Transaldolase

Overview
NameTransaldolase
Smed IDSMED30008785
Length (bp)1176
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transaldolase (SMED30008785) t-SNE clustered cells

Violin plots show distribution of expression levels for Transaldolase (SMED30008785) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transaldolase (SMED30008785) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transaldolase (SMED30008785) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008785

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008785SMESG000037474.1 SmedASXL_001430SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30008785SMESG000037474.1 dd_Smed_v4_9485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008785SMESG000037474.1 dd_Smed_v6_9485_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30008785SMESG000037474.1 OX_Smed_1.0.14593ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30008785SMESG000037474.1 Contig33147newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30008785SMESG000037474.1 Contig33147uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30008785SMESG000037474.1 Contig33147newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30008785SMESG000037474.1 Contig33147uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008785SMESG000037474.1 Contig33147newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008785SMESG000037474.1 Contig33147uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30008785SMESG000037474.1 dd_Smed_v4_9485_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transaldolase vs. Ensembl Human
Match: TALDO1 (transaldolase 1 [Source:HGNC Symbol;Acc:HGNC:11559])

HSP 1 Score: 354.369 bits (908), Expect = 1.093e-120
Identity = 188/322 (58.39%), Postives = 238/322 (73.91%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + LDQLK+ T +VADTGDF +I +Y+P DATTNPSLI AAA++P Y  L++ A+ YG+      ++Q+  A++KL V FG EILK IPGRVSTEVDAR SFDK+A +A++  +I+LY+E GIS+DRILIKLSSTWEGIQA  ELE++H IHCN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL      +   L+ +AA+  ++   K  + E  FR+  NED+MA +KLS+GIRKF+ADA  LE +L  ++
Sbjct:   11 MESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDL--EKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERMLTERM 330          
BLAST of Transaldolase vs. Ensembl Human
Match: TALDO1 (transaldolase 1 [Source:HGNC Symbol;Acc:HGNC:11559])

HSP 1 Score: 313.538 bits (802), Expect = 7.043e-105
Identity = 162/256 (63.28%), Postives = 198/256 (77.34%), Query Frame = 3
Query:   57 KNFMATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEEL 824
            +  M + LDQLK+ T +VADTGDF +I +Y+P DATTNPSLI AAA++P Y  L++ A+ YG+      ++Q+  A++KL V FG EILK IPGRVSTEVDAR SFDK+A +A++  +I+LY+E GIS+DRILIKLSSTWEGIQA  ELE++H IHCN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL
Sbjct:    8 RQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGEL 263          
BLAST of Transaldolase vs. Ensembl Human
Match: TALDO1 (transaldolase 1 [Source:HGNC Symbol;Acc:HGNC:11559])

HSP 1 Score: 77.7962 bits (190), Expect = 3.007e-17
Identity = 37/68 (54.41%), Postives = 49/68 (72.06%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKE 269
            M + LDQLK+ T +VADTGDF +I +Y+P DATTNPSLI AAA++P Y  L++ A+ YG+      KE
Sbjct:   11 MESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGNTKE 78          
BLAST of Transaldolase vs. Ensembl Celegans
Match: tald-1 (Transaldolase [Source:UniProtKB/TrEMBL;Acc:Q8T876])

HSP 1 Score: 349.362 bits (895), Expect = 2.508e-119
Identity = 187/321 (58.26%), Postives = 236/321 (73.52%), Query Frame = 3
Query:   72 TILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAK-LDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            ++L+QLK  + +VADTGDF +I +++P DATTNPSLI AA+K+ +Y  LID +V Y K  +   +E L  AM++L V FG EILK IPGRVSTEVDAR SFD  A I ++L +I  YE+ GIS+DRILIKL+STWEGI+AA  LE KH IHCN+TLLF F QAVACA++GVTLISPFVGRI DW +    +K Y   +DPGV+SV+ I+ YYKK + KT++M ASFRN  +I GL GCD LTISPALL++L + T   PV L+   AK LD  +P K  I E  FR+ LNED MAT+KL+EGIR F+ DAR+LE L+  K+
Sbjct:    2 SVLEQLKGASVVVADTGDFNAIKEFQPTDATTNPSLILAASKMEQYAALIDQSVAYAKEHASGHQEVLQAAMDRLFVVFGKEILKTIPGRVSTEVDARLSFDTQASIDRALGLIAQYEKEGISKDRILIKLASTWEGIRAAKFLESKHGIHCNMTLLFNFEQAVACAESGVTLISPFVGRIMDWFVKNTDQKAYTRKDDPGVVSVTRIFNYYKKYDYKTQVMAASFRNTEEIKGLVGCDLLTISPALLKQLAAETELAPVVLSTSHAKTLD--LP-KVSIDEKAFRWALNEDAMATEKLAEGIRNFAKDARTLEKLIEAKI 319          
BLAST of Transaldolase vs. Ensembl Celegans
Match: tald-1 (Transaldolase [Source:UniProtKB/TrEMBL;Acc:Q8T876])

HSP 1 Score: 349.362 bits (895), Expect = 2.508e-119
Identity = 187/321 (58.26%), Postives = 236/321 (73.52%), Query Frame = 3
Query:   72 TILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAK-LDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            ++L+QLK  + +VADTGDF +I +++P DATTNPSLI AA+K+ +Y  LID +V Y K  +   +E L  AM++L V FG EILK IPGRVSTEVDAR SFD  A I ++L +I  YE+ GIS+DRILIKL+STWEGI+AA  LE KH IHCN+TLLF F QAVACA++GVTLISPFVGRI DW +    +K Y   +DPGV+SV+ I+ YYKK + KT++M ASFRN  +I GL GCD LTISPALL++L + T   PV L+   AK LD  +P K  I E  FR+ LNED MAT+KL+EGIR F+ DAR+LE L+  K+
Sbjct:    2 SVLEQLKGASVVVADTGDFNAIKEFQPTDATTNPSLILAASKMEQYAALIDQSVAYAKEHASGHQEVLQAAMDRLFVVFGKEILKTIPGRVSTEVDARLSFDTQASIDRALGLIAQYEKEGISKDRILIKLASTWEGIRAAKFLESKHGIHCNMTLLFNFEQAVACAESGVTLISPFVGRIMDWFVKNTDQKAYTRKDDPGVVSVTRIFNYYKKYDYKTQVMAASFRNTEEIKGLVGCDLLTISPALLKQLAAETELAPVVLSTSHAKTLD--LP-KVSIDEKAFRWALNEDAMATEKLAEGIRNFAKDARTLEKLIEAKI 319          
BLAST of Transaldolase vs. Ensembl Celegans
Match: tald-1 (Transaldolase [Source:UniProtKB/TrEMBL;Acc:Q8T876])

