Otopetrin

Overview
NameOtopetrin
Smed IDSMED30008781
Length (bp)2010
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Otopetrin (SMED30008781) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Otopetrin (SMED30008781) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008781

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008781SMESG000018672.1 SMESG000018670.1 SmedASXL_013120SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008781SMESG000018672.1 OX_Smed_1.0.11107ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
glial cellSMED30008781SMESG000018672.1 SMESG000018670.1 dd_Smed_v6_13612_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Otopetrin vs. Ensembl Human
Match: OTOP1 (otopetrin 1 [Source:HGNC Symbol;Acc:HGNC:19656])

HSP 1 Score: 51.2174 bits (121), Expect = 5.900e-6
Identity = 63/310 (20.32%), Postives = 132/310 (42.58%), Query Frame = 1
Query:  805 HLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKT----CTDQ-----LSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEE----ALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLES----SRKCAQSFHDVRV 1683
            H  +  +Q +F++ + + I    K + RF + H   +N+  W   V+ E  H+L +HK        GN T   ++ T    CT       +S+ +  YL+P  IEY ++++ + Y + + +G      +H   + ++  V+             G  +GL     T+  + ++L+     KT++ + ++      I L+    A   A I++  +    L E +     LD +LL+   +G +  +    ++ + +      + ++L        S+  I++  +Q LF+ ES      K ++    +RV
Sbjct:  173 HSVHTLLQVYFLWGHAKDIIQSFKTLERFGVIHSVFTNLLLWANGVLNESKHQLNEHKERLITLGFGNITTVLDDHTPQCNCTPPTLCTAISHGIY-YLYPFNIEYQILASTMLYVLWKNIGRKVDSHQHQKMQFKSDGVM------------VGAVLGLTVLAATIAVVVVYLIHIGRSKTKSESALIMFYLYAITLLMLMGAAGLAGIRIYRIDEKSLDESKNPARKLDSDLLVGTASGSWLISWGSILAILCAEGHPRYTWYNLPY------SILAIVEKYIQNLFIFESIHREPEKLSEDIQTLRV 463          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-3 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL0])

HSP 1 Score: 140.969 bits (354), Expect = 3.265e-35
Identity = 124/441 (28.12%), Postives = 222/441 (50.34%), Query Frame = 1
Query:  646 VIKETNGINLYLRLGAVGFGF-GVMVHDGFKVADQVRLQNSFCHNQLWTPK-QCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHE--NKTCTDQLSY--SVSPYLFPCAIEYSLISAAI---FYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLS------EEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSR-KCAQSF-HDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRA---DEHL-IFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYK 1905
            V+  T+  +LYLRLG V FG  GV+ +    V   +   ++     + +     +   +IF+Q +F++   + IF     + RF L HLT +N+  W + ++YE    + + ++    N+   S   HE   + C   L      + +++ C +EYSLI A +   F+  L+R+   E  EK    K++ + ++K     +C R+ +GLF G    +VT++ +A   LF      + +A  ++  + +   + S+  +V AF +MR L+F            E LD  LL+VGL G   +++   +S I+      N    L +I+F   ++  +IQ   Q   ++ +SR +  +S  H +R KPG+ ++T L++ N A + +++FEA++A   DE + ++  YY    W+I+     PL IF+RFHSS C  +IW K ++
Sbjct:  134 VLANTSTGSLYLRLGCVVFGIIGVVYYLLIFVICLLGWSSNEGECSVISDVLNVMAAVFIFVQMWFVYCNGKIIFTGDGNLARFGLMHLTGTNLWMWLRYILYEEVETVKEIRHVQHANLSKASAHHHEVHEEACKGVLCIFNGYNEFMYTCVVEYSLICAGVAFVFWANLERLK-REQMEK----KMKKRSILK----IDCSRTAEGLFAGFACIIVTIIAIA---LFNAYSSDKNVAQWIFSCTNMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGLIGELIFSIGGILSFIN------NMTIGLPLIIFT-TNVLRLIQVTFQSCLLMVASRLRIEESNQHMLRYKPGKQVITMLLMMNCAQFMMNVFEAQKAGINDEMIHMYGSYY----WAIVVRGCSPLTIFYRFHSSACFAEIWKKTFR 551          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-3 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL0])

HSP 1 Score: 140.969 bits (354), Expect = 3.265e-35
Identity = 124/441 (28.12%), Postives = 222/441 (50.34%), Query Frame = 1
Query:  646 VIKETNGINLYLRLGAVGFGF-GVMVHDGFKVADQVRLQNSFCHNQLWTPK-QCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHE--NKTCTDQLSY--SVSPYLFPCAIEYSLISAAI---FYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLS------EEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSR-KCAQSF-HDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRA---DEHL-IFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYK 1905
            V+  T+  +LYLRLG V FG  GV+ +    V   +   ++     + +     +   +IF+Q +F++   + IF     + RF L HLT +N+  W + ++YE    + + ++    N+   S   HE   + C   L      + +++ C +EYSLI A +   F+  L+R+   E  EK    K++ + ++K     +C R+ +GLF G    +VT++ +A   LF      + +A  ++  + +   + S+  +V AF +MR L+F            E LD  LL+VGL G   +++   +S I+      N    L +I+F   ++  +IQ   Q   ++ +SR +  +S  H +R KPG+ ++T L++ N A + +++FEA++A   DE + ++  YY    W+I+     PL IF+RFHSS C  +IW K ++
Sbjct:  134 VLANTSTGSLYLRLGCVVFGIIGVVYYLLIFVICLLGWSSNEGECSVISDVLNVMAAVFIFVQMWFVYCNGKIIFTGDGNLARFGLMHLTGTNLWMWLRYILYEEVETVKEIRHVQHANLSKASAHHHEVHEEACKGVLCIFNGYNEFMYTCVVEYSLICAGVAFVFWANLERLK-REQMEK----KMKKRSILK----IDCSRTAEGLFAGFACIIVTIIAIA---LFNAYSSDKNVAQWIFSCTNMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGLIGELIFSIGGILSFIN------NMTIGLPLIIFT-TNVLRLIQVTFQSCLLMVASRLRIEESNQHMLRYKPGKQVITMLLMMNCAQFMMNVFEAQKAGINDEMIHMYGSYY----WAIVVRGCSPLTIFYRFHSSACFAEIWKKTFR 551          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-8 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:G5EDX5])

HSP 1 Score: 137.887 bits (346), Expect = 7.015e-34
Identity = 116/444 (26.13%), Postives = 211/444 (47.52%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNT----------------------SQINIHGNSTIRHENKTCTDQLSYS----------VSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSD-KLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAY 1902
             LYLRLGA+ FG   +V  G ++   + ++N  C  ++   K  + + + FIQ  FIF   +      + ++ F + HL   N+  WF+ V+ +   E   HK                          I+   NST+ +   T T +   S          V+ +L  C +EYSLI AAI + + + +G N H + +S   K++ ++        +C  S  GLF G++F + +LV + ++ +F+   +  + A +V+ + ++ L   +  A +    +MR L++   +  E +D+ LL++GL G   Y        I      D +  +L   +F+ +    +IQ ++Q  F+L +SR    S + ++ KPG+ ++TFL+V+N+ L+    FE  ++            T ++ I + + PL++F+RFHSS CL +IW   Y
Sbjct:  158 TLYLRLGALFFGSVGIVLFGLELF--LCIENVAC-KKVAIAKMIVAIVFTFIQMHFIFCNSKITVNSSRKIVAFGMMHLISVNLWTWFRFVLAK--QEAKAHKKAQLKQTFRKYYSSSSSSSSEEIHELISAVLNSTLNNTPATKTMEPVASRLFALEHFGDVATFLTTCIVEYSLIGAAIMFILWKSIGQNNHQQSNSGKRKVKMRI--------DCSSSSTGLFAGIIFLIGSLVSMGMYTIFESL-RNSSGAQLVFGIVDLSLFSIALGACIIGLWRMRHLQYRLHAHGEVIDEILLIIGLIGEILYCAVGIDVFITCRRSADLTVSALPAFVFVIR----MIQVVVQAAFILTTSRLRCLSKYSMKYKPGKEIITFLLVSNVTLFVFHTFEGMKSSFGF---SSKAATQYNYIIYAVGPLLVFYRFHSSACLAEIWKHTY 580          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-1 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O45067])

HSP 1 Score: 137.502 bits (345), Expect = 9.336e-34
Identity = 121/450 (26.89%), Postives = 201/450 (44.67%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYE-----------INHELLDHK----------------------NTSQINIHGNSTIRHENKTCTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRF------CQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAY 1902
            +L+LRLG+V FG   +V+  F V       N    + L T      + +IFIQ  FIF   +        V R    HL  +N+  W + V+ E            NH    H                       + S  + H    I   +    + +  S+S  +F   +EYSLI+AA+ Y + + +G  +    +   K Q +V        +C ++  GLF+GL F  VT   + ++  F   +K+Q+ A  VY  +++   V S+I ++ A  +MR L++       Q S++E LD  LL +GL G   Y++   +         + S     I+LF+   +  +IQ   Q  F+L  +R           +PG+  +TFL+  NLA++ +++FE+++A    +  +YY K  W  +  +  PL IF+RFHSS+C  +IW   Y
Sbjct:  181 SLFLRLGSVVFGVTGVVYYAFLVFLCELDPNC---SALSTSLDVCAILFIFIQMHFIFCNWKLSITGSHMVARVGTMHLVAANLWTWIRYVLMEEGVMEKEIREVFNHRPPGHNYMRSNSSDSSSSAENSMEQFLGDGSHEDEHFEKKIMPGSCQAVECILGSMSEIMFTSIVEYSLIAAAVMYIVWRNIGRQDQGSTYVKRKHQIRV--------DCSKTTTGLFLGLAFLAVTFTSMVVYYGFTMMNKSQS-AAFVYAFTDMFQYVLSTIGVLTAIYQMRALKYFNKKTKLQNSDQELLDQILLSIGLVGELIYSVAGLVGLTGEKQWTNFS----FILLFV--HIFRLIQVGTQT-FLLHVARSVRMGCEHREAQPGKQAITFLLTANLAIFFMNLFESEKAGVSEMIIEYYGKRSWVFLVRSFSPLTIFYRFHSSVCFAEIWKNVY 611          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-1 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O45067])

