Piezo-type mechanosensitive ion channel component

Overview
NamePiezo-type mechanosensitive ion channel component
Smed IDSMED30008757
Length (bp)3999
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Piezo-type mechanosensitive ion channel component (SMED30008757) t-SNE clustered cells

Violin plots show distribution of expression levels for Piezo-type mechanosensitive ion channel component (SMED30008757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Piezo-type mechanosensitive ion channel component (SMED30008757) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Piezo-type mechanosensitive ion channel component (SMED30008757) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008757

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008757h1SMcG0009875 PL08005A2E08smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30008757h1SMcG0010500 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008757h1SMcG0010500 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30008757h1SMcG0010500 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008757h1SMcG0010500 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008757h1SMcG0009875 Contig4157GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30008757h1SMcG0009875 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008757h1SMcG0009875 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30008757h1SMcG0009875 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008757h1SMcG0009875 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30008757h1SMcG0009875 dd_Smed_v4_7182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30008757h1SMcG0009875 dd_Smed_v4_7182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008757h1SMcG0009875 dd_Smed_v4_7182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008757h1SMcG0009875 dd_Smed_v4_7182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008757h1SMcG0009875 dd_Smed_v4_7182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008757h1SMcG0009875 dd_Smed_v4_7182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008757h1SMcG0009875 dd_Smed_v4_7182_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008757h1SMcG0018728 Contig4157GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30008757h1SMcG0020490 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008757h1SMcG0020490 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30008757h1SMcG0020490 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008757h1SMcG0020490 dd_Smed_v4_1447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 429.869 bits (1104), Expect = 1.461e-124
Identity = 226/591 (38.24%), Postives = 371/591 (62.77%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +++F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+  +  QL YFVKC+YF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ + +++F +  +       +  +L+++E +D T   ++  S+++W I+PP  +K+  +L  P +S  +      +R  +    +E I     S  L N  + N+  +I   +T+ + T V +  I+P ++ A   + S+      ++NN +++I++ +  DN       WW +N +   + Y PN  +       L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2171 IKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSE-IATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMDITIILSRDNTTKYNSEWWVLN-LTGNRIYNPNSQA-------LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2749          

HSP 2 Score: 125.946 bits (315), Expect = 3.213e-28
Identity = 76/165 (46.06%), Postives = 102/165 (61.82%), Query Frame = 3
Query: 1275 LLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVD-PLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLW--RDHTEFAQDLEIVDKE-------QDGRNKIKS 1739
            LL  ++ N  +  SE VCYF++ILNHM+S ++ +L  P+++FLWAMLSVPRPS+ FW+  I YTE+ IV+KY FQF F  +N+      D P   P IIG+EK + Y + DLIQLL +F HR  LK +GLW   D TE     E  D E       +D  + +KS
Sbjct: 1909 LLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKNVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDEDDMTESGMAREESDDELSLGHGRRDSSDSLKS 2073          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 429.869 bits (1104), Expect = 1.870e-124
Identity = 226/591 (38.24%), Postives = 371/591 (62.77%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +++F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+  +  QL YFVKC+YF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ + +++F +  +       +  +L+++E +D T   ++  S+++W I+PP  +K+  +L  P +S  +      +R  +    +E I     S  L N  + N+  +I   +T+ + T V +  I+P ++ A   + S+      ++NN +++I++ +  DN       WW +N +   + Y PN  +       L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2196 IKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSE-IATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMDITIILSRDNTTKYNSEWWVLN-LTGNRIYNPNSQA-------LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2774          

HSP 2 Score: 125.946 bits (315), Expect = 3.686e-28
Identity = 76/165 (46.06%), Postives = 102/165 (61.82%), Query Frame = 3
Query: 1275 LLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVD-PLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLW--RDHTEFAQDLEIVDKE-------QDGRNKIKS 1739
            LL  ++ N  +  SE VCYF++ILNHM+S ++ +L  P+++FLWAMLSVPRPS+ FW+  I YTE+ IV+KY FQF F  +N+      D P   P IIG+EK + Y + DLIQLL +F HR  LK +GLW   D TE     E  D E       +D  + +KS
Sbjct: 1934 LLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKNVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDEDDMTESGMAREESDDELSLGHGRRDSSDSLKS 2098          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 429.483 bits (1103), Expect = 2.347e-124
Identity = 226/591 (38.24%), Postives = 371/591 (62.77%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +++F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+  +  QL YFVKC+YF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ + +++F +  +       +  +L+++E +D T   ++  S+++W I+PP  +K+  +L  P +S  +      +R  +    +E I     S  L N  + N+  +I   +T+ + T V +  I+P ++ A   + S+      ++NN +++I++ +  DN       WW +N +   + Y PN  +       L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2122 IKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSE-IATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMDITIILSRDNTTKYNSEWWVLN-LTGNRIYNPNSQA-------LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2700          