HSP 1 Score: 164.081 bits (414), Expect = 3.803e-49
Identity = 96/168 (57.14%), Postives = 121/168 (72.02%), Query Frame = 3
Query:  531 LTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAK-LDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            +TLLF F QAVACA++GVTLISPFVGRI DW +    +K Y   +DPGV+SV+ I+ YYKK + KT++M ASFRN  +I GL GCD LTISPALL++L + T   PV L+   AK LD  +P K  I E  FR+ LNED MAT+KL+EGIR F+ DAR+LE L+  K+
Sbjct:    1 MTLLFNFEQAVACAESGVTLISPFVGRIMDWFVKNTDQKAYTRKDDPGVVSVTRIFNYYKKYDYKTQVMAASFRNTEEIKGLVGCDLLTISPALLKQLAAETELAPVVLSTSHAKTLD--LP-KVSIDEKAFRWALNEDAMATEKLAEGIRNFAKDARTLEKLIEAKI 165          
BLAST of Transaldolase vs. Ensembl Celegans
Match: tald-1 (Transaldolase [Source:UniProtKB/TrEMBL;Acc:Q8T876])

HSP 1 Score: 164.081 bits (414), Expect = 3.803e-49
Identity = 96/168 (57.14%), Postives = 121/168 (72.02%), Query Frame = 3
Query:  531 LTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAK-LDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            +TLLF F QAVACA++GVTLISPFVGRI DW +    +K Y   +DPGV+SV+ I+ YYKK + KT++M ASFRN  +I GL GCD LTISPALL++L + T   PV L+   AK LD  +P K  I E  FR+ LNED MAT+KL+EGIR F+ DAR+LE L+  K+
Sbjct:    1 MTLLFNFEQAVACAESGVTLISPFVGRIMDWFVKNTDQKAYTRKDDPGVVSVTRIFNYYKKYDYKTQVMAASFRNTEEIKGLVGCDLLTISPALLKQLAAETELAPVVLSTSHAKTLD--LP-KVSIDEKAFRWALNEDAMATEKLAEGIRNFAKDARTLEKLIEAKI 165          
BLAST of Transaldolase vs. Ensembl Celegans
Match: tald-1 (Transaldolase [Source:UniProtKB/TrEMBL;Acc:Q8T876])

HSP 1 Score: 164.081 bits (414), Expect = 3.803e-49
Identity = 96/168 (57.14%), Postives = 121/168 (72.02%), Query Frame = 3
Query:  531 LTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAK-LDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            +TLLF F QAVACA++GVTLISPFVGRI DW +    +K Y   +DPGV+SV+ I+ YYKK + KT++M ASFRN  +I GL GCD LTISPALL++L + T   PV L+   AK LD  +P K  I E  FR+ LNED MAT+KL+EGIR F+ DAR+LE L+  K+
Sbjct:    1 MTLLFNFEQAVACAESGVTLISPFVGRIMDWFVKNTDQKAYTRKDDPGVVSVTRIFNYYKKYDYKTQVMAASFRNTEEIKGLVGCDLLTISPALLKQLAAETELAPVVLSTSHAKTLD--LP-KVSIDEKAFRWALNEDAMATEKLAEGIRNFAKDARTLEKLIEAKI 165          
BLAST of Transaldolase vs. Ensembl Fly
Match: Taldo (gene:FBgn0023477 transcript:FBtr0072141)

HSP 1 Score: 346.28 bits (887), Expect = 7.276e-118
Identity = 183/321 (57.01%), Postives = 233/321 (72.59%), Query Frame = 3
Query:   72 TILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKLE 1034
            ++L +LKK T IVADTGDF++I  Y+P DATTNPSLI +A+ +  Y  L+  AV Y K K   + EQ+  AM+ L V FG EILK++PGRVSTE+DAR SFD    + K+L +I LY+  G+ ++RILIKL+STWEGI+AA  LE +H +HCNLTLLF+F QAVACA+AGVTLISPFVGRI DW+++    K +E  +DPGVISV+ IY YYKK   KT +MGASFRNV +I  L GCD LTISPALL+EL + T  +   L+   AKL ++   K  + E+ FR+ LNED MATDKLSEGIRKF+ D   LENL++  L+
Sbjct:   13 SVLQELKKITTIVADTGDFEAINIYKPTDATTNPSLILSASSMERYQPLVQKAVEYAKGKKGSVSEQVAEAMDYLCVLFGTEILKVVPGRVSTEIDARLSFDTKKSVEKALKLIALYKSLGVDKERILIKLASTWEGIKAAEILENEHGVHCNLTLLFSFAQAVACAEAGVTLISPFVGRILDWYVANTDTKKFEALKDPGVISVTNIYNYYKKFGYKTLVMGASFRNVGEIKALAGCDLLTISPALLKELENETESVVTYLSVSNAKLQDI--EKITVDESRFRWLLNEDAMATDKLSEGIRKFAVDTVKLENLIKTYLK 331          
BLAST of Transaldolase vs. Ensembl Zebrafish
Match: taldo1 (transaldolase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3277])

HSP 1 Score: 318.546 bits (815), Expect = 1.812e-107
Identity = 164/270 (60.74%), Postives = 203/270 (75.19%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAK 875
            M + L+Q+KK T +VADTGDF +I +Y+P DATTNPSLI AAAK+P Y  L+D A+ YG +      EQ+  AM+KL VNFG+EILK +PGRVSTEVDAR SFDK+A ++++  +I LYE+ GIS++RILIKLSSTWEGIQA  ELE+ H IHCN+TLLF+F QAVACA+A VTLISPFVGRI DW+     +K YE  EDPGV+SV+ IY YYKK + +T +MGASFRN+ ++  L GCD LTISPALLEEL+     I   L  Q  K
Sbjct:   11 MESALEQIKKFTVVVADTGDFNAIEEYKPQDATTNPSLILAAAKMPAYQPLVDQAIKYGTANGGTEDEQVTNAMDKLFVNFGLEILKKVPGRVSTEVDARLSFDKDAMVSRARRLISLYEDAGISKERILIKLSSTWEGIQAGRELEEIHGIHCNMTLLFSFAQAVACAEARVTLISPFVGRILDWYKENTERKTYEPHEDPGVLSVTKIYNYYKKFDYRTVVMGASFRNIGEVKALAGCDLLTISPALLEELSQDHSAITCTLTPQTGK 280          
BLAST of Transaldolase vs. Ensembl Xenopus
Match: taldo1 (transaldolase 1 [Source:NCBI gene;Acc:549885])

HSP 1 Score: 343.584 bits (880), Expect = 1.956e-116
Identity = 182/321 (56.70%), Postives = 235/321 (73.21%), Query Frame = 3
Query:   69 ATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            ++ LDQLK+ T +VADTGDF +I  Y+P DATTNPSLI AAA++P+Y  L+ +A+ YG++     +EQ++  M+KL V FG+EILK IPGRVSTEVDAR SFDK+  + ++  +I LY+E GI ++RILIKLSSTWEGIQA   LE+++ IHCN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL   +  +   L  + A+  N+   K  + E +FR+  NED+MA +KLS+GIRKF+ DA  LE +L+ +L
Sbjct:   14 SSALDQLKQHTVVVADTGDFNAIEVYKPQDATTNPSLILAAAQMPDYQGLVKDAIQYGRNLGGSEEEQINNIMDKLFVLFGVEILKKIPGRVSTEVDARLSFDKDGMVKRAKRLIALYKEAGIDKERILIKLSSTWEGIQAGKILEEEYGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANSDKKSYEPSEDPGVKSVAKIYNYYKKFGYKTIVMGASFRNTGEIKALTGCDYLTISPKLLGELAKDSSKLTPVLTVKEAQASNL--EKVHLEEKDFRWLHNEDQMAVEKLSDGIRKFAIDAVKLEKMLKERL 332          
BLAST of Transaldolase vs. Ensembl Xenopus
Match: taldo1 (transaldolase 1 [Source:NCBI gene;Acc:549885])