HSP 1 Score: 137.117 bits (344), Expect = 9.396e-34
Identity = 121/450 (26.89%), Postives = 201/450 (44.67%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYE-----------INHELLDHK----------------------NTSQINIHGNSTIRHENKTCTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRF------CQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAY 1902
            +L+LRLG+V FG   +V+  F V       N    + L T      + +IFIQ  FIF   +        V R    HL  +N+  W + V+ E            NH    H                       + S  + H    I   +    + +  S+S  +F   +EYSLI+AA+ Y + + +G  +    +   K Q +V        +C ++  GLF+GL F  VT   + ++  F   +K+Q+ A  VY  +++   V S+I ++ A  +MR L++       Q S++E LD  LL +GL G   Y++   +         + S     I+LF+   +  +IQ   Q  F+L  +R           +PG+  +TFL+  NLA++ +++FE+++A    +  +YY K  W  +  +  PL IF+RFHSS+C  +IW   Y
Sbjct:  165 SLFLRLGSVVFGVTGVVYYAFLVFLCELDPNC---SALSTSLDVCAILFIFIQMHFIFCNWKLSITGSHMVARVGTMHLVAANLWTWIRYVLMEEGVMEKEIREVFNHRPPGHNYMRSNSSDSSSSAENSMEQFLGDGSHEDEHFEKKIMPGSCQAVECILGSMSEIMFTSIVEYSLIAAAVMYIVWRNIGRQDQGSTYVKRKHQIRV--------DCSKTTTGLFLGLAFLAVTFTSMVVYYGFTMMNKSQS-AAFVYAFTDMFQYVLSTIGVLTAIYQMRALKYFNKKTKLQNSDQELLDQILLSIGLVGELIYSVAGLVGLTGEKQWTNFS----FILLFV--HIFRLIQVGTQT-FLLHVARSVRMGCEHREAQPGKQAITFLLTANLAIFFMNLFESEKAGVSEMIIEYYGKRSWVFLVRSFSPLTIFYRFHSSVCFAEIWKNVY 595          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0346834)

HSP 1 Score: 240.35 bits (612), Expect = 5.178e-67
Identity = 150/453 (33.11%), Postives = 237/453 (52.32%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRL-QNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFL-KHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTS--------QINIH--GNSTIRHENKT----------------CT-----DQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYS-ECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFIS---TIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKINIT 1917
            + YLR+GAV FG G M++ G +      L  ++ CHN L        +A+IFIQ +FIF  +  I + ++K + RF L H+  +N+  W   ++ E  HE+L   N          +I  H  G++ I+H+                   C        L    SP+LFPC IEYSLI AAI Y M + +   +       D + + +      YS +C R+HKGLFVG+L  ++T++ L IF +     +   +AV    + E+++  +++IA +   I++R L++       +LDD LL+    G F YN+F  I+   T+ S +           +L    ++  I+Q+  Q +F+L++SR+ A S   +R KPGR +VTF++V NLA+W +S  E  RA+ H I   +Y    W+IITH  +PL IF+RFHS++CL +IW +AYK+  T
Sbjct: 1013 SFYLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQY-DAYRSFSLDDILLVGAQTGSFLYNIFTVIAGHFTLRSDD-----------MLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYKLKPT 1453          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0331168)

HSP 1 Score: 240.35 bits (612), Expect = 5.217e-67
Identity = 150/453 (33.11%), Postives = 237/453 (52.32%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRL-QNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFL-KHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTS--------QINIH--GNSTIRHENKT----------------CT-----DQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYS-ECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFIS---TIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKINIT 1917
            + YLR+GAV FG G M++ G +      L  ++ CHN L        +A+IFIQ +FIF  +  I + ++K + RF L H+  +N+  W   ++ E  HE+L   N          +I  H  G++ I+H+                   C        L    SP+LFPC IEYSLI AAI Y M + +   +       D + + +      YS +C R+HKGLFVG+L  ++T++ L IF +     +   +AV    + E+++  +++IA +   I++R L++       +LDD LL+    G F YN+F  I+   T+ S +           +L    ++  I+Q+  Q +F+L++SR+ A S   +R KPGR +VTF++V NLA+W +S  E  RA+ H I   +Y    W+IITH  +PL IF+RFHS++CL +IW +AYK+  T
Sbjct: 1013 SFYLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQY-DAYRSFSLDDILLVGAQTGSFLYNIFTVIAGHFTLRSDD-----------MLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYKLKPT 1453          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0331167)

HSP 1 Score: 239.965 bits (611), Expect = 6.553e-67
Identity = 150/453 (33.11%), Postives = 237/453 (52.32%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRL-QNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFL-KHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTS--------QINIH--GNSTIRHENKT----------------CT-----DQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYS-ECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFIS---TIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKINIT 1917
            + YLR+GAV FG G M++ G +      L  ++ CHN L        +A+IFIQ +FIF  +  I + ++K + RF L H+  +N+  W   ++ E  HE+L   N          +I  H  G++ I+H+                   C        L    SP+LFPC IEYSLI AAI Y M + +   +       D + + +      YS +C R+HKGLFVG+L  ++T++ L IF +     +   +AV    + E+++  +++IA +   I++R L++       +LDD LL+    G F YN+F  I+   T+ S +           +L    ++  I+Q+  Q +F+L++SR+ A S   +R KPGR +VTF++V NLA+W +S  E  RA+ H I   +Y    W+IITH  +PL IF+RFHS++CL +IW +AYK+  T
Sbjct: 1013 SFYLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQY-DAYRSFSLDDILLVGAQTGSFLYNIFTVIAGHFTLRSDD-----------MLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYKLKPT 1453          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLb (gene:FBgn0031514 transcript:FBtr0077608)

HSP 1 Score: 177.178 bits (448), Expect = 3.947e-47
Identity = 133/481 (27.65%), Postives = 221/481 (45.95%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQN-SFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAI-FLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQIN------IHGNSTIRHE------------------------------NKTCTDQ-----------------LSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYS-ECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEE----ALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRA---DEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYK 1905
            K T+  + YLR+GA+ F  G MV+ G +      L     C +          +     Q  FIF     +   +HK   RF L H+  +N+C+W   +V E  HE+  H +  +++      IH +S  R +                              N T T                   L   +SP+LFPC IEYSLI A I ++M + V      +K   + ++         +S +C +SHKGLF G+L  ++T++ + ++ +       + +A     + E  +    + A++   I MR LR+ + + +E     LD+ LL+V   GV+ Y +F  + +  +  K D     +  I+     +  ++Q+ LQ +F+L SS +  +  + VR KPGR ++TFL+V N+A+W V+     RA   + HL   +++    W+IITH  +PL IF+RFHS+ICL ++W   YK
Sbjct:  154 KVTHFGSFYLRVGAIAFAIGTMVYSGLEFGQFFELNGHPGCRDVFVAITPICRMVLCIAQVQFIFLNTTYMDMARHKVTSRFGLMHMVATNLCEWLYVLVEETKHEIF-HISQHEVDPAHDLVIHNSSMSRTDWAAVNESLHQHHHHHALNNTLVANVSSVIVNMTITPSPTPAAFSGCSRTTIMGALVQQLSPFLFPCTIEYSLICAVILFEMWKTVKSIPDIDKTRKNSVKPAAAKPAHHFSVDCSQSHKGLFFGILIIVMTIISMIMYFVLYTQPGYELVATQEVTLWETFMYFMCAAAVITGMILMRDLRYIKNTSDEHHSMDLDNLLLIVAQTGVYLYGMFSILGSYFA--KWDTVPDRVEGII---AEVFGVVQTSLQTMFILHSSHRRCRGTNQVRRKPGREIITFLLVANIAIWFVNTLIKGRAVFRESHL---EFFGVWGWTIITHISMPLAIFYRFHSTICLFEVWKITYK 625          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLb (gene:FBgn0031514 transcript:FBtr0344796)

HSP 1 Score: 176.792 bits (447), Expect = 6.870e-47
Identity = 133/481 (27.65%), Postives = 221/481 (45.95%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQN-SFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAI-FLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQIN------IHGNSTIRHE------------------------------NKTCTDQ-----------------LSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYS-ECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEE----ALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRA---DEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYK 1905
            K T+  + YLR+GA+ F  G MV+ G +      L     C +          +     Q  FIF     +   +HK   RF L H+  +N+C+W   +V E  HE+  H +  +++      IH +S  R +                              N T T                   L   +SP+LFPC IEYSLI A I ++M + V      +K   + ++         +S +C +SHKGLF G+L  ++T++ + ++ +       + +A     + E  +    + A++   I MR LR+ + + +E     LD+ LL+V   GV+ Y +F  + +  +  K D     +  I+     +  ++Q+ LQ +F+L SS +  +  + VR KPGR ++TFL+V N+A+W V+     RA   + HL   +++    W+IITH  +PL IF+RFHS+ICL ++W   YK
Sbjct:  172 KVTHFGSFYLRVGAIAFAIGTMVYSGLEFGQFFELNGHPGCRDVFVAITPICRMVLCIAQVQFIFLNTTYMDMARHKVTSRFGLMHMVATNLCEWLYVLVEETKHEIF-HISQHEVDPAHDLVIHNSSMSRTDWAAVNESLHQHHHHHALNNTLVANVSSVIVNMTITPSPTPAAFSGCSRTTIMGALVQQLSPFLFPCTIEYSLICAVILFEMWKTVKSIPDIDKTRKNSVKPAAAKPAHHFSVDCSQSHKGLFFGILIIVMTIISMIMYFVLYTQPGYELVATQEVTLWETFMYFMCAAAVITGMILMRDLRYIKNTSDEHHSMDLDNLLLIVAQTGVYLYGMFSILGSYFA--KWDTVPDRVEGII---AEVFGVVQTSLQTMFILHSSHRRCRGTNQVRRKPGREIITFLLVANIAIWFVNTLIKGRAVFRESHL---EFFGVWGWTIITHISMPLAIFYRFHSTICLFEVWKITYK 643          
BLAST of Otopetrin vs. Ensembl Zebrafish
Match: otop2 (otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2])