HSP 2 Score: 125.946 bits (315), Expect = 3.692e-28
Identity = 76/165 (46.06%), Postives = 102/165 (61.82%), Query Frame = 3
Query: 1275 LLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVD-PLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLW--RDHTEFAQDLEIVDKE-------QDGRNKIKS 1739
            LL  ++ N  +  SE VCYF++ILNHM+S ++ +L  P+++FLWAMLSVPRPS+ FW+  I YTE+ IV+KY FQF F  +N+      D P   P IIG+EK + Y + DLIQLL +F HR  LK +GLW   D TE     E  D E       +D  + +KS
Sbjct: 1860 LLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKNVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDEDDMTESGMAREESDDELSLGHGRRDSSDSLKS 2024          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO1 (piezo type mechanosensitive ion channel component 1 [Source:HGNC Symbol;Acc:HGNC:28993])

HSP 1 Score: 387.497 bits (994), Expect = 1.851e-110
Identity = 225/596 (37.75%), Postives = 357/596 (59.90%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSMKTDNA------MMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            +RRF+  + + K+    DVY  MFL + + F+IIIFG+ +FG  + + D     +  +++P  F+ M++ QF  +++DRAL+LRK V GK  FQ+  VL IH W+FF LP +T++ FN  +  QL YFVKCIYFALSAYQ++ GYP RILGNFLT+ +N++NLFLF+G+ +VPFL ELR VMDW+WTD++++   WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S +  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+         +  ++  + P+D     I+ +S  +W I+PP   ++K +L    A + +    N Q    +  T   + EK +           + A+LL   + +    +V +P +FP+++ A      EAN + Q   N+   YL + + ++ +        + WW V E+ + ++ C            L + IF++++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+
Sbjct: 1942 LRRFFHDILHTKYRAATDVYALMFLADVVDFIIIIFGFWAFGKHSAATDITSS-LSDDQVPEAFLVMLLIQFSTMVVDRALYLRKTVLGKLAFQVALVLAIHLWMFFILPAVTERMFNQNVVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSSWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLVRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQ----SVVIPNLFPKYIRAPNG--PEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWW-VIELQECRTDCN----------LLPMVIFSDKVSPPSLGFL-AGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTR 2518          

HSP 2 Score: 115.161 bits (287), Expect = 6.560e-25
Identity = 62/126 (49.21%), Postives = 85/126 (67.46%), Query Frame = 3
Query: 1311 YSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRV---DPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTE 1679
            +SE +CYF++ILNHM++ +  SL  P++VFLWAMLS+PRPSK FW+  I +TEI +V+KY+FQF F  +N     R     P + P I+G+EK+  Y   DL+QL+ +F HR  L   GLW DH E
Sbjct: 1686 HSELLCYFIIILNHMVTASAGSLVLPVLVFLWAMLSIPRPSKRFWMTAIVFTEIAVVVKYLFQFGFFPWNSHVVLRRYENKPYFPPRILGLEKTDGYIKYDLVQLMALFFHRSQLLCYGLW-DHEE 1810          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 250.751 bits (639), Expect = 1.383e-66
Identity = 107/216 (49.54%), Postives = 161/216 (74.54%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGE 2444
            +++F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+  +  QL YFVKC+YF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E
Sbjct: 2171 IKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESE 2385          

HSP 2 Score: 152.14 bits (383), Expect = 3.762e-36
Identity = 99/311 (31.83%), Postives = 175/311 (56.27%), Query Frame = 3
Query: 2634 PLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            P+F  S++++ ++ + +++F +  +       +  +L+++E +D T   ++  S+++W I+PP  +K+  +L  P +S  +      +R  +    +E I     S  L N  + N+  +I   +T+ + T V +  I+P ++ A   + S+      ++NN +++I++ +  DN       WW +N +   + Y PN  +       L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2387 PIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSE-IATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMDITIILSRDNTTKYNSEWWVLN-LTGNRIYNPNSQA-------LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2686          