HSP 1 Score: 283.493 bits (724), Expect = 3.502e-93
Identity = 165/321 (51.40%), Postives = 215/321 (66.98%), Query Frame = 3
Query:   69 ATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            ++ LDQLK+ T +VADTGDF +I  Y+P DATTNPSLI AAA++P+Y  L+ +A+ YG++     +EQ++  M+KL V FG+EILK IPGRVSTEVDAR SFDK+  + ++       ++N          L  T+ GI        K+ IHCN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL   +  +   L  + A+  N+   K  + E +FR+  NED+MA +KLS+GIRKF+ DA  LE +L+ +L
Sbjct:   14 SSALDQLKQHTVVVADTGDFNAIEVYKPQDATTNPSLILAAAQMPDYQGLVKDAIQYGRNLGGSEEEQINNIMDKLFVLFGVEILKKIPGRVSTEVDARLSFDKDGMVKRA-------KQN---------HLELTF-GISNCC----KYGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANSDKKSYEPSEDPGVKSVAKIYNYYKKFGYKTIVMGASFRNTGEIKALTGCDYLTISPKLLGELAKDSSKLTPVLTVKEAQASNL--EKVHLEEKDFRWLHNEDQMAVEKLSDGIRKFAIDAVKLEKMLKERL 311          
BLAST of Transaldolase vs. Ensembl Xenopus
Match: ENSXETT00000018550.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:18225379:18229841:1 gene:ENSXETG00000008025.1 transcript:ENSXETT00000018550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.388 bits (677), Expect = 4.372e-86
Identity = 146/258 (56.59%), Postives = 183/258 (70.93%), Query Frame = 3
Query:  252 SKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRV 1025
            S+  +EQ++  M+KL V FG+EILK IPGRVST+VDAR SFDK+  + ++  +I LY+E GI ++RILIKLSSTWEGIQA   LE+++ IHCN+TLLF+F QAVACA+AGVTL SPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL   +  +   L  +  K D      +E  E +FR+  NE +MA +KLS GIRKF+ DA  LE +L+V
Sbjct:   50 SRSEEEQINNIMDKLFVLFGVEILKKIPGRVSTDVDARLSFDKDGMVKRAKRLIALYKEAGIDKERILIKLSSTWEGIQAGKILEEEYGIHCNMTLLFSFAQAVACAEAGVTLFSPFVGRILDWHVANSDKKSYEPSEDPGVKSVAKIYNYYKKFGYKTIVMGASFRNTGEIKALTGCDYLTISPKLLGELAKDSSKLTPVLTVKEGKFDPFRKCTWE--EKDFRWLHNEHQMAVEKLSNGIRKFAIDAIKLEKMLKV 305          
BLAST of Transaldolase vs. Ensembl Xenopus
Match: ENSXETT00000028919.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:38092407:38097193:1 gene:ENSXETG00000005023.1 transcript:ENSXETT00000028919.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.914 bits (655), Expect = 1.031e-82
Identity = 143/259 (55.21%), Postives = 182/259 (70.27%), Query Frame = 3
Query:  252 SKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEID--EDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLR 1022
            S+  +EQ++  M+KL V FG+EILK IPGRVST+VDAR SFDK+  + ++  +I LY+E GI ++RILIKLSSTWEGIQA   LE+++ IHCN+TLLF+F QAVACA+AGVTL SPFVGRI DWH++   KK Y+       GV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL   +  +   L  +  K D   P K  + E +FR+  NED+MA +KLS+GIRKF+ DA  LE +L+
Sbjct:   58 SRSEEEQINNIMDKLFVLFGVEILKKIPGRVSTDVDARLSFDKDGMVKRAKRLIALYKEAGIDKERILIKLSSTWEGIQAGKILEEEYGIHCNMTLLFSFAQAVACAEAGVTLFSPFVGRILDWHVANSDKKSYDKQCVFSLGVKSVAKIYNYYKKFGYKTIVMGASFRNTGEIKALTGCDYLTISPKLLGELAKDSSKLTPVLTVKEGKFD---PFKVHLEEKDFRWLHNEDQMAVEKLSDGIRKFAIDAVKLEKMLK 313          
BLAST of Transaldolase vs. Ensembl Xenopus
Match: ENSXETT00000012783.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:38092151:38097193:1 gene:ENSXETG00000005023.1 transcript:ENSXETT00000012783.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 255.758 bits (652), Expect = 3.474e-82
Identity = 143/258 (55.43%), Postives = 181/258 (70.16%), Query Frame = 3
Query:  264 KEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVIS-VSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIP----HKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLR 1022
            +EQ++  M+KL V FG+EILK IPGRVST+VDAR SFDK+  + ++  +I LY+E GI ++RILIKLSSTWEGIQA   LE+++ IHCN+TLLF+F QAVACA+AGVTL SPFVGRI DWH++   KK YE  EDP +   V+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL E           L K ++KL  V+      K  + E +FR+  NED+MA +KLS+GIRKF+ DA  LE +L+
Sbjct:   72 EEQINNIMDKLFVLFGVEILKKIPGRVSTDVDARLSFDKDGMVKRAKRLIALYKEAGIDKERILIKLSSTWEGIQAGKILEEEYGIHCNMTLLFSFAQAVACAEAGVTLFSPFVGRILDWHVANSDKKSYEPSEDPAIYPVVAKIYNYYKKFGYKTIVMGASFRNTGEIKALTGCDYLTISPKLLGE-----------LAKDSSKLTPVLTASNLEKVHLEEKDFRWLHNEDQMAVEKLSDGIRKFAIDAVKLEKMLK 318          
BLAST of Transaldolase vs. Ensembl Mouse
Match: Taldo1 (transaldolase 1 [Source:MGI Symbol;Acc:MGI:1274789])

HSP 1 Score: 354.755 bits (909), Expect = 5.589e-121
Identity = 188/322 (58.39%), Postives = 236/322 (73.29%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + LDQLK+ T +VADTGDF +I +Y+P DATTNPSLI AAA++P Y  L++ A+ YGK      +EQ+  A++KL V FG EILK IPGRVSTEVDAR SFDK+A +A++  +I+LY+E G+ +DRILIKLSSTWEGIQA  ELE++H IHCN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL      +   L+ +AA+  +    K  + E  FR+  NED+MA +KLS+GIRKF+ADA  LE +L  ++
Sbjct:   11 MESALDQLKQFTTVVADTGDFNAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGKKLGGPQEEQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGVGKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLKDNSKLAPALSVKAAQTSD--SEKIHLDEKAFRWLHNEDQMAVEKLSDGIRKFAADAIKLERMLTERM 330          
BLAST of Transaldolase vs. Ensembl Mouse
Match: Taldo1 (transaldolase 1 [Source:MGI Symbol;Acc:MGI:1274789])