HSP 1 Score: 69.3218 bits (168), Expect = 7.589e-12
Identity = 102/463 (22.03%), Postives = 191/463 (41.25%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKTCTDQLSYSVSP-------YLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLV-GLAIFLLF-----KKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEE---EALDDNLLLVGLAGVFAYNLFLFISTIDS-----SNKLDNSKHSLSII------LFLCKSM-------TEIIQSLLQVLFVLE-SSRKCAQSFHDVRVKP-------GR---------SLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDI 1887
            K+++   ++LR G V FG   ++ D FK+   V   N  C + +      +   ++ +QT+ ++ + +      + + R  L     +N+  W   V  E  H+ +        N  G++    +      +  +++         YL+P  IEYSL ++A+ Y M + VG    D  H S KL              H S   + VG L  ++ LV GLA F+++     K   K +  A++++ +  I+ ++  S + +   I  R  +  Q+S +    +LD  LL+    G F    F  ++ + S     +N L+ +   L++I       FL K +       TE+      V+ V E    + + S       P       GR          +  FL++ N+ LW +  F A+   ++ +    Y+   W+ + +  +P  IF+R HS   L ++
Sbjct:  106 KDSHAGPVWLRTGLVLFGICSVIMDIFKIIFYVGRMN--CESPVKIAFPVVQAVFVIVQTYVLWIHAKDCVQIKQNITRCGLMLTLSTNLMVWMMAVTEESLHQTVAPVKPPTNNNIGSAVASQQGGPSECECLHNMCDLFEKAYYYLYPFNIEYSLFASAMTYVMWKNVGRKMDD--HHSHKL--------------HFSLWDVLVGPLAGLIVLVAGLATFVVYEVDVSKDDPKKKEEALIMHYIMNIVAVLLMSSSALAGCILFRMDKREQVSGKNPTRSLDVGLLVGASLGQFLICYFTIVAVLASGVQGHTNGLNLACAMLTVIELCIQNAFLIKGLHREPFKETEVATVFANVMAVKERDPERRSSSIVPAHTLPIPLTLLQGRMSWKRRVLKEICAFLLLCNVTLWIIPAFGARPQFDNTVGPDVYEFQTWAAVVNIGMPFGIFYRMHSVASLFEV 550          
BLAST of Otopetrin vs. Ensembl Zebrafish
Match: otop2 (otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2])

HSP 1 Score: 68.5514 bits (166), Expect = 1.301e-11
Identity = 106/463 (22.89%), Postives = 189/463 (40.82%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTI--RHENKTC-----TDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLV-GLAIFLLF-----KKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEE---EALDDNLLLVGLAGVFAYNLFLFISTIDS-----SNKLDNSKHSLSII------LFLCKSM-------TEIIQSLLQVLFVLE-SSRKCAQSFHDVRVKP-------GR---------SLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDI 1887
            K+++   ++LR G V FG   ++ D FK+   V   N  C + +      +   ++ +QT+ ++ + +      + + R  L     +N+  W   V  E  H+ +        N   N T+  R     C        L      YL+P  IEYSL ++A+ Y M + VG    D  H S KL              H S   + VG L  ++ LV GLA F+++     K   K +  A++++ +  I+ ++  S + +   I  R  +  Q+S +    +LD  LL+    G F    F  ++ + S     +N L+ +   L++I       FL K +       TE+      V+ V E    + + S       P       GR          +  FL++ N+ LW +  F A+   ++ +    Y+   W+ + +  +P  IF+R HS   L ++
Sbjct:  106 KDSHAGPVWLRTGLVLFGICSVIMDIFKIIFYVGRMN--CESPVKIAFPVVQAVFVIVQTYVLWIHAKDCVQIKQNITRCGLMLTLSTNLMVWMMAVTEESLHQTVAPVKPPTNNNSYNDTLDGRAAASECECLHNMCDLFEKAYYYLYPFNIEYSLFASAMTYVMWKNVGRKMDD--HHSHKL--------------HFSLWDVLVGPLAGLIVLVAGLATFVVYEVDVSKDDPKKKEEALIMHYIMNIVAVLLMSSSALAGCILFRMDKREQVSGKNPTRSLDVGLLVGASLGQFLICYFTIVAVLASGVQGHTNGLNLACAMLTVIELCIQNAFLIKGLHREPFKETEVATVFANVMAVKERDPERRSSSIVPAHTLPIPLTLLQGRMSWKRRVLKEICAFLLLCNVTLWIIPAFGARPQFDNTVGPDVYEFQTWAAVVNIGMPFGIFYRMHSVASLFEV 550          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: slc46a2 (solute carrier family 46 member 2 [Source:Xenbase;Acc:XB-GENE-988711])

HSP 1 Score: 76.6406 bits (187), Expect = 7.494e-14
Identity = 105/483 (21.74%), Postives = 195/483 (40.37%), Query Frame = 1
Query:  637 NYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKT----------CTDQLSYSVSP---YLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIF-LLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRF--CQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSS-NKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLV-------------------------------------------------TFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDI 1887
            N  + K+++   ++LR G V FG   +V D FK+   +   +  C + +      +  A+I +QT+F++   +     H  + R+ L  + I+N+  W   V  E  H+  D ++  +I +H +    H++K           C++ L +       YL+P  IEYSL ++A+ Y M + VG    D+     +L      KN+          G  +G    +  +V L I+ +     DK     ++ Y  + + L + S  +L  + I     R      +    LD  LLL    G +  + +  ++ + +S  +L N+       L L  S+  I+Q  LQ  F++E   +  + F D   +P + L+                                                  FL++ N+ LW +  F A+   ++ +   +Y    W+IIT+  LP  IF+R H++  L ++
Sbjct:  189 NAVLYKDSHAGPVWLRGGLVFFGICSLVMDVFKIGYYISYID--CESPIKLIHPMVQSAFIIMQTYFLWVSSKHCVQIHTNISRYGLMLILITNLSIWMAAVTDESVHQTRDLEDDHKI-VHSSPAGSHDHKEVGGAHEHTCQCSNHLCHIFQTGYYYLYPFNIEYSLFASAMTYVMWKNVGREMDDQVAHHSRLSLCFYFKNM--------FAGFLIGGAVLLCGVVVLVIYKVKINLPDKLYRAHILFYSFNILALALMSLGSLAGSIIYRFDKRHMDAHKNPTRTLDVTLLLGAALGQYCISYYSIVAMVATSPGELINA-------LNLVYSILMIVQLTLQNTFIIEGLHR--EPFQDAAPQPEKGLIFANEAVAPSLAHNETPGFSAPAPEFPAKPKQSITEPPWNLKRRMVQEISLFLLLCNIILWLMPAFGARPQLKNNLERNFYGLYVWTIITNICLPFGIFYRMHAAASLLEV 651          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: crp.1 (C-reactive protein, pentraxin-related, gene 1 [Source:Xenbase;Acc:XB-GENE-1018603])

HSP 1 Score: 62.7734 bits (151), Expect = 1.146e-9
Identity = 77/353 (21.81%), Postives = 148/353 (41.93%), Query Frame = 1
Query:  613 LFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENK--TCTDQLSYSVSP---YLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQT-LAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEA----LDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLE 1641
            +F SQ      + K+T+    +LR G   F    ++ D FK+   +         +   P    H  +  +Q +F++ + + I    K + RF L H   +N+  W   ++ E  HEL +HK         N T+ H      CT  +    S    YL+P  IEY ++++ + Y + + +G     + H   K+  +           H    G  +GL+    T+  L ++L+     K+++ LA+ ++ +  I +L     + +   I  R +    L + E+    LD +LL+    G +  +    ++ I +    D + ++L        S+  II+  +Q LF++E
Sbjct:   97 IFRSQSIRRSIIEKDTDAGARWLRCGITLFAVITLILDSFKIGYYIGYSECLSITEGIFP--VTHTIHTLLQVYFLWFHAKDIIQSFKTLERFGLIHAVFTNLLLWANGILTESKHELNEHKERLITLGFSNITMDHHTPECNCTSSVCSIFSQGIYYLYPFTIEYHILASTMLYVLWKNIGRTV--KHHQQQKIHFKF----------HGITIGTILGLIVLTTTVAVLVVYLIQIGRSKSKSELALNMFYLYAITVLTLMCTSAIIGLIIYR-IENKSLDDSESPAKKLDSDLLVGSACGSWLISWGSILAIICAETHPDYTWYNLP------YSILVIIEKYIQNLFIIE 428          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: crp.1 (C-reactive protein, pentraxin-related, gene 1 [Source:Xenbase;Acc:XB-GENE-1018603])

HSP 1 Score: 62.7734 bits (151), Expect = 1.346e-9
Identity = 77/353 (21.81%), Postives = 148/353 (41.93%), Query Frame = 1
Query:  613 LFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENK--TCTDQLSYSVSP---YLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQT-LAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEA----LDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLE 1641
            +F SQ      + K+T+    +LR G   F    ++ D FK+   +         +   P    H  +  +Q +F++ + + I    K + RF L H   +N+  W   ++ E  HEL +HK         N T+ H      CT  +    S    YL+P  IEY ++++ + Y + + +G     + H   K+  +           H    G  +GL+    T+  L ++L+     K+++ LA+ ++ +  I +L     + +   I  R +    L + E+    LD +LL+    G +  +    ++ I +    D + ++L        S+  II+  +Q LF++E
Sbjct:  109 IFRSQSIRRSIIEKDTDAGARWLRCGITLFAVITLILDSFKIGYYIGYSECLSITEGIFP--VTHTIHTLLQVYFLWFHAKDIIQSFKTLERFGLIHAVFTNLLLWANGILTESKHELNEHKERLITLGFSNITMDHHTPECNCTSSVCSIFSQGIYYLYPFTIEYHILASTMLYVLWKNIGRTV--KHHQQQKIHFKF----------HGITIGTILGLIVLTTTVAVLVVYLIQIGRSKSKSELALNMFYLYAITVLTLMCTSAIIGLIIYR-IENKSLDDSESPAKKLDSDLLVGSACGSWLISWGSILAIICAETHPDYTWYNLP------YSILVIIEKYIQNLFIIE 440          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: ENSXETT00000044547.1 (otopetrin 2 [Source:NCBI gene;Acc:100496174])