HSP 3 Score: 125.946 bits (315), Expect = 3.221e-28
Identity = 76/165 (46.06%), Postives = 102/165 (61.82%), Query Frame = 3
Query: 1275 LLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVD-PLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLW--RDHTEFAQDLEIVDKE-------QDGRNKIKS 1739
            LL  ++ N  +  SE VCYF++ILNHM+S ++ +L  P+++FLWAMLSVPRPS+ FW+  I YTE+ IV+KY FQF F  +N+      D P   P IIG+EK + Y + DLIQLL +F HR  LK +GLW   D TE     E  D E       +D  + +KS
Sbjct: 1909 LLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKNVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDEDDMTESGMAREESDDELSLGHGRRDSSDSLKS 2073          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 348.591 bits (893), Expect = 1.938e-101
Identity = 258/953 (27.07%), Postives = 445/953 (46.69%), Query Frame = 3
Query:  969 SKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXX--XXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETT---NDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHT-----------------------EFAQDLEIVDKEQD------GRNKIKSSYEESSPTSNKWSCNPIYKMR------RFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENN-----MRPLTKKTFEEMKECHKFHLPSKD------------YLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAY-----KRTLSEANSLHQ---NQNNTYLNISLSMKTDNAMMWWE--VNEIIQGQS-----YCPNPDSPSKKYL---------------FLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFL-RTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 3563
            SK +++   +   I +  D   V +N   +E+R +   L  EK+ +K      +SN      ++ + V       S   V S N  E ++       + +S    L  ++ N    +++ +CYF  I+  +++G L +LP PLM   W  LS PRPSK FW+ +ITYTE VIVIK++ QF F+ +N  T     ++DP+ +  + G+ +  ++A+ D++ L  +F HR  L+  GLW+D                         + AQ+ ++V  + D      G   +  S   +     +  C P    +      RF  ++ +PKF    D+Y  MF  + I FLI+ FGY +FG G   + N  D +K ++IPV  + M++   + IIIDRAL+LRK V GK I+Q+  +  +H W+F  LP++T++   S    Q LY +K  YF +SA+Q+++GYP   +GN LT  +   N+  FK +M +PFL+ELR  +DW WTD+S+  + +  +E+ ++ IF +KC R  E  +P  RG  +  +VKY +G  I+I     I+ PL++ S +        P + +  I++  Y PL+   ++ +N     +  +       + +       ++D            YL+ +  +D   +     S+  W I+      + +KLS    +  +N +   E       +    ++ ++S  +       +   I +       + P + P+ + A+     +  L+   S+     N  N  +N +   K+D A  W++     + QG+S     +    + P  +                 +L +  F +R   +    +F   G++ +Y +   VV R L R  ++     +   ELPN D + K+  +IYLVRE K   LE+ L AKLIFL+RS  T+I+WT+  K   E
Sbjct:   97 SKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKLTDIRSAV----DLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEG--GSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLS---RNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGH-PILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKG-GVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE 1038          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 345.125 bits (884), Expect = 1.925e-97
Identity = 258/953 (27.07%), Postives = 445/953 (46.69%), Query Frame = 3
Query:  969 SKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXX--XXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETT---NDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHT-----------------------EFAQDLEIVDKEQD------GRNKIKSSYEESSPTSNKWSCNPIYKMR------RFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENN-----MRPLTKKTFEEMKECHKFHLPSKD------------YLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAY-----KRTLSEANSLHQ---NQNNTYLNISLSMKTDNAMMWWE--VNEIIQGQS-----YCPNPDSPSKKYL---------------FLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFL-RTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 3563
            SK +++   +   I +  D   V +N   +E+R +   L  EK+ +K      +SN      ++ + V       S   V S N  E ++       + +S    L  ++ N    +++ +CYF  I+  +++G L +LP PLM   W  LS PRPSK FW+ +ITYTE VIVIK++ QF F+ +N  T     ++DP+ +  + G+ +  ++A+ D++ L  +F HR  L+  GLW+D                         + AQ+ ++V  + D      G   +  S   +     +  C P    +      RF  ++ +PKF    D+Y  MF  + I FLI+ FGY +FG G   + N  D +K ++IPV  + M++   + IIIDRAL+LRK V GK I+Q+  +  +H W+F  LP++T++   S    Q LY +K  YF +SA+Q+++GYP   +GN LT  +   N+  FK +M +PFL+ELR  +DW WTD+S+  + +  +E+ ++ IF +KC R  E  +P  RG  +  +VKY +G  I+I     I+ PL++ S +        P + +  I++  Y PL+   ++ +N     +  +       + +       ++D            YL+ +  +D   +     S+  W I+      + +KLS    +  +N +   E       +    ++ ++S  +       +   I +       + P + P+ + A+     +  L+   S+     N  N  +N +   K+D A  W++     + QG+S     +    + P  +                 +L +  F +R   +    +F   G++ +Y +   VV R L R  ++     +   ELPN D + K+  +IYLVRE K   LE+ L AKLIFL+RS  T+I+WT+  K   E
Sbjct:  789 SKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKLTDIRSAV----DLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEG--GSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLS---RNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGH-PILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKG-GVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE 1730          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 345.125 bits (884), Expect = 1.925e-97
Identity = 258/953 (27.07%), Postives = 445/953 (46.69%), Query Frame = 3
Query:  969 SKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXX--XXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETT---NDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHT-----------------------EFAQDLEIVDKEQD------GRNKIKSSYEESSPTSNKWSCNPIYKMR------RFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENN-----MRPLTKKTFEEMKECHKFHLPSKD------------YLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAY-----KRTLSEANSLHQ---NQNNTYLNISLSMKTDNAMMWWE--VNEIIQGQS-----YCPNPDSPSKKYL---------------FLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFL-RTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 3563