HSP 1 Score: 332.028 bits (850), Expect = 2.161e-111
Identity = 189/367 (51.50%), Postives = 237/367 (64.58%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDF---------------------------------------------KSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + LDQLK+ T +VADTGDF                                             K+I +Y+P DATTNPSLI AAA++P Y  L++ A+ YGK      +EQ+  A++KL V FG EILK IPGRVSTEVDAR SFDK+A +A++  +I+LY+E G+ +DRILIKLSSTWEGIQA  ELE++H IHCN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL      +   L+ +AA+  +    K  + E  FR+  NED+MA +KLS+GIRKF+ADA  LE +L  ++
Sbjct:   11 MESALDQLKQFTTVVADTGDFNGCFVASLWSCCEHCHCDPLGIAAGHCFPSLVTAASGHSDKHLREKAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGKKLGGPQEEQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGVGKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLKDNSKLAPALSVKAAQTSD--SEKIHLDEKAFRWLHNEDQMAVEKLSDGIRKFAADAIKLERMLTERM 375          
BLAST of Transaldolase vs. UniProt/SwissProt
Match: sp|Q9EQS0|TALDO_RAT (Transaldolase OS=Rattus norvegicus OX=10116 GN=Taldo1 PE=1 SV=2)

HSP 1 Score: 359.377 bits (921), Expect = 6.501e-122
Identity = 191/322 (59.32%), Postives = 239/322 (74.22%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + LDQLK+ T +VADTGDF +I +Y+P DATTNPSLI AAA++P Y  L++ A+ YGK      +EQ+  A++KL V FG EILK IPGRVSTEVDAR SFDK+A +A++  II+LY+E GIS+DRILIKLSSTWEGIQA  ELE++H IHCN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL   +  +   L+ +AA+  ++   K  + E  FR+  NED+MA +KLS+GIRKF+ADA  LE +L  ++
Sbjct:   11 MESALDQLKQFTTVVADTGDFNAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGKKLGGPQEEQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRIIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLKDSSKLAPTLSVKAAQTSDL--EKIHLDEKAFRWLHNEDQMAVEKLSDGIRKFAADAIKLERMLTERM 330          
BLAST of Transaldolase vs. UniProt/SwissProt
Match: sp|Q93092|TALDO_MOUSE (Transaldolase OS=Mus musculus OX=10090 GN=Taldo1 PE=1 SV=2)

HSP 1 Score: 354.755 bits (909), Expect = 3.910e-120
Identity = 188/322 (58.39%), Postives = 236/322 (73.29%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + LDQLK+ T +VADTGDF +I +Y+P DATTNPSLI AAA++P Y  L++ A+ YGK      +EQ+  A++KL V FG EILK IPGRVSTEVDAR SFDK+A +A++  +I+LY+E G+ +DRILIKLSSTWEGIQA  ELE++H IHCN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL      +   L+ +AA+  +    K  + E  FR+  NED+MA +KLS+GIRKF+ADA  LE +L  ++
Sbjct:   11 MESALDQLKQFTTVVADTGDFNAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGKKLGGPQEEQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGVGKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLKDNSKLAPALSVKAAQTSD--SEKIHLDEKAFRWLHNEDQMAVEKLSDGIRKFAADAIKLERMLTERM 330          
BLAST of Transaldolase vs. UniProt/SwissProt
Match: sp|P37837|TALDO_HUMAN (Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2)