HSP 1 Score: 57.3806 bits (137), Expect = 5.495e-8
Identity = 68/264 (25.76%), Postives = 118/264 (44.70%), Query Frame = 1
Query:  613 LFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYE---INHELLDHKNTSQINIHGNSTIRHENKTC--------TDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVG----GNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFM-VTLVGLAIFLLFK---KTDKTQTLAVMVY 1347
            L+TS+   + Y +K+++   ++LR G V FG   +V D  K+   V L +  C + +      +   ++ IQT+F++   +     H  + R  L     +N+  W   V  E   + HEL    N +     G      E+  C        T Q  Y    YL+P  IEYSL ++A+ Y M + VG    G+ H   H+  K +T                + LFVGL+  + V + GL +F+++K     ++T++ A+ ++
Sbjct:  115 LWTSK---HKYNLKDSHAGPIWLRGGLVLFGVCTLVLDVMKIGKSVTLIH--CESPVKIVHPVIQGVFVVIQTYFLWVSCKDCAQIHMNLTRCGLMITLSTNLAVWMAAVTDESLHLTHELNMDVNYTVSATVGPRAAGGESHGCECATHVCKTFQNGYY---YLYPFNIEYSLFASAMSYVMWKNVGRVMSGHHH---HTQHKFKT----------------RNLFVGLICGIGVFVAGLGVFIVYKIEVDVEETRSQAITMF 351          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: ENSXETT00000044555.1 (otopetrin 2 [Source:NCBI gene;Acc:100496174])

HSP 1 Score: 56.9954 bits (136), Expect = 8.692e-8
Identity = 68/264 (25.76%), Postives = 118/264 (44.70%), Query Frame = 1
Query:  613 LFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYE---INHELLDHKNTSQINIHGNSTIRHENKTC--------TDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVG----GNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFM-VTLVGLAIFLLFK---KTDKTQTLAVMVY 1347
            L+TS+   + Y +K+++   ++LR G V FG   +V D  K+   V L +  C + +      +   ++ IQT+F++   +     H  + R  L     +N+  W   V  E   + HEL    N +     G      E+  C        T Q  Y    YL+P  IEYSL ++A+ Y M + VG    G+ H   H+  K +T                + LFVGL+  + V + GL +F+++K     ++T++ A+ ++
Sbjct:   77 LWTSK---HKYNLKDSHAGPIWLRGGLVLFGVCTLVLDVMKIGKSVTLIH--CESPVKIVHPVIQGVFVVIQTYFLWVSCKDCAQIHMNLTRCGLMITLSTNLAVWMAAVTDESLHLTHELNMDVNYTVSATVGPRAAGGESHGCECATHVCKTFQNGYY---YLYPFNIEYSLFASAMSYVMWKNVGRVMSGHHH---HTQHKFKT----------------RNLFVGLICGIGVFVAGLGVFIVYKIEVDVEETRSQAITMF 313          
BLAST of Otopetrin vs. Ensembl Mouse
Match: Otop1 (otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363])

HSP 1 Score: 53.9138 bits (128), Expect = 5.020e-7
Identity = 47/189 (24.87%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKT----CTDQ-----LSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQ 1191
            K+T+    +LR     F F  +V    KVA  +         +   P    H  +  +Q +F++ + + I +  K + RF + H   +N+  W  +V+ E  H+L +HK        GN TI  ++ T    CT       LS+ +  YL+P  IEY ++++ + Y + + +G      +H   K+Q +
Sbjct:  119 KDTHAGARWLRGSITLFAFITVVLGCLKVAYFIGFSECLSATEGVFPVT--HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLGFGNITIVLDDHTPQCNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGRRVDSSQH--QKMQCR 302          
BLAST of Otopetrin vs. Ensembl Mouse
Match: Otop1 (otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363])

HSP 1 Score: 53.9138 bits (128), Expect = 5.214e-7
Identity = 47/189 (24.87%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKT----CTDQ-----LSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQ 1191
            K+T+    +LR     F F  +V    KVA  +         +   P    H  +  +Q +F++ + + I +  K + RF + H   +N+  W  +V+ E  H+L +HK        GN TI  ++ T    CT       LS+ +  YL+P  IEY ++++ + Y + + +G      +H   K+Q +
Sbjct:  122 KDTHAGARWLRGSITLFAFITVVLGCLKVAYFIGFSECLSATEGVFPVT--HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLGFGNITIVLDDHTPQCNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGRRVDSSQH--QKMQCR 305          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|B7Z0W9|OTOP_DROME (Proton channel OtopLc OS=Drosophila melanogaster OX=7227 GN=OtopLc PE=3 SV=2)

HSP 1 Score: 239.965 bits (611), Expect = 6.569e-66
Identity = 150/453 (33.11%), Postives = 237/453 (52.32%), Query Frame = 1
Query:  670 NLYLRLGAVGFGFGVMVHDGFKVADQVRL-QNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFL-KHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTS--------QINIH--GNSTIRHENKT----------------CT-----DQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYS-ECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFIS---TIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKINIT 1917
            + YLR+GAV FG G M++ G +      L  ++ CHN L        +A+IFIQ +FIF  +  I + ++K + RF L H+  +N+  W   ++ E  HE+L   N          +I  H  G++ I+H+                   C        L    SP+LFPC IEYSLI AAI Y M + +   +       D + + +      YS +C R+HKGLFVG+L  ++T++ L IF +     +   +AV    + E+++  +++IA +   I++R L++       +LDD LL+    G F YN+F  I+   T+ S +           +L    ++  I+Q+  Q +F+L++SR+ A S   +R KPGR +VTF++V NLA+W +S  E  RA+ H I   +Y    W+IITH  +PL IF+RFHS++CL +IW +AYK+  T
Sbjct: 1013 SFYLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQY-DAYRSFSLDDILLVGAQTGSFLYNIFTVIAGHFTLRSDD-----------MLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYKLKPT 1453          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|Q7M734|OTOP1_RAT (Proton channel OTOP1 OS=Rattus norvegicus OX=10116 GN=Otop1 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.739e-6
Identity = 55/246 (22.36%), Postives = 108/246 (43.90%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKT----CTDQ-----LSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQ---VVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLF--KKTDKTQTLAVMVY 1347
            K+T+    +LR     F F  +V    KVA  +         +   P    H  +  +Q +F++ + + I +  K + RF + H   +N+  W  +V+ E  H+L +HK        GN TI  ++ T    CT       LS+ +  YL+P  IEY ++++ + Y + + +G      +H   K+Q +   V+V ++             +GL     T+  + ++++   +   K+++  +M Y
Sbjct:  122 KDTHAGARWLRGSITLFAFITIVLGCLKVAYFIGFSECLSATEGVFPVT--HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLGFGNITIVLDDHTPQCNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGRRVDSSRH--QKMQCRFDGVLVGSV-------------LGLTVLAATIAVVVVYMIHIGRSKSKSESALIMFY 349          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|Q80VM9|OTOP1_MOUSE (Proton channel OTOP1 OS=Mus musculus OX=10090 GN=Otop1 PE=1 SV=3)