            SK +++   +   I +  D   V +N   +E+R +   L  EK+ +K      +SN      ++ + V       S   V S N  E ++       + +S    L  ++ N    +++ +CYF  I+  +++G L +LP PLM   W  LS PRPSK FW+ +ITYTE VIVIK++ QF F+ +N  T     ++DP+ +  + G+ +  ++A+ D++ L  +F HR  L+  GLW+D                         + AQ+ ++V  + D      G   +  S   +     +  C P    +      RF  ++ +PKF    D+Y  MF  + I FLI+ FGY +FG G   + N  D +K ++IPV  + M++   + IIIDRAL+LRK V GK I+Q+  +  +H W+F  LP++T++   S    Q LY +K  YF +SA+Q+++GYP   +GN LT  +   N+  FK +M +PFL+ELR  +DW WTD+S+  + +  +E+ ++ IF +KC R  E  +P  RG  +  +VKY +G  I+I     I+ PL++ S +        P + +  I++  Y PL+   ++ +N     +  +       + +       ++D            YL+ +  +D   +     S+  W I+      + +KLS    +  +N +   E       +    ++ ++S  +       +   I +       + P + P+ + A+     +  L+   S+     N  N  +N +   K+D A  W++     + QG+S     +    + P  +                 +L +  F +R   +    +F   G++ +Y +   VV R L R  ++     +   ELPN D + K+  +IYLVRE K   LE+ L AKLIFL+RS  T+I+WT+  K   E
Sbjct:  789 SKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKLTDIRSAV----DLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEG--GSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLS---RNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGH-PILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKG-GVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE 1730          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 345.125 bits (884), Expect = 2.052e-97
Identity = 258/953 (27.07%), Postives = 445/953 (46.69%), Query Frame = 3
Query:  969 SKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXX--XXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETT---NDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHT-----------------------EFAQDLEIVDKEQD------GRNKIKSSYEESSPTSNKWSCNPIYKMR------RFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENN-----MRPLTKKTFEEMKECHKFHLPSKD------------YLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAY-----KRTLSEANSLHQ---NQNNTYLNISLSMKTDNAMMWWE--VNEIIQGQS-----YCPNPDSPSKKYL---------------FLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFL-RTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 3563
            SK +++   +   I +  D   V +N   +E+R +   L  EK+ +K      +SN      ++ + V       S   V S N  E ++       + +S    L  ++ N    +++ +CYF  I+  +++G L +LP PLM   W  LS PRPSK FW+ +ITYTE VIVIK++ QF F+ +N  T     ++DP+ +  + G+ +  ++A+ D++ L  +F HR  L+  GLW+D                         + AQ+ ++V  + D      G   +  S   +     +  C P    +      RF  ++ +PKF    D+Y  MF  + I FLI+ FGY +FG G   + N  D +K ++IPV  + M++   + IIIDRAL+LRK V GK I+Q+  +  +H W+F  LP++T++   S    Q LY +K  YF +SA+Q+++GYP   +GN LT  +   N+  FK +M +PFL+ELR  +DW WTD+S+  + +  +E+ ++ IF +KC R  E  +P  RG  +  +VKY +G  I+I     I+ PL++ S +        P + +  I++  Y PL+   ++ +N     +  +       + +       ++D            YL+ +  +D   +     S+  W I+      + +KLS    +  +N +   E       +    ++ ++S  +       +   I +       + P + P+ + A+     +  L+   S+     N  N  +N +   K+D A  W++     + QG+S     +    + P  +                 +L +  F +R   +    +F   G++ +Y +   VV R L R  ++     +   ELPN D + K+  +IYLVRE K   LE+ L AKLIFL+RS  T+I+WT+  K   E
Sbjct:  745 SKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKLTDIRSAV----DLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEG--GSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLS---RNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGH-PILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKG-GVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE 1686          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 344.739 bits (883), Expect = 2.507e-97
Identity = 258/953 (27.07%), Postives = 445/953 (46.69%), Query Frame = 3
Query:  969 SKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXX--XXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETT---NDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHT-----------------------EFAQDLEIVDKEQD------GRNKIKSSYEESSPTSNKWSCNPIYK------MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENN-----MRPLTKKTFEEMKECHKFHLPSKD------------YLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAY-----KRTLSEANSLHQ---NQNNTYLNISLSMKTDNAMMWWE--VNEIIQGQS-----YCPNPDSPSKKYL---------------FLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFL-RTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 3563
            SK +++   +   I +  D   V +N   +E+R +   L  EK+ +K      +SN      ++ + V       S   V S N  E ++       + +S    L  ++ N    +++ +CYF  I+  +++G L +LP PLM   W  LS PRPSK FW+ +ITYTE VIVIK++ QF F+ +N  T     ++DP+ +  + G+ +  ++A+ D++ L  +F HR  L+  GLW+D                         + AQ+ ++V  + D      G   +  S   +     +  C P         + RF  ++ +PKF    D+Y  MF  + I FLI+ FGY +FG G   + N  D +K ++IPV  + M++   + IIIDRAL+LRK V GK I+Q+  +  +H W+F  LP++T++   S    Q LY +K  YF +SA+Q+++GYP   +GN LT  +   N+  FK +M +PFL+ELR  +DW WTD+S+  + +  +E+ ++ IF +KC R  E  +P  RG  +  +VKY +G  I+I     I+ PL++ S +        P + +  I++  Y PL+   ++ +N     +  +       + +       ++D            YL+ +  +D   +     S+  W I+      + +KLS    +  +N +   E       +    ++ ++S  +       +   I +       + P + P+ + A+     +  L+   S+     N  N  +N +   K+D A  W++     + QG+S     +    + P  +                 +L +  F +R   +    +F   G++ +Y +   VV R L R  ++     +   ELPN D + K+  +IYLVRE K   LE+ L AKLIFL+RS  T+I+WT+  K   E
Sbjct:  763 SKVESTAKFIQKMIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKSGHSESLSNTSRKLTDIRSAV----DLPSLQLVQSANDVEKMETAVSVDWQQKSSATRLLNAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFGEG--GSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDKLS---RNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGH-PILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARAWFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKG-GVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSKKKQE 1704          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335175)