HSP 1 Score: 354.369 bits (908), Expect = 5.247e-120
Identity = 188/322 (58.39%), Postives = 238/322 (73.91%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + LDQLK+ T +VADTGDF +I +Y+P DATTNPSLI AAA++P Y  L++ A+ YG+      ++Q+  A++KL V FG EILK IPGRVSTEVDAR SFDK+A +A++  +I+LY+E GIS+DRILIKLSSTWEGIQA  ELE++H IHCN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL      +   L+ +AA+  ++   K  + E  FR+  NED+MA +KLS+GIRKF+ADA  LE +L  ++
Sbjct:   11 MESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDL--EKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERMLTERM 330          
BLAST of Transaldolase vs. UniProt/SwissProt
Match: sp|Q8VI73|TALDO_CRIGR (Transaldolase OS=Cricetulus griseus OX=10029 GN=TALDO1 PE=2 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 8.291e-120
Identity = 189/322 (58.70%), Postives = 238/322 (73.91%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + LDQLK+ T +VADTGDF +I +Y+P DATTNPSLI AAA++P Y  L++ A+ YGK      +EQ+  A++KL V FG EILK IPGRVSTEVDAR SFDK+A +A++  +I+LY+E GIS+DRILIKLSSTWEGIQA  ELE++H IHCN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL      +   L+ +AA+  ++   K  + E  FR+  +ED+MA +KLS+GIRKF+ADA  LE +L  ++
Sbjct:   11 MESALDQLKQFTTVVADTGDFNAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGKKLGGPQEEQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARAKRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLKDNTKLAPVLSIKAAQTSDL--GKIHLDEKAFRWLHSEDQMAVEKLSDGIRKFAADAIKLERMLTERM 330          
BLAST of Transaldolase vs. UniProt/SwissProt
Match: sp|Q2TBL6|TALDO_BOVIN (Transaldolase OS=Bos taurus OX=9913 GN=TALDO1 PE=2 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 1.201e-119
Identity = 187/322 (58.07%), Postives = 236/322 (73.29%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M   LDQLK+ T +VADTGDF +I +Y+P DATTNPSLI AAA++P Y  L++ A+ YG+      +EQ+  A++KL V FG EILK IPGRVSTEVDAR SFDK+A +A++  +I+LY+E GIS++RILIKLSSTWEGIQA  ELE+ H I CN+TLLF+F QAVACA+AGVTLISPFVGRI DWH++   KK YE  EDPGV SV+ IY YYKK   KT +MGASFRN  +I  L GCD LTISP LL EL      +   L+ +AA+  ++   K ++ E  FR+  NED MA +KLS+GIR+F+ADA  LE +LR ++
Sbjct:   11 MENALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPTYQELVEEAIAYGRKLGGSQEEQITNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKERILIKLSSTWEGIQAGKELEEHHGIRCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYETQEDPGVKSVTKIYNYYKKFGYKTIVMGASFRNTGEIKALAGCDFLTISPQLLGELLKDHSKLTPVLSAKAAQASDL--EKIQLDEKAFRWLHNEDRMAVEKLSDGIRRFAADAVKLERMLRERM 330          
BLAST of Transaldolase vs. TrEMBL
Match: A0A3M7PL53 (Transaldolase OS=Brachionus plicatilis OX=10195 GN=BpHYR1_030705 PE=3 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 8.881e-131
Identity = 201/322 (62.42%), Postives = 250/322 (77.64%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M   L++ K+ T +VADTGDF+++ KY+P DATTNPSL+ AA + P+Y  L+D A+ Y K  S  + EQ+  A  KL V FG+EILKI+PGRVSTEVDAR SFDK  QI K+L+ I+LYE+ G+S++RILIKLSSTWEGIQAA ELE+KH IHCNLTLLF+F QAVACA+AGVTLISPFVGRIYDWH+ K G K +++ EDPGV SV+ IY YYKKN  KT++MGASFRN+ +I  LCGCD LTISP+LLEEL+++  +  V LN + AK   V   K  + EA+FR+  NEDEMA+DKLSEGIRKF+ADA  LE+L+R  L
Sbjct:    1 MTNFLEKFKQNTVVVADTGDFEAMKKYKPTDATTNPSLLLAATQQPQYKHLLDQAIEYAKQNSSNVDEQVSLASEKLFVLFGLEILKIVPGRVSTEVDARLSFDKETQIQKALNFIKLYEQAGVSKERILIKLSSTWEGIQAAKELEEKHGIHCNLTLLFSFAQAVACAEAGVTLISPFVGRIYDWHVQKKGIKEFDLLEDPGVKSVTKIYNYYKKNGYKTQVMGASFRNIKEIQALCGCDLLTISPSLLEELSNLPGEPNVYLNAENAK--QVGDEKISLDEAKFRYMHNEDEMASDKLSEGIRKFAADAIKLEDLIRKNL 320          
BLAST of Transaldolase vs. TrEMBL
Match: W6UNT9 (Transaldolase OS=Echinococcus granulosus OX=6210 GN=EGR_10111 PE=3 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 1.585e-130
Identity = 205/322 (63.66%), Postives = 249/322 (77.33%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + LD LK+ T +VADTGDF SI K+ P DATTNPSLI AA+K+P+Y  +I+ AV   K+KS  L+EQ++ A +   V FG EILKIIPGRVSTEVDAR SFDK+ QI K+L +I LY E GIS++RILIKLSSTWEGIQAA ELE KH +HCNLTLLF+F QAVACA+A VTLISPFVGRIYDW+++K G+  +   +DPGV+SV+ IY YYKK   +TEIMGASFRNVNQI+GL GCD LTISP+LLE L SM   +PV L+ + A   +       + EA FR+ +NEDEMATDKLSEGIRKF+AD+R+LE LLR +L
Sbjct:    1 MPSTLDLLKQTTIVVADTGDFDSIRKFLPTDATTNPSLILAASKMPKYSEIIEEAVRIAKTKSDSLEEQVEIASDYTFVMFGEEILKIIPGRVSTEVDARLSFDKDKQIEKALRLIALYAEKGISKERILIKLSSTWEGIQAAKELELKHGVHCNLTLLFSFFQAVACAEANVTLISPFVGRIYDWYVAKKGQIEFTRLDDPGVLSVTQIYNYYKKFGYETEIMGASFRNVNQILGLVGCDLLTISPSLLESLASMDEVVPVALDAKLASSRSKYESPLHLDEAAFRWAMNEDEMATDKLSEGIRKFAADSRTLECLLRARL 322          
BLAST of Transaldolase vs. TrEMBL
Match: A0A068X2F0 (Transaldolase OS=Echinococcus granulosus OX=6210 GN=EgrG_000092800 PE=3 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 1.611e-130
Identity = 205/322 (63.66%), Postives = 249/322 (77.33%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + LD LK+ T +VADTGDF SI K+ P DATTNPSLI AA+K+P+Y  +I+ AV   K+KS  L+EQ++ A +   V FG EILKIIPGRVSTEVDAR SFDK+ QI K+L +I LY E GIS++RILIKLSSTWEGIQAA ELE KH +HCNLTLLF+F QAVACA+A VTLISPFVGRIYDW+++K G+  +   +DPGV+SV+ IY YYKK   +TEIMGASFRNVNQI+GL GCD LTISP+LLE L SM   +PV L+ + A   +       + EA FR+ +NEDEMATDKLSEGIRKF+AD+R+LE LLR +L
Sbjct:    4 MPSTLDLLKQTTIVVADTGDFDSIRKFLPTDATTNPSLILAASKMPKYSEIIEEAVRIAKTKSDSLEEQVEIASDYTFVMFGEEILKIIPGRVSTEVDARLSFDKDKQIEKALRLIALYAEKGISKERILIKLSSTWEGIQAAKELELKHGVHCNLTLLFSFFQAVACAEANVTLISPFVGRIYDWYVAKKGQIEFTRLDDPGVLSVTQIYNYYKKFGYETEIMGASFRNVNQILGLVGCDLLTISPSLLESLASMDEVVPVALDAKLASSRSKYESPLHLDEAAFRWAMNEDEMATDKLSEGIRKFAADSRTLECLLRARL 325          
BLAST of Transaldolase vs. TrEMBL
Match: A0A2Z5RDX3 (Transaldolase OS=Reticulitermes speratus OX=60591 GN=RsTAD PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 1.836e-130
Identity = 202/327 (61.77%), Postives = 249/327 (76.15%), Query Frame = 3
Query:   57 KNFMATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKLEK 1037
            K  M++ L QLK  T +VADTGDF++I +Y+P DATTNPSLI +AA +P+Y  LI  AV YG+S      EQL+ A +KL+V FG EILKI+PGRVSTEVDAR SFDK A I K+  +IQLYEE G+ RDRILIKL+STWEGIQAA ELE+++ IHCNLTLLF+FCQAVACA+AGVTLISPFVGRI DW+++   +K +E DEDPGVISV+ IY YYKK   KT +MGASFRNV +I  L GCD LTISP LLEEL+S   ++   L +++A+  +V   K  + E  FR+ LNED+MA+DKLSEGIRKF+ D+R LE LL+  L K
Sbjct:    9 KKKMSSSLAQLKNFTTVVADTGDFEAIKQYKPTDATTNPSLILSAASMPQYKHLITKAVEYGRSTGNRPAEQLEAASDKLVVLFGNEILKIVPGRVSTEVDARLSFDKEASIQKAKRLIQLYEEQGVDRDRILIKLASTWEGIQAAKELEERYGIHCNLTLLFSFCQAVACAEAGVTLISPFVGRILDWYVANTDQKTFEPDEDPGVISVTKIYNYYKKYGYKTVVMGASFRNVGEIKALAGCDLLTISPKLLEELDSSNKEVFESLTEKSARKADV--EKVTLDEKTFRWMLNEDQMASDKLSEGIRKFAEDSRKLEKLLKEHLSK 333          
BLAST of Transaldolase vs. TrEMBL
Match: A0A023GIL9 (Transaldolase OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 2.543e-130
Identity = 203/324 (62.65%), Postives = 254/324 (78.40%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNK-QAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKLE 1034
            M++ LDQLK+ T +VADTGDF+ + +Y+P DATTNPSLI AA+K+P+Y  L+D AV YGKS  K + EQ+  AM+KL+V FG EILKIIPGRVSTEVDAR SF+K A IAK+L +I LY+E+GI + RILIKL+S+WEGIQAA  LE +H IHCN+TLLF F QAVACA+AGVTLISPFVGRI DWH++   +K +E  EDPGV SV+ IY+YYK++  KT +MGASFRNV Q+  L GCD LTISP LL+EL +    I   L++ +A KLD     K E++EA FR++LNED+MATDKLS+GIRKF+ADA  LEN+LR KL+
Sbjct:   14 MSSSLDQLKEVTTVVADTGDFEVMKQYKPTDATTNPSLILAASKLPQYAHLVDEAVKYGKSNGKTVDEQVTSAMDKLVVLFGTEILKIIPGRVSTEVDARLSFNKEASIAKALHLIALYKEHGIDKKRILIKLASSWEGIQAAKILESQHGIHCNMTLLFNFTQAVACAEAGVTLISPFVGRILDWHVANTSQKSFEPLEDPGVKSVTRIYEYYKRHGYKTVVMGASFRNVGQVRALAGCDLLTISPGLLQELANSKEPIVHHLSEAKAKKLDM---KKVEVNEATFRWELNEDQMATDKLSDGIRKFAADAVKLENILREKLK 334          
BLAST of Transaldolase vs. Ensembl Cavefish
Match: taldo1 (transaldolase 1 [Source:NCBI gene;Acc:103029185])