HSP 1 Score: 53.9138 bits (128), Expect = 3.647e-6
Identity = 47/189 (24.87%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKT----CTDQ-----LSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQ 1191
            K+T+    +LR     F F  +V    KVA  +         +   P    H  +  +Q +F++ + + I +  K + RF + H   +N+  W  +V+ E  H+L +HK        GN TI  ++ T    CT       LS+ +  YL+P  IEY ++++ + Y + + +G      +H   K+Q +
Sbjct:  122 KDTHAGARWLRGSITLFAFITVVLGCLKVAYFIGFSECLSATEGVFPVT--HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLGFGNITIVLDDHTPQCNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGRRVDSSQH--QKMQCR 305          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4Z2D9Y9 (Otopetrin isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_003030 PE=4 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 2.743e-118
Identity = 209/471 (44.37%), Postives = 292/471 (62.00%), Query Frame = 1
Query:  643 YVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSF---CHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELL-DHKNTSQINI-------------HGNSTI---------------------RHENKT----------CTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSS--DKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYK 1905
            Y  ++T G+NLYLRLGAVGFGFGVM+ DGFK+A+      S    CH  LW P   LH  Y+F QT+F+FK+HR +F   K V+RF+L HL ++N+CQW KT+V EI  E   D + TS+ NI             HGN++I                      H+N T          C   + Y ++PYLFPCAIEYSLI+ AIFYKM ++VG   H  K S   +KL+ +   K  ++SECHRSHKGLFVGLL FM TLV +++F +F      +  A+ +YQ +E++LL  S++  + +  +++ L+   LSEE A DDNLLL+GL G+  Y+LFL +  +++   + N    ++  L+  K++ E+IQS+LQV F+LE+SR+CA +   ++ KPGR+++TFL+V NLA+W V+ FE K AD H I   YY    W IITH  LPLI+FFRFHS++CL+DIW  AY+
Sbjct:  466 YFSRDTEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEEGASSVVSCHGHLWIPLHLLHFIYVFWQTYFLFKHHRVVFNVQKFVLRFLLCHLAVANLCQWLKTIVDEIGSEPGHDEEPTSKWNIVSPSEYLMDSNITHGNTSIFKYASSVNRTKHNVATVPHRMNHDNATVNAVEQAVLGCGVTVKY-LAPYLFPCAIEYSLIAGAIFYKMFEKVG---HVRKESERLEKLR-KANPKISQFSECHRSHKGLFVGLLLFMATLVAMSLFFIFIVKRDRRNTAITLYQGTELVLLSVSTLTCLISLFRLQALKLSDLSEEVAFDDNLLLIGLVGMLFYDLFLLVPALEA---IPNG--VIAAKLYAAKAIMEMIQSMLQVFFILEASRRCAGTLEHIQKKPGRTMITFLLVLNLAMWFVNTFEVKHADNHSIHINYYSSMAWKIITHIALPLIVFFRFHSTVCLSDIWANAYR 926          
BLAST of Otopetrin vs. TrEMBL
Match: A0A504YZQ1 (Otopetrin (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_06924 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 6.344e-118
Identity = 201/470 (42.77%), Postives = 278/470 (59.15%), Query Frame = 1
Query:  643 YVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQ---NSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEIN----HELLDHKNTSQI----------------------------NIHGNSTIRHENKTCTDQLSYSVS--------------PYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYK 1905
            Y+ +++ G+NLYLRLGAVGFGFGVM+ DGFK+A+           CH+ LW P   LH  Y+F QT+F+FK+H+ +F   K  +RF+L HL ++N+CQW KT+V EI+    HE   H NTS                               I+G  +    N T    +   +S              P+LFPCAIEYSLI+ AIFYKM Q+VG    + +  +   +   + +  +++ECHRSHKGLF+GLL FM TLV + +F +F   +  +  A+ +YQ +E++LL  S    V   I+ R L+  +LSEE A DDNLLLVGL G+  Y+LFL +  I++ N        +   LF  K++ EI+QS+LQV F+LE+SR+CA S   VR KPGR+L+TFL++ NLA+W V+ FE KRAD   I   YY    W IITH  LP+I+FFRFHS++CL+DIW  AY+
Sbjct:  302 YLSRDSEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEADITGAGPCHSTLWIPIHVLHFVYVFWQTYFLFKHHQVVFNVQKFALRFLLCHLAVANLCQWLKTIVDEISNEPAHESPTHVNTSDTREDRVDLLWEAFSHSITRRDGSLNVSSDEIYGTYSTERLNHTVPHTVGVEISSHFGSCRSTAKYLAPFLFPCAIEYSLIAGAIFYKMFQKVGHVREESERLARMRKANTMTR--RFAECHRSHKGLFIGLLLFMATLVTMCLFFIFFTKENKKNTAITLYQSTELVLLALSLFTCVAIMIQFRVLKLSELSEEGAFDDNLLLVGLIGMIFYDLFLLVPAIEAINT-----GMIVARLFAAKALLEIVQSMLQVFFILEASRRCAGSLAHVRNKPGRTLITFLLILNLAMWFVNTFEVKRADNQSIHIDYYTGMAWKIITHIALPMIVFFRFHSTVCLSDIWANAYR 764          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4Z2D9Z2 (Otopetrin isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_003030 PE=4 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 1.013e-117
Identity = 210/472 (44.49%), Postives = 292/472 (61.86%), Query Frame = 1
Query:  643 YVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSF---CHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELL-DHKNTSQINI-------------HGNSTI---------------------RHENKT----------CTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSS--DKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDS-SNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYK 1905
            Y  ++T G+NLYLRLGAVGFGFGVM+ DGFK+A+      S    CH  LW P   LH  Y+F QT+F+FK+HR +F   K V+RF+L HL ++N+CQW KT+V EI  E   D + TS+ NI             HGN++I                      H+N T          C   + Y ++PYLFPCAIEYSLI+ AIFYKM ++VG   H  K S   +KL+ +   K  ++SECHRSHKGLFVGLL FM TLV +++F +F      +  A+ +YQ +E++LL  S++  + +  +++ L+   LSEE A DDNLLL+GL G+  Y+LFL +  +++  N +  +K      L+  K++ E+IQS+LQV F+LE+SR+CA +   ++ KPGR+++TFL+V NLA+W V+ FE K AD H I   YY    W IITH  LPLI+FFRFHS++CL+DIW  AY+
Sbjct:  509 YFSRDTEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEEGASSVVSCHGHLWIPLHLLHFIYVFWQTYFLFKHHRVVFNVQKFVLRFLLCHLAVANLCQWLKTIVDEIGSEPGHDEEPTSKWNIVSPSEYLMDSNITHGNTSIFKYASSVNRTKHNVATVPHRMNHDNATVNAVEQAVLGCGVTVKY-LAPYLFPCAIEYSLIAGAIFYKMFEKVG---HVRKESERLEKLR-KANPKISQFSECHRSHKGLFVGLLLFMATLVAMSLFFIFIVKRDRRNTAITLYQGTELVLLSVSTLTCLISLFRLQALKLSDLSEEVAFDDNLLLIGLVGMLFYDLFLLVPALEAIPNGVIAAK------LYAAKAIMEMIQSMLQVFFILEASRRCAGTLEHIQKKPGRTMITFLLVLNLAMWFVNTFEVKHADNHSIHINYYSSMAWKIITHIALPLIVFFRFHSTVCLSDIWANAYR 969          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4E0RHX6 (Otopetrin OS=Fasciola hepatica OX=6192 GN=D915_000863 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 1.025e-116
Identity = 201/470 (42.77%), Postives = 283/470 (60.21%), Query Frame = 1
Query:  643 YVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQ---NSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEIN----HELLDHKNTSQIN---------IHGNSTIRHENKT-----------CTDQLSYSV----------------------SPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYK 1905
            Y+ +++ G+NLYLRLGAVGFGFGVM+ DGFK+A+           CH+ LW P   LH  Y+F QT+F+FK+H+ +F   K  +RF+L HL ++N+CQW KT+V EI+    HE   H NTS  +            +S  R +               T++L+++V                      +P+LFPCAIEYSLI+ AIFYKM Q+VG    + +  +   +   + +  +++ECHRSHKGLF+GLL FM TLV + +F +F   +  +  A+ +YQ +E++LL  S    V   I+ R L+  +LSEE A DDNLLLVGL G+  Y+LFL +  I++ N        +   LF  K++ EI+QS+LQV F+LE+SR+CA S   VR KPGR+L+TFL++ NLA+W V+ FE KRAD   I   YY    W IITH  LP+I+FFRFHS++CL+DIW  AY+
Sbjct:  363 YLSRDSEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEADITGAGPCHSTLWIPIHVLHFVYVFWQTYFLFKHHQVVFNVQKFALRFLLCHLAVANLCQWLKTIVDEISNEPAHESPTHVNTSDTSEDHVDLLWEAFSHSITRRDGSLNLSSDEIYETYSTERLNHTVPHTVGVEVSSHFGSCRSTAKYLAPFLFPCAIEYSLIAGAIFYKMFQKVGHVREESERLARMRKANTMTR--RFAECHRSHKGLFIGLLLFMATLVTMCLFFIFFTKENKKNTAITLYQSTELVLLALSLFTCVAIMIQFRVLKLSELSEEGAFDDNLLLVGLIGMIFYDLFLLVPAIEAINT-----GMIVARLFAAKALLEIVQSMLQVFFILEASRRCAGSLAHVRNKPGRTLITFLLILNLAMWFVNTFEVKRADNQSIHIDYYTGMAWKIITHIALPMIVFFRFHSTVCLSDIWANAYR 825          
BLAST of Otopetrin vs. TrEMBL
Match: G4VMW5 (Putative otopetrin OS=Schistosoma mansoni OX=6183 GN=Smp_152940 PE=4 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 2.212e-116
Identity = 207/487 (42.51%), Postives = 291/487 (59.75%), Query Frame = 1
Query:  643 YVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQ-VRLQNSF--CHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHE-------------------LLDHK---NTSQINIHGNSTI------------------RHENKTCTDQLSYS--------------------VSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSS--DKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDS-SNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYK 1905
            Y  ++T G+NLYLRLGAVGFGFGVM+ DGFK+A+    + NS   CH  LW P   LH  Y+F QT+F+FK+HR +F   K V+RF+L HL ++N+CQW KT+V EI  E                    LD K   N++ ++ + N T+                  +H   T     +Y                     ++PYLFPCAIEYSLI+ AIFYKM ++VG   H  K S   +KL+ +   K  ++SECHRSHKGLFVGLL FM TLV +++F +F      +  A+ +YQ +E++LL  S++  + +  +++ L+   LSEE A DDNLLL+GL G+  Y+LFL +  +++  N +  +K      L+  K++ E+IQS+LQV F+LE+SR+CA +   V+ KPGR+++TFL+V NLA+W V+ FE K AD H I   YY    W IITH  LPLI+FFRFHS++CL+DIW  AY+
Sbjct:  267 YFSRDTEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEEVANSVVSCHGHLWIPLHLLHFVYVFWQTYFLFKHHRVVFNVQKFVLRFLLCHLAVANLCQWLKTIVDEIGSEPGHEEELIPDSAIVFPSEYFLDAKTPLNSTTLHKYTNGTMSPTFNLTNLANMVLLNRKKHNANTKPHDANYDNSTVHAAEQAVLGCGITVKYLAPYLFPCAIEYSLIAGAIFYKMFEKVG---HVRKESERLEKLR-KANPKTSQFSECHRSHKGLFVGLLLFMATLVAMSLFFIFIVKRDRRNTAITLYQGTELVLLSVSTVTCLISLFRLQALKLSDLSEEVAFDDNLLLIGLVGMLFYDLFLLVPALEAIPNGVIAAK------LYAAKAIMEMIQSMLQVFFILEASRRCAGTLEHVQKKPGRTMITFLLVLNLAMWFVNTFEVKHADNHSIHINYYSSMAWKIITHIALPLIVFFRFHSTVCLSDIWANAYR 743          
BLAST of Otopetrin vs. Ensembl Cavefish
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:103039885])

HSP 1 Score: 79.337 bits (194), Expect = 5.496e-15
Identity = 106/475 (22.32%), Postives = 200/475 (42.11%), Query Frame = 1
Query:  652 KETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQIN---------IHGNSTIRHENKTCT--DQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSH-KGLFVGLLFFMVTLV-GLAIFLLFK------KTDKTQTLAVMVY-QXXXXXXXXXXXXXXXCAFIKM-RGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRV----------------------------------KP-------GRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIW 1890
            K+ +   ++LR G V FG   ++ D FK+A  V   +  C + +      +   +I +QT+F++ + +      + V R  L     +N+  W   V  E  H+ +    T+Q +           G+S+ +  + +C+  +Q  Y    YL+P  IEYSL ++A+ Y M + VG    D  H + +               HR H + + +G    +V LV GLA F++++        +K  T   + Y   +  I L++      C   ++ R       +   +LD  LL+    G F  + F  ++ + +   +D   ++L+    L  S+  +++  +Q +F++E  R+  +  HDVR                                   KP        + +  FL+++N+ LW +  F A+   ++ I T++YQ   W  + +  LP  IF+R HS   L +++
Sbjct:  141 KDVHAGPVWLRGGLVLFGVCSLIMDVFKIAYYVGYTH--CQSPVKIVFPVVQAVFILVQTYFLWLHAKDCVQVQRNVTRCGLMLTLATNLMLWMTAVTEESLHQTVYPDGTNQTSRTLLLRAAASDGDSSCQCSHTSCSIFEQAYY----YLYPFNIEYSLFASAMTYVMWRNVGRLVDD--HPAHE---------------HRFHLRDVLLGPAGGLVVLVAGLATFVVYEVDVSSGDQEKRDTALTLYYITNTVTIALMTMVTVAGCVIYRLERREHASGKNPTRSLDMGLLVGSSMGQFTVSYFTVVAVLGTG--VDGHVNALN----LAWSVITLLELCVQNVFIIEGIRR--EPHHDVRRASIFSNLLALHAQEDRRSSHVPTSPRGSIAIPVHKPLPWKRKILKEIAAFLLLSNIILWIMPAFGARPQFDNPIGTEFYQFNMWVAVVNVGLPFSIFYRMHSVASLFEVY 584          
BLAST of Otopetrin vs. Ensembl Nematostella
Match: EDO39144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAV2])

HSP 1 Score: 76.6406 bits (187), Expect = 1.469e-14
Identity = 82/382 (21.47%), Postives = 152/382 (39.79%), Query Frame = 1
Query:  889 FILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKTCTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRV----------GGNEHDEKHSSDKLQTQVVVKNIKYSECHRSH---------------KGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFC-------QLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSF-----HDVRVKPG----RSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKIN 1911
            F L H+   N+C WF  ++ E   ++   K  +  +   N+T+  EN      L    + +L+P  IEYS++S+ + + +   +            + + E + +    ++    +   S C +                 K    G    ++TLVGL + ++    +K     V           V   I ++ AF  + G+  C         S    +D  LL++G++G F    F  +       +L + +    +  FL  ++   +Q  +Q LFV+ +  + A+S+      DV ++      R +   L + N ALW ++ FE    + +         T WS++ H   PL IFFR HS  C  +I    + I+
Sbjct:  337 FFLMHIIGVNMCSWFYVIIEESAEDMKPTKPPNTYSQSCNATMAMEN------LIKKANYFLYPFEIEYSVMSSGLLFNLWYSLKQPPDYNSVESSDANSETNGNGIFSSKFCGLSAACSTCCKCKPESSPQGHARTVAFWKNAICGFSIGIITLVGLLVLIICVYAEKD----VARINPWNAYYGVRILIYIMMAFASLVGIN-CLVHFHPSSSSSHTIVDTVLLMIGISGAFILTGFQIVVGF---TELKSKRDKTYVTFFLLDAVAATVQFTVQTLFVIRALLRSAESYDNEVYRDVSIRTLSWFIRQIAALLSIVNFALWAMNTFEINFKEMNNPEISVIDSTVWSVVRHIAYPLCIFFRLHSVFCCFEIVINRFGID 704          
BLAST of Otopetrin vs. Ensembl Nematostella
Match: EDO48113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK62])

HSP 1 Score: 67.781 bits (164), Expect = 7.935e-12
Identity = 49/150 (32.67%), Postives = 73/150 (48.67%), Query Frame = 1
Query: 1450 ALDDNLLLVGLAGVFAY-NLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTV-SIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWT 1893
            A DD LL+   +G+F Y  L L     +  NK   S  S++      KS   + Q++LQ   V+++ R   +   ++     R    FL+ TN ALW   S FE +      + T +Y +  W  IT    PL IFFRFHS+ CL ++W+
Sbjct:  467 APDDTLLIASFSGLFLYAGLCLTAGIAEYKNKQLISSFSIA------KSTLILFQAMLQASAVIKALR--FKPIDEIGANVIRQGALFLLTTNFALWAQDSFFELRNFATTPVQTVFYGEKSWRAITTLAYPLCIFFRFHSAACLFEVWS 608          

HSP 2 Score: 61.6178 bits (148), Expect = 7.475e-10
Identity = 51/172 (29.65%), Postives = 75/172 (43.60%), Query Frame = 1
Query:  679 LRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPK---QCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKTCTDQLSYSVS-------PYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEK 1164
            L  GA  FG G  V D   +A  V      C + L  P          +IF Q  F+ K+  A   K  + IR +L+H+  +N+C WF+         L  H   S  ++ G +T+    +T    L YS+S       PYL+P  +EYSLI+  I Y M   +   + D +
Sbjct:  164 LMAGAYVFGAGSCVMDLLHIAFYVE-----CSSNL--PSLFFSVFKAVFIFSQILFLRKFATATLHKSPS-IRLVLFHILGTNVCIWFRA--------LFSHSR-SIFSVRGTTTLDSAAETECIALHYSMSKIWEASEPYLYPFTMEYSLIAGGILYNMWSGMRDLDPDPQ 318          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 79.7221 bits (195), Expect = 3.631e-15
Identity = 107/468 (22.86%), Postives = 207/468 (44.23%), Query Frame = 1
Query:  625 QQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHE--LLDHK-NTSQINI---------HGNSTIRHENKTCT--DQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVG--GNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFK---KT-----DKTQTLAVMVY--QXXXXXXXXXXXXXXXCAFIKMRGLR-FCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDV--------------------RVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDI 1887
            ++  N  + K+ +   ++LR G V FG   ++ D FK+A  V   +  C + +      + L ++ +QT+F++ + +      K +    L     +N+  W   V  E  H+  L D++ N ++++          +G+ + +  + +C    +  Y    YL+P  IEYSL ++A+ + M + VG   +EH + +    L+  V+              G  VG+L   + + GLA F++++   KT     D     AVM++      I+ ++S S  + CA  K+       + +   +LD  LL+    G F  + F  I+TI +  K   ++ +L+  + +      + Q  LQ  F++E   +  + FH+V                    + +  R +  FL++ N+ LW +  F A+   +H    ++Y+   W+ I +  LP  IF+R HS   L ++
Sbjct:  120 RRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYLH--CDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARSLYISKAGYGDDSCKCSHTSCGVFKEAYY----YLYPFNIEYSLFASAMSFVMWKNVGRVASEHSKHNFKFTLKDIVI--------------GPVVGIL---LVIAGLATFIVYEIEMKTYRSDDDDINDHAVMMHFIMNIVIVTMMSVSTVIGCAIFKVDHREHVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAKGHLNRLNLAWGVLM------VFQLGLQNFFIIEGLHR--EPFHEVEDNEKSEESCFEGHKHKLLWKRRVLREVCVFLLLGNIILWIMPAFGARPQFDHDTEVEFYKFNMWAAIVNVGLPFGIFYRMHSVASLFEV 556          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 75.485 bits (184), Expect = 6.779e-14
Identity = 109/479 (22.76%), Postives = 203/479 (42.38%), Query Frame = 1
Query:  625 QQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHE--LLDHK-NTSQINIHGNS-TIRHENKTCTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVG--GNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFK---KT-----DKTQTLAVMVY--QXXXXXXXXXXXXXXXCAFIKMRGLR-FCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVR----------------VKPG-------------------------RSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDI 1887
            ++  N  + K+ +   ++LR G V FG   ++ D FK+A  V   +  C + +      + L ++ +QT+F++ + +      K +    L     +N+  W   V  E  H+  L D++ N ++++   +S    H +     +  Y    YL+P  IEYSL ++A+ + M + VG   +EH + +    L+  V+              G  VG+L   + + GLA F++++   KT     D     AVM++      I+ ++S S  + CA  K+       + +   +LD  LL+    G F  + F  I+TI +  K   ++ +L+  + +      + Q  LQ  F++E   +  + FH+V                  KP                          R +  FL++ N+ LW +  F A+   +H    ++Y+   W+ I +  LP  IF+R HS   L ++
Sbjct:  119 RRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYLH--CDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARNDSCKCSHTSCGVFKEAYY----YLYPFNIEYSLFASAMSFVMWKNVGRVASEHSKHNFKFTLKDIVI--------------GPVVGIL---LVIAGLATFIVYEIEMKTYRSDDDDINDHAVMMHFIMNIVIVTMMSVSTVIGCAIFKVDHREHVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAKGHLNRLNLAWGVLM------VFQLGLQNFFIIEGLHR--EPFHEVEELEKTNASTFERGEGAAKPNLVPATLNYSSATEHKHKLLWKRRVLREVCVFLLLGNIILWIMPAFGARPQFDHDTEVEFYKFNMWAAIVNVGLPFGIFYRMHSVASLFEV 566          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 67.0106 bits (162), Expect = 3.454e-11
Identity = 112/503 (22.27%), Postives = 208/503 (41.35%), Query Frame = 1
Query:  625 QQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTIS-NICQWFKTVVYEINHE--LLDHK-NTSQINI---------HGNSTIRHENKTCT--DQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVG--GNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFK---KT-----DKTQTLAVMVY--QXXXXXXXXXXXXXXXCAFIKMRGLR-FCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVR-----------------------------VKPG-------------------------RSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDI 1887
            ++  N  + K+ +   ++LR G V FG   ++ D FK+A  V   +  C + +      + L ++ +QT+F++ + +     H  ++      LT+S N+  W   V  E  H+  L D++ N ++++          +G+ + +  + +C    +  Y    YL+P  IEYSL ++A+ + M + VG   +EH + +    L+  V+              G  VG+L   + + GLA F++++   KT     D     AVM++      I+ ++S S  + CA  K+       + +   +LD  LL+    G F  + F  I+TI +  K   ++      L L   +  + Q  LQ  F++E   +  + FH+V                               KP                          R +  FL++ N+ LW +  F A+   +H    ++Y+   W+ I +  LP  IF+R HS   L ++
Sbjct:   83 RRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYLH--CDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCV--HCGLM------LTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARSLYISKAGYGDDSCKCSHTSCGVFKEAYY----YLYPFNIEYSLFASAMSFVMWKNVGRVASEHSKHNFKFTLKDIVI--------------GPVVGIL---LVIAGLATFIVYEIEMKTYRSDDDDINDHAVMMHFIMNIVIVTMMSVSTVIGCAIFKVDHREHVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAKGHLNR------LNLAWGVLMVFQLGLQNFFIIEGLHR--EPFHEVEEPITVVENPYVLELLEKTNASTFERGEGAAKPNLVPATLNYSSATEHKHKLLWKRRVLREVCVFLLLGNIILWIMPAFGARPQFDHDTEVEFYKFNMWAAIVNVGLPFGIFYRMHSVASLFEV 546          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 54.6842 bits (130), Expect = 2.526e-7
Identity = 87/379 (22.96%), Postives = 170/379 (44.85%), Query Frame = 1
Query:  625 QQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHE--LLDHK-NTSQINI---------HGNSTIRHENKTCT--DQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVG--GNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFK---KT-----DKTQTLAVMVY--QXXXXXXXXXXXXXXXCAFIKMRGLR-FCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVR 1680
            ++  N  + K+ +   ++LR G V FG   ++ D FK+A  V   +  C + +      + L ++ +QT+F++ + +      K +    L     +N+  W   V  E  H+  L D++ N ++++          +G+ + +  + +C    +  Y    YL+P  IEYSL ++A+ + M + VG   +EH + +    L+  V+              G  VG+L   + + GLA F++++   KT     D     AVM++      I+ ++S S  + CA  K+       + +   +LD  LL+    G F  + F  I+TI +  K   ++ +L+  + +      + Q  LQ  F++E   +  + FH+V 
Sbjct:  123 RRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYLH--CDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARSLYISKAGYGDDSCKCSHTSCGVFKEAYY----YLYPFNIEYSLFASAMSFVMWKNVGRVASEHSKHNFKFTLKDIVI--------------GPVVGIL---LVIAGLATFIVYEIEMKTYRSDDDDINDHAVMMHFIMNIVIVTMMSVSTVIGCAIFKVDHREHVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAKGHLNRLNLAWGVLM------VFQLGLQNFFIIEGLHR--EPFHEVE 470          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 53.1434 bits (126), Expect = 8.527e-7
Identity = 86/379 (22.69%), Postives = 166/379 (43.80%), Query Frame = 1
Query:  625 QQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHE-------LLDHKNTSQINIH-----GNSTIRHENKTCT--DQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVG--GNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFK---KT-----DKTQTLAVMVY--QXXXXXXXXXXXXXXXCAFIKMRGLR-FCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVR 1680
            ++  N  + K+ +   ++LR G V FG   ++ D FK+A  V   +  C + +      + L ++ +QT+F++ + +      K +    L     +N+  W   V  E  H+       + + + T   + H     G+ + +  + +C    +  Y    YL+P  IEYSL ++A+ + M + VG   +EH + +    L+  V+              G  VG+L   + + GLA F++++   KT     D     AVM++      I+ ++S S  + CA  K+       + +   +LD  LL+    G F  + F  I+TI +  K   ++ +L+  + +      + Q  LQ  F++E   +  + FH+V 
Sbjct:  123 RRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYLH--CDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTPLTLQSVRNQQLTKLFSCHPAAGYGDDSCKCSHTSCGVFKEAYY----YLYPFNIEYSLFASAMSFVMWKNVGRVASEHSKHNFKFTLKDIVI--------------GPVVGIL---LVIAGLATFIVYEIEMKTYRSDDDDINDHAVMMHFIMNIVIVTMMSVSTVIGCAIFKVDHREHVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAKGHLNRLNLAWGVLM------VFQLGLQNFFIIEGLHR--EPFHEVE 470          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018672.1 (SMESG000018672.1)