HSP 1 Score: 350.132 bits (897), Expect = 2.941e-119
Identity = 189/325 (58.15%), Postives = 235/325 (72.31%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAK---LDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + LDQLKK T +VADTGDF +I +Y+P DATTNPSLI AAAK+  Y  L+D A+ +G +     +EQL   ++KL VNFG+EILK IPGRVSTEVDAR SFDK+A + ++  +I LYEE GIS+DR+LIKLSSTWEGIQA  ELE+K+ IHCN+TLLF+F QAVACA+A VTLISPFVGRI DW+     +K YE  EDPGV+SV+ IY YYKK   +T +MGASFRN+ ++  L GCD LTISP LL EL+     I   L  Q+AK   LD V      + E  FR+  NED MA +KLS+GIRKF+ADA  LE +++ K+
Sbjct:   11 MESALDQLKKFTVVVADTGDFNAIEEYKPQDATTNPSLILAAAKMSAYQQLVDQAIKFGIANGGTEEEQLINTVDKLFVNFGLEILKKIPGRVSTEVDARLSFDKDAMVTRARRLISLYEEAGISKDRVLIKLSSTWEGIQAGRELEEKYGIHCNMTLLFSFAQAVACAEARVTLISPFVGRILDWYKENTDRKSYEPHEDPGVLSVTKIYNYYKKFGYQTVVMGASFRNIGEVKALAGCDLLTISPGLLGELSKDHSAISCALTPQSAKECDLDKV-----HLDEKAFRWLHNEDRMAVEKLSDGIRKFAADAVKLETMIKEKM 330          
BLAST of Transaldolase vs. Ensembl Cavefish
Match: taldo1 (transaldolase 1 [Source:NCBI gene;Acc:103029185])

HSP 1 Score: 311.227 bits (796), Expect = 1.951e-104
Identity = 164/270 (60.74%), Postives = 201/270 (74.44%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAK 875
            M + LDQLKK T +VADTGDF +I +Y+P DATTNPSLI AAAK+  Y  L+D A+ +G +     +EQL   ++KL VNFG+EILK IPGRVSTEVDAR SFDK+A + ++  +I LYEE GIS+DR+LIKLSSTWEGIQA  ELE+K+ IHCN+TLLF+F QAVACA+A VTLISPFVGRI DW+     +K YE  EDPGV+SV+ IY YYKK   +T +MGASFRN+ ++  L GCD LTISP LL EL+     I   L  Q+AK
Sbjct:   11 MESALDQLKKFTVVVADTGDFNAIEEYKPQDATTNPSLILAAAKMSAYQQLVDQAIKFGIANGGTEEEQLINTVDKLFVNFGLEILKKIPGRVSTEVDARLSFDKDAMVTRARRLISLYEEAGISKDRVLIKLSSTWEGIQAGRELEEKYGIHCNMTLLFSFAQAVACAEARVTLISPFVGRILDWYKENTDRKSYEPHEDPGVLSVTKIYNYYKKFGYQTVVMGASFRNIGEVKALAGCDLLTISPGLLGELSKDHSAISCALTPQSAK 280          
BLAST of Transaldolase vs. Ensembl Yeast
Match: TAL1 (Transaldolase, enzyme in the non-oxidative pentose phosphate pathway; converts sedoheptulose 7-phosphate and glyceraldehyde 3-phosphate to erythrose 4-phosphate and fructose 6-phosphate; TAL1 has a paralog, NQM1, that arose from the whole genome duplication [Source:SGD;Acc:S000004346])

HSP 1 Score: 347.051 bits (889), Expect = 6.390e-119
Identity = 191/319 (59.87%), Postives = 237/319 (74.29%), Query Frame = 3
Query:   78 LDQLKKQ-TKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            L+QLK   T +VADTGDF SI K++P D+TTNPSLI AAAK P Y  LID AV YGK   K  +EQ++ A+++L+V FG EILKI+PGRVSTEVDAR SFD  A I K+  II+L+E+ G+S++R+LIK++STWEGIQAA ELE+K  IHCNLTLLF+F QAVACA+A VTLISPFVGRI DW+ S  GK  Y+ + DPGVISV  IY YYKK   KT +MGASFR+ ++I  L G D LTISPALL++L + T   P  L+  +AK +      Y   E++FRF LNED MAT+KLSEGIRKFSAD  +L +L+  K+
Sbjct:   16 LEQLKASGTVVVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPTYAKLIDVAVEYGKKHGKTTEEQVENAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDTQATIEKARHIIKLFEQEGVSKERVLIKIASTWEGIQAAKELEEKDGIHCNLTLLFSFVQAVACAEAQVTLISPFVGRILDWYKSSTGKD-YKGEADPGVISVKKIYNYYKKYGYKTIVMGASFRSTDEIKNLAGVDYLTISPALLDKLMNSTEPFPRVLDPVSAKKEAGDKISYISDESKFRFDLNEDAMATEKLSEGIRKFSADIVTLFDLIEKKV 333          
BLAST of Transaldolase vs. Ensembl Yeast
Match: NQM1 (Transaldolase of unknown function; transcription is repressed by Mot1p and induced by alpha-factor and during diauxic shift; NQM1 has a paralog, TAL1, that arose from the whole genome duplication [Source:SGD;Acc:S000003275])