HSP 1 Score: 1222.61 bits (3162), Expect = 0.000e+0
Identity = 614/620 (99.03%), Postives = 614/620 (99.03%), Query Frame = 1
Query:   61 MNEKELLKNEILDKSYSRSGRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDLDSQKVTFKLSHQNTEDVELENISNDDTTHLSTNNLQINNLSNAFNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKTCTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKINITK 1920
            MNEKELLKNEILDKSYSRS RRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDLDSQKVTFKLSHQNTEDVELENISNDDTTHLSTNNL     SNAFNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKTCTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQVSEIILLVSSSIALVCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKINITK
Sbjct:    1 MNEKELLKNEILDKSYSRSDRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDLDSQKVTFKLSHQNTEDVELENISNDDTTHLSTNNL-----SNAFNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKTCTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQVSEIILLVSSSIALVCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKINITK 615          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018671.1 (SMESG000018671.1)

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 383/623 (61.48%), Postives = 469/623 (75.28%), Query Frame = 1
Query:  112 RSGRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKN-----------NKKDDPCQDEITRELVDL-DSQKVTFKL-----SHQNTEDVELENISNDDTTHLSTNNLQINNLSNAFNTDDKSSHLENKL--FTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKTCTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKL-QTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKINITK 1920
            +  RRH+VAFADFAI + R+SI VSCTLLFAM QLF GIVIPLSDSFVTIS+    HAYYLEAFLIIQY +AI  VF+LQGY+++ +   K+N            KK     D I  + +D+ +S KVTF L     +HQ + ++ + ++  DD                 F T  K+SH  +++    SQ      ++++  GINLYLRLGAVGFGFGVMVHDGFK+AD+ RL+   CHN+LWTPK CLHL+YIF+QTFFIFKYHR IFLKHK ++RFILY+L  SNICQWFKTVVYEINHEL++H+N  +I++  N +  + N  C+ QLSY+VSP+LFPCAIEYSLISAAIFYKMLQ+VG    D  +    + Q + ++   KYSECHRSH+GLFVGLLFFMVTLVG+AIF LFKK   TQ+ +V+VYQ+SEI+LLVSS I LV AFIKMR L F QL+EE+ALDDNLLL+GL+GVF+YNLFLFISTIDS  +L   ++SL IILF+CKS+TE++QS +QVLFVLE SRK       +++KPGRSLVTFLI+ NLALW VSIFEAKR+DEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICL DIW+K+Y+ N+ K
Sbjct:   17 KKNRRHNVAFADFAIPDTRASIRVSCTLLFAMCQLFCGIVIPLSDSFVTISDSGMGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDI----------------FLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRN--KISMKSNLSENYSN--CSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIA--KYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRGNLNK 617          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018670.1 (SMESG000018670.1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 371/605 (61.32%), Postives = 453/605 (74.88%), Query Frame = 1
Query:  115 SGRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDL-----DSQKVTFKLSHQNTEDVELENISNDDTTHLSTNNL--QINNLSNAFNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKT-CTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVG-GNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAY 1902
            S R+ S+   +F INN RSS +VS T+L+AMSQLF GIV+PLSDSFV+ S+ E +H YYLE +L+IQY+ A+ S+F+LQGY+YI++ +L +   K+   ++E     V L     D+     +    N  ++E+    +++ T L   N   +IN +S +           + L  S+  +N ++  + +GIN+YLRLGAVGFGFGVMVHDGFK+ADQVR QNS CHN LWTPKQCLHLAYIF QTFFIFKYHR I+LKHK +IRFILYHLTISNIC+WFKTVVYEINHEL++H      NI         NKT C D+LS+SV+PYLFPCAIEYSLISAA+FYKM Q+VG  N      S   L ++     IKYSECHRSHKGLF+GLLFFM TLVGLA FL+FK+ +KTQTLA+MVYQVSEI+LL SS I+L+ AFI+MR L F QL+EEE  DDNL+LV LAGVF YNLFLFISTIDS+ ++ N K+SL++ LFLCKS+TEIIQSL+QV FVLESSRK A +      K GRS+VTFLI+ NLALWT+SIFEAKRADEHLIFT+YYQKTPW+IITHTLLPLIIFFRFHSSICLT IW K+Y
Sbjct:   19 STRKQSIGLMEFRINNSRSSTSVSITILYAMSQLFLGIVLPLSDSFVSNSDYEADHTYYLEIYLMIQYILAVISIFYLQGYIYIYEKFLSRKRNKNAEIKEEDKEIEVILANNFFDNNNKIDESYIINQNEIEVSAKEDEERTSLENTNFISKINQISVS----------NSNLADSENIDNKFIFHDNDGINVYLRLGAVGFGFGVMVHDGFKIADQVRAQNSSCHNHLWTPKQCLHLAYIFSQTFFIFKYHRIIYLKHKIIIRFILYHLTISNICEWFKTVVYEINHELIEH------NIKFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEK--HTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQVSEIVLLASSIISLIVAFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKHAINQKQALEKSGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKTPWTIITHTLLPLIIFFRFHSSICLTAIWRKSY 605          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018670.1 (SMESG000018670.1)

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 371/605 (61.32%), Postives = 453/605 (74.88%), Query Frame = 1
Query:  115 SGRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDL-----DSQKVTFKLSHQNTEDVELENISNDDTTHLSTNNL--QINNLSNAFNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKT-CTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVG-GNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAY 1902
            S R+ S+   +F INN RSS +VS T+L+AMSQLF GIV+PLSDSFV+ S+ E +H YYLE +L+IQY+ A+ S+F+LQGY+YI++ +L +   K+   ++E     V L     D+     +    N  ++E+    +++ T L   N   +IN +S +           + L  S+  +N ++  + +GIN+YLRLGAVGFGFGVMVHDGFK+ADQVR QNS CHN LWTPKQCLHLAYIF QTFFIFKYHR I+LKHK +IRFILYHLTISNIC+WFKTVVYEINHEL++H      NI         NKT C D+LS+SV+PYLFPCAIEYSLISAA+FYKM Q+VG  N      S   L ++     IKYSECHRSHKGLF+GLLFFM TLVGLA FL+FK+ +KTQTLA+MVYQVSEI+LL SS I+L+ AFI+MR L F QL+EEE  DDNL+LV LAGVF YNLFLFISTIDS+ ++ N K+SL++ LFLCKS+TEIIQSL+QV FVLESSRK A +      K GRS+VTFLI+ NLALWT+SIFEAKRADEHLIFT+YYQKTPW+IITHTLLPLIIFFRFHSSICLT IW K+Y
Sbjct:   21 STRKQSIGLMEFRINNSRSSTSVSITILYAMSQLFLGIVLPLSDSFVSNSDYEADHTYYLEIYLMIQYILAVISIFYLQGYIYIYEKFLSRKRNKNAEIKEEDKEIEVILANNFFDNNNKIDESYIINQNEIEVSAKEDEERTSLENTNFISKINQISVS----------NSNLADSENIDNKFIFHDNDGINVYLRLGAVGFGFGVMVHDGFKIADQVRAQNSSCHNHLWTPKQCLHLAYIFSQTFFIFKYHRIIYLKHKIIIRFILYHLTISNICEWFKTVVYEINHELIEH------NIKFIDKSDFHNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEK--HTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQVSEIVLLASSIISLIVAFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKHAINQKQALEKSGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKTPWTIITHTLLPLIIFFRFHSSICLTAIWRKSY 607          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018671.1 (SMESG000018671.1)