HSP 1 Score: 334.724 bits (857), Expect = 3.524e-114
Identity = 176/319 (55.17%), Postives = 237/319 (74.29%), Query Frame = 3
Query:   78 LDQLKKQ-TKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            L+QLKK  T +VAD+GDF++I KYEP D+TTNPSLI AA+K+ +Y   ID AV YG+   K   E+++ AM+K++V FG +ILK++PGRVSTEVDAR SFDK A + K+L II+LY++ G+ ++R+LIK++STWEGIQAA ELE KH IHCN+TLLF+F QAVACA+A VTLISPFVGRI D++ +  GK  Y  + DPGV+SV  IY YYK++   TE+M ASFRN++++  L G D++T+   LLE+L   T  I  +LN ++AK + V    +   E  FR+ LNED+MAT+KLS+GIRKFSAD  +L  L+  K+
Sbjct:   16 LEQLKKAGTHVVADSGDFEAISKYEPQDSTTNPSLILAASKLEKYARFIDAAVEYGRKHGKTDHEKIENAMDKILVEFGTQILKVVPGRVSTEVDARLSFDKKATVKKALHIIKLYKDAGVPKERVLIKIASTWEGIQAARELEVKHGIHCNMTLLFSFTQAVACAEANVTLISPFVGRIMDFYKALSGKD-YTAETDPGVLSVKKIYSYYKRHGYATEVMAASFRNLDELKALAGIDNMTLPLNLLEQLYESTDPIENKLNSESAKEEGVEKVSFINDEPHFRYVLNEDQMATEKLSDGIRKFSADIEALYKLVEEKM 333          
BLAST of Transaldolase vs. Ensembl Nematostella
Match: EDO50035 (Transaldolase [Source:UniProtKB/TrEMBL;Acc:A7RF51])

HSP 1 Score: 379.407 bits (973), Expect = 2.275e-131
Identity = 200/324 (61.73%), Postives = 249/324 (76.85%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRL-NKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKLE 1034
            MA  L+QLKK T +VADTGD KSI K++P D TTNPSLIFAAA++ EY  L++ A+ YGK   + L+EQ+  A +KL V FG+++L+++PG VSTEVDAR SFD  A +AK+L  I+LY+E GIS++R+LIKLSSTWEGIQAA  LE+ H IHCNLTLLFAF QAVACA+AGVTLISPFVGRIYDW+++K G+K YE  EDPGV SV+ IY YYKK   KT +MGASFRNV QI GL GCD LTISP+LLE+L +    I  +L +++A KLD     K E+ E  FR+ LNED MAT+KL+EGIRKF+ DA  LE LL+ K++
Sbjct:    1 MANSLEQLKKFTVVVADTGDIKSIDKFKPTDCTTNPSLIFAAAQMSEYSNLLEEAIQYGKCNGRTLEEQISAASDKLFVLFGLKLLEMVPGVVSTEVDARLSFDVEASVAKALKFIELYKEAGISKERVLIKLSSTWEGIQAARILERDHGIHCNLTLLFAFVQAVACAEAGVTLISPFVGRIYDWYVAKTGQKEYEPHEDPGVKSVTAIYNYYKKFGYKTVVMGASFRNVGQITGLTGCDKLTISPSLLEKLQNSNEAITQKLSSEEAGKLD---IEKVEVDEKSFRWLLNEDAMATEKLAEGIRKFAVDAVKLEGLLKEKMQ 321          
BLAST of Transaldolase vs. Ensembl Medaka
Match: taldo1 (transaldolase 1 [Source:NCBI gene;Acc:101163235])

HSP 1 Score: 358.607 bits (919), Expect = 1.308e-122
Identity = 185/322 (57.45%), Postives = 234/322 (72.67%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKL 1031
            M + L QLKK T +VADTGDF +I +Y+P DATTNPSLI AAAK+PEY  L+D A+ YG +K    +EQ+   M+KL V+FG+EILK +PGRVSTEVDAR SFDK+  + ++L +I LYEE GI ++R+LIKLSSTWEGIQA  ELE+KH +HCN+TLLF+F QAVACA+A VTLISPFVGRI DWH     +K +E  EDPGV+SV+ I+ YYKK    T +MGASFRN  ++  L GCD LTISP LL EL+     I   L+   AK  ++   K  + E  FR+Q NED MA +KLS+GIRKF+ADA  LE +++ K+
Sbjct:   12 MESALSQLKKFTVVVADTGDFNAIDEYKPQDATTNPSLILAAAKMPEYQNLLDQAIKYGIAKGGTEEEQVANTMDKLFVSFGLEILKKVPGRVSTEVDARLSFDKDTMVTRALKLISLYEEAGIKKERVLIKLSSTWEGIQAGKELEEKHGVHCNMTLLFSFAQAVACAEAKVTLISPFVGRILDWHKENSDRKSFEPHEDPGVLSVTKIFNYYKKFGYSTVVMGASFRNTGEVKALAGCDLLTISPGLLAELSQDHSSITAMLSMDKAKACDL--EKIHLDEKAFRWQHNEDRMAVEKLSDGIRKFAADAVKLETMIKEKM 331          
BLAST of Transaldolase vs. Planmine SMEST
Match: SMESG000037474.1 (SMESG000037474.1)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 322/324 (99.38%), Postives = 323/324 (99.69%), Query Frame = 3
Query:   66 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSXXXXXXXXXXXXXXXMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKLEK 1037
            MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLID+AVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKN QIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSIIYKYYKKNEIKTEIMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKLEK
Sbjct:    1 MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGCLIDDAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDARFSFDKNTQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKHKIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDEDPGVISVSIIYKYYKKNEIKTEIMGASFRNVNQIIGLCGCDDLTISPALLEELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKLSEGIRKFSADARSLENLLRVKLEK 324          
The following BLAST results are available for this feature:
BLAST of Transaldolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TALDO11.093e-12058.39transaldolase 1 [Source:HGNC Symbol;Acc:HGNC:11559... [more]
TALDO17.043e-10563.28transaldolase 1 [Source:HGNC Symbol;Acc:HGNC:11559... [more]
TALDO13.007e-1754.41transaldolase 1 [Source:HGNC Symbol;Acc:HGNC:11559... [more]
back to top
BLAST of Transaldolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tald-12.508e-11958.26Transaldolase [Source:UniProtKB/TrEMBL;Acc:Q8T876... [more]
tald-12.508e-11958.26Transaldolase [Source:UniProtKB/TrEMBL;Acc:Q8T876... [more]
tald-13.803e-4957.14Transaldolase [Source:UniProtKB/TrEMBL;Acc:Q8T876... [more]
tald-13.803e-4957.14Transaldolase [Source:UniProtKB/TrEMBL;Acc:Q8T876... [more]
tald-13.803e-4957.14Transaldolase [Source:UniProtKB/TrEMBL;Acc:Q8T876... [more]
back to top
BLAST of Transaldolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Taldo7.276e-11857.01gene:FBgn0023477 transcript:FBtr0072141[more]
back to top
BLAST of Transaldolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taldo11.812e-10760.74transaldolase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3... [more]
back to top
BLAST of Transaldolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taldo11.956e-11656.70transaldolase 1 [Source:NCBI gene;Acc:549885][more]
taldo13.502e-9351.40transaldolase 1 [Source:NCBI gene;Acc:549885][more]
ENSXETT00000018550.14.372e-8656.59pep primary_assembly:Xenopus_tropicalis_v9.1:4:182... [more]
ENSXETT00000028919.11.031e-8255.21pep primary_assembly:Xenopus_tropicalis_v9.1:4:380... [more]
ENSXETT00000012783.13.474e-8255.43pep primary_assembly:Xenopus_tropicalis_v9.1:4:380... [more]
back to top
BLAST of Transaldolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Taldo15.589e-12158.39transaldolase 1 [Source:MGI Symbol;Acc:MGI:1274789... [more]
Taldo12.161e-11151.50transaldolase 1 [Source:MGI Symbol;Acc:MGI:1274789... [more]
back to top
BLAST of Transaldolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9EQS0|TALDO_RAT6.501e-12259.32Transaldolase OS=Rattus norvegicus OX=10116 GN=Tal... [more]
sp|Q93092|TALDO_MOUSE3.910e-12058.39Transaldolase OS=Mus musculus OX=10090 GN=Taldo1 P... [more]
sp|P37837|TALDO_HUMAN5.247e-12058.39Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE... [more]
sp|Q8VI73|TALDO_CRIGR8.291e-12058.70Transaldolase OS=Cricetulus griseus OX=10029 GN=TA... [more]
sp|Q2TBL6|TALDO_BOVIN1.201e-11958.07Transaldolase OS=Bos taurus OX=9913 GN=TALDO1 PE=2... [more]
back to top
BLAST of Transaldolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7PL538.881e-13162.42Transaldolase OS=Brachionus plicatilis OX=10195 GN... [more]
W6UNT91.585e-13063.66Transaldolase OS=Echinococcus granulosus OX=6210 G... [more]
A0A068X2F01.611e-13063.66Transaldolase OS=Echinococcus granulosus OX=6210 G... [more]
A0A2Z5RDX31.836e-13061.77Transaldolase OS=Reticulitermes speratus OX=60591 ... [more]
A0A023GIL92.543e-13062.65Transaldolase OS=Amblyomma triste OX=251400 PE=2 S... [more]
back to top
BLAST of Transaldolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taldo12.941e-11958.15transaldolase 1 [Source:NCBI gene;Acc:103029185][more]
taldo11.951e-10460.74transaldolase 1 [Source:NCBI gene;Acc:103029185][more]
back to top
BLAST of Transaldolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transaldolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TAL16.390e-11959.87Transaldolase, enzyme in the non-oxidative pentose... [more]
NQM13.524e-11455.17Transaldolase of unknown function; transcription i... [more]
back to top
BLAST of Transaldolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO500352.275e-13161.73Transaldolase [Source:UniProtKB/TrEMBL;Acc:A7RF51... [more]
back to top
BLAST of Transaldolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taldo11.308e-12257.45transaldolase 1 [Source:NCBI gene;Acc:101163235][more]
back to top
BLAST of Transaldolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000037474.10.000e+099.38SMESG000037474.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008785 ID=SMED30008785|Name=Transaldolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1176bp
AAACTTCGTTTTGTTAGAATTAATCAAAAAGTTTTAATTTAAAAAGTCAT
TTTATAAAAAACTTTATGGCTACTATTTTGGATCAACTGAAAAAGCAAAC
TAAAATTGTTGCTGACACAGGTGATTTTAAAAGTATTGTGAAATACGAAC
CAATTGACGCAACTACTAATCCATCTCTCATTTTTGCTGCTGCAAAAATT
CCAGAATATGGATGTTTAATTGATAATGCCGTTTGCTATGGAAAATCTAA
ATCCAAAGTACTCAAGGAACAATTGGATTATGCTATGAATAAATTGATTG
TCAATTTTGGAATTGAAATCTTAAAAATTATTCCTGGTCGAGTTTCCACT
GAAGTTGATGCAAGGTTCTCATTTGATAAAAATGCACAAATTGCAAAATC
TCTGAGTATAATCCAACTCTATGAAGAGAATGGAATATCAAGAGATCGAA
TTTTGATAAAATTAAGTTCCACGTGGGAAGGTATTCAAGCAGCGGCTGAA
CTCGAGAAAAAACATAAAATTCACTGCAATTTGACGCTTTTATTTGCATT
TTGCCAGGCCGTCGCATGTGCTGATGCCGGCGTGACTCTTATTTCCCCAT
TTGTCGGTAGAATTTATGATTGGCATATTTCTAAACACGGAAAGAAAGTT
TACGAAATTGATGAAGACCCCGGAGTAATCTCAGTATCGATTATATACAA
GTATTATAAGAAAAACGAAATTAAAACCGAAATAATGGGTGCCTCTTTTC
GTAATGTTAATCAAATCATTGGCTTATGTGGCTGTGATGATTTGACTATT
AGTCCTGCACTGTTGGAGGAGTTAAATTCAATGACAATGGACATCCCAGT
GCGGTTAAATAAGCAAGCTGCAAAGCTTGATAATGTCATACCACACAAGT
ATGAAATTAGTGAGGCAGAATTTAGATTCCAATTAAATGAAGATGAAATG
GCCACAGATAAATTATCTGAAGGTATCCGGAAGTTTTCTGCAGATGCGAG
AAGTTTAGAGAATTTGCTGCGCGTGAAATTAGAGAAATGATCTAAAAGTG
AAATCTCAGGAATTAATCAATAACTATAACTGTTGCTAACCAAATGTTTT
ATTCTTTTGCATTAGATAAATTGTTATGATTACATTTCTAAATTTATATT
TTTGAAATAAAGCTTGTGTGAATTGG
back to top

protein sequence of SMED30008785-orf-1

>SMED30008785-orf-1 ID=SMED30008785-orf-1|Name=SMED30008785-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=325bp
MATILDQLKKQTKIVADTGDFKSIVKYEPIDATTNPSLIFAAAKIPEYGC
LIDNAVCYGKSKSKVLKEQLDYAMNKLIVNFGIEILKIIPGRVSTEVDAR
FSFDKNAQIAKSLSIIQLYEENGISRDRILIKLSSTWEGIQAAAELEKKH
KIHCNLTLLFAFCQAVACADAGVTLISPFVGRIYDWHISKHGKKVYEIDE
DPGVISVSIIYKYYKKNEIKTEIMGASFRNVNQIIGLCGCDDLTISPALL
EELNSMTMDIPVRLNKQAAKLDNVIPHKYEISEAEFRFQLNEDEMATDKL
SEGIRKFSADARSLENLLRVKLEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004730Transaldolase_1
IPR001585TAL/FSA
IPR013785Aldolase_TIM
IPR018225Transaldolase_AS
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0006098pentose-phosphate shunt
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004801sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001585Transaldolase/Fructose-6-phosphate aldolasePFAMPF00923TAL_FSAcoord: 14..317
e-value: 1.4E-87
score: 293.7
IPR001585Transaldolase/Fructose-6-phosphate aldolasePANTHERPTHR10683TRANSALDOLASEcoord: 3..321
IPR004730Transaldolase type 1TIGRFAMTIGR00874TIGR00874coord: 5..321
e-value: 1.9E-140
score: 465.7
IPR004730Transaldolase type 1PANTHERPTHR10683:SF18TRANSALDOLASEcoord: 3..321
IPR004730Transaldolase type 1CDDcd00957Transaldolase_TalABcoord: 5..318
e-value: 2.96772E-170
score: 473.258
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 1..324
e-value: 1.5E-128
score: 430.6
IPR018225Transaldolase, active sitePROSITEPS01054TRANSALDOLASE_1coord: 31..39
NoneNo IPR availableSUPERFAMILYSSF51569Aldolasecoord: 1..319