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 343/567 (60.49%), Postives = 424/567 (74.78%), Query Frame = 1
Query:  280 HAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKN-----------NKKDDPCQDEITRELVDL-DSQKVTFKL-----SHQNTEDVELENISNDDTTHLSTNNLQINNLSNAFNTDDKSSHLENKL--FTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKTCTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKL-QTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQXXXXXXXXXXXXXXXCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKINITK 1920
            HAYYLEAFLIIQY +AI  VF+LQGY+++ +   K+N            KK     D I  + +D+ +S KVTF L     +HQ + ++ + ++  DD                 F T  K+SH  +++    SQ      ++++  GINLYLRLGAVGFGFGVMVHDGFK+AD+ RL+   CHN+LWTPK CLHL+YIF+QTFFIFKYHR IFLKHK ++RFILY+L  SNICQWFKTVVYEINHEL++H+N  +I++  N +  + N  C+ QLSY+VSP+LFPCAIEYSLISAAIFYKMLQ+VG    D  +    + Q + ++   KYSECHRSH+GLFVGLLFFMVTLVG+AIF LFKK   TQ+ +V+VYQ+SEI+LLVSS I LV AFIKMR L F QL+EE+ALDDNLLL+GL+GVF+YNLFLFISTIDS  +L   ++SL IILF+CKS+TE++QS +QVLFVLE SRK       +++KPGRSLVTFLI+ NLALW VSIFEAKR+DEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICL DIW+K+Y+ N+ K
Sbjct:   46 HAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDI----------------FLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRN--KISMKSNLSENYSN--CSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIA--KYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRGNLNK 590          
The following BLAST results are available for this feature:
BLAST of Otopetrin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
OTOP15.900e-620.32otopetrin 1 [Source:HGNC Symbol;Acc:HGNC:19656][more]
back to top
BLAST of Otopetrin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otpl-33.265e-3528.12OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL... [more]
otpl-33.265e-3528.12OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL... [more]
otpl-87.015e-3426.13OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:G5EDX... [more]
otpl-19.336e-3426.89OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O4506... [more]
otpl-19.396e-3426.89OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O4506... [more]
back to top
BLAST of Otopetrin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OtopLc5.178e-6733.11gene:FBgn0259150 transcript:FBtr0346834[more]
OtopLc5.217e-6733.11gene:FBgn0259150 transcript:FBtr0331168[more]
OtopLc6.553e-6733.11gene:FBgn0259150 transcript:FBtr0331167[more]
OtopLb3.947e-4727.65gene:FBgn0031514 transcript:FBtr0077608[more]
OtopLb6.870e-4727.65gene:FBgn0031514 transcript:FBtr0344796[more]
back to top
BLAST of Otopetrin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
otop27.589e-1222.03otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2][more]
otop21.301e-1122.89otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2][more]
back to top
BLAST of Otopetrin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc46a27.494e-1421.74solute carrier family 46 member 2 [Source:Xenbase;... [more]
crp.11.146e-921.81C-reactive protein, pentraxin-related, gene 1 [Sou... [more]
crp.11.346e-921.81C-reactive protein, pentraxin-related, gene 1 [Sou... [more]
ENSXETT00000044547.15.495e-825.76otopetrin 2 [Source:NCBI gene;Acc:100496174][more]
ENSXETT00000044555.18.692e-825.76otopetrin 2 [Source:NCBI gene;Acc:100496174][more]
back to top
BLAST of Otopetrin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Otop15.020e-724.87otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363][more]
Otop15.214e-724.87otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363][more]
back to top
BLAST of Otopetrin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|B7Z0W9|OTOP_DROME6.569e-6633.11Proton channel OtopLc OS=Drosophila melanogaster O... [more]
sp|Q7M734|OTOP1_RAT1.739e-622.36Proton channel OTOP1 OS=Rattus norvegicus OX=10116... [more]
sp|Q80VM9|OTOP1_MOUSE3.647e-624.87Proton channel OTOP1 OS=Mus musculus OX=10090 GN=O... [more]
back to top
BLAST of Otopetrin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D9Y92.743e-11844.37Otopetrin isoform 2 OS=Schistosoma japonicum OX=61... [more]
A0A504YZQ16.344e-11842.77Otopetrin (Fragment) OS=Fasciola gigantica OX=4683... [more]
A0A4Z2D9Z21.013e-11744.49Otopetrin isoform 1 OS=Schistosoma japonicum OX=61... [more]
A0A4E0RHX61.025e-11642.77Otopetrin OS=Fasciola hepatica OX=6192 GN=D915_000... [more]
G4VMW52.212e-11642.51Putative otopetrin OS=Schistosoma mansoni OX=6183 ... [more]
back to top
BLAST of Otopetrin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
otop25.496e-1522.32otopetrin 2 [Source:NCBI gene;Acc:103039885][more]
back to top
BLAST of Otopetrin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO391441.469e-1421.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481137.935e-1232.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Otopetrin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otop23.631e-1522.86otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop26.779e-1422.76otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop23.454e-1122.27otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop22.526e-722.96otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop28.527e-722.69otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
back to top
BLAST of Otopetrin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018672.10.000e+099.03SMESG000018672.1[more]
SMESG000018671.10.000e+061.48SMESG000018671.1[more]
SMESG000018670.10.000e+061.32SMESG000018670.1[more]
SMESG000018670.10.000e+061.32SMESG000018670.1[more]
SMESG000018671.10.000e+060.49SMESG000018671.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008781 ID=SMED30008781|Name=Otopetrin|organism=Schmidtea mediterranea sexual|type=transcript|length=2010bp
CAACAAATTAGTTCAAACACAATGGCATGTTTATAAAGATAAATGATTTT
ATAGTTCAACATGAATGAAAAGGAACTTTTGAAAAACGAAATTTTGGATA
AATCTTATTCTAGAAGTGGCAGAAGACATAGCGTGGCCTTCGCAGATTTT
GCAATTAACAATCCACGAAGTTCAATTGCTGTGTCATGCACTCTTTTATT
TGCCATGAGCCAGTTGTTTTTTGGAATTGTCATTCCATTATCAGATTCTT
TTGTGACGATTTCGGAAAAAGAAACAGAACATGCATATTATTTAGAGGCA
TTTTTAATTATCCAGTACGTGACAGCTATTGCTAGCGTATTTTTCTTGCA
AGGATATGTTTATATACACGATTGCTATTTGAAGAAAAATAATAAAAAAG
ACGATCCATGCCAAGACGAAATTACTCGCGAGCTTGTAGATTTGGATTCA
CAAAAGGTCACATTCAAGCTATCTCATCAAAACACTGAAGACGTAGAGCT
GGAAAATATTTCAAATGATGACACAACTCATTTGTCAACAAATAATTTGC
AAATAAATAATTTGTCAAATGCTTTTAACACCGATGACAAGTCAAGTCAC
TTAGAAAACAAATTATTTACATCTCAACAATTTAATAACTATTACGTTAT
AAAAGAAACTAATGGAATAAATCTTTACTTGAGACTTGGAGCTGTTGGAT
TTGGGTTTGGAGTTATGGTCCATGACGGCTTTAAAGTTGCTGATCAAGTT
AGGCTGCAAAATAGTTTTTGCCACAACCAACTATGGACTCCAAAGCAATG
TTTACATCTAGCTTATATTTTCATTCAAACATTTTTTATTTTCAAATATC
ACAGAGCAATTTTCCTCAAGCACAAAGCTGTCATTCGGTTCATTTTGTAT
CACTTAACTATTTCCAATATTTGCCAGTGGTTCAAAACTGTTGTTTATGA
AATTAATCACGAACTGCTGGATCATAAAAACACTTCACAAATCAATATTC
ATGGAAATTCTACCATACGTCATGAAAACAAAACCTGCACAGACCAATTA
TCCTATTCTGTGTCACCGTATCTGTTTCCTTGTGCAATTGAATATAGCTT
GATAAGTGCAGCTATTTTTTACAAAATGCTTCAAAGGGTTGGTGGTAACG
AACACGATGAGAAGCACTCATCAGATAAATTGCAAACTCAAGTCGTGGTA
AAGAATATCAAATATTCCGAATGTCATAGGTCACACAAAGGTCTCTTTGT
AGGCTTACTATTTTTTATGGTTACTCTTGTTGGACTGGCTATTTTTCTTT
TATTTAAAAAGACTGACAAAACACAAACTTTAGCAGTTATGGTCTACCAA
GTATCGGAAATAATTCTTCTGGTTTCGAGTTCAATAGCTCTAGTCTGCGC
TTTCATTAAAATGAGAGGACTTCGTTTTTGTCAACTGTCGGAAGAGGAGG
CATTAGATGATAATCTGTTGTTAGTTGGACTTGCTGGAGTTTTTGCGTAC
AATTTGTTTTTGTTTATTTCCACAATTGATTCATCGAATAAATTGGACAA
TAGTAAACATTCGCTATCGATAATTCTATTCTTGTGCAAATCAATGACAG
AAATTATCCAGTCATTATTGCAGGTTTTGTTTGTTTTGGAAAGTTCAAGA
AAATGCGCTCAGAGTTTTCACGATGTAAGAGTGAAGCCTGGAAGATCTCT
TGTAACATTTTTAATTGTCACAAATCTAGCACTATGGACTGTGAGCATCT
TTGAGGCCAAACGGGCTGATGAACATTTGATATTCACTAAATATTACCAG
AAAACCCCATGGAGCATTATAACTCACACTCTCTTGCCATTGATAATATT
TTTTAGATTCCATTCCTCTATTTGCCTTACAGATATTTGGACAAAAGCTT
ACAAGATTAATATAACAAAATGATTTTAAAAATATTTATTAGAAATCGAT
GATTTACTATTTTTACATGTACAATTATTTTTAATATTTGTTTTAAATAA
ATGATTTGTT
back to top

protein sequence of SMED30008781-orf-1

>SMED30008781-orf-1 ID=SMED30008781-orf-1|Name=SMED30008781-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=621bp
MNEKELLKNEILDKSYSRSGRRHSVAFADFAINNPRSSIAVSCTLLFAMS
QLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYV
YIHDCYLKKNNKKDDPCQDEITRELVDLDSQKVTFKLSHQNTEDVELENI
SNDDTTHLSTNNLQINNLSNAFNTDDKSSHLENKLFTSQQFNNYYVIKET
NGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHL
AYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINH
ELLDHKNTSQINIHGNSTIRHENKTCTDQLSYSVSPYLFPCAIEYSLISA
AIFYKMLQRVGGNEHDEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLL
FFMVTLVGLAIFLLFKKTDKTQTLAVMVYQVSEIILLVSSSIALVCAFIK
MRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKH
SLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTF
LIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRF
HSSICLTDIWTKAYKINITK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR004878Otopetrin
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 615..615
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
NoneNo IPR availableTMHMMTMhelixcoord: 464..484
NoneNo IPR availableTMHMMTMhelixcoord: 421..443
NoneNo IPR availableTMHMMTMhelixcoord: 39..61
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
NoneNo IPR availableTMHMMTMhelixcoord: 579..601
NoneNo IPR availableTMHMMTMhelixcoord: 542..559
NoneNo IPR availableTMHMMTMhelixcoord: 499..521
IPR004878OtopetrinPFAMPF03189Otopetrincoord: 201..311
e-value: 1.1E-27
score: 97.0
coord: 313..595
e-value: 1.1E-73
score: 248.6
IPR004878OtopetrinPANTHERPTHR21522OTOPETRINcoord: 32..610