HSP 1 Score: 426.402 bits (1095), Expect = 1.098e-123
Identity = 261/809 (32.26%), Postives = 433/809 (53.52%), Query Frame = 3
Query: 1314 SEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFI--SFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRD-----HTEFAQDLEIVDKEQDGRN---------------KIKSSYEESS-PTSNKWSCNPIYKMRR----------FYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPG-TDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER--PSTDSK---STEKIVRFTQSRFLTNPEKANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPSKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            ++ +CY ++ +N +++ +L SLP P+MVFLW  LS+PRP+K FW+ LI YT+ +++IK IFQF  I  ++++  N    PL    I G+E   +YAI DLI LL +FLHR  LK+ GLW+        +F +    +D+  D  N               K+     ++S P S ++S   I ++ R          F+S +   +     DVY  MFLC+F+ F +++FG+ +FG   T+S +    ++  NK+P+PF+ M++ QF+ I+IDRAL+LRK +  K IF  F V+ IH W+FF +P +T++ FNS   P + Y +KC Y  LS+YQ+KSGYP RILGNF T+ F+ +N+  FK YM +PFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R  P+   K     E  +   +S       +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1886 TDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKSRL--ATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESF----EGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2676          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0347414)

HSP 1 Score: 426.402 bits (1095), Expect = 1.118e-123
Identity = 260/809 (32.14%), Postives = 434/809 (53.65%), Query Frame = 3
Query: 1314 SEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFI--SFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWR-----------------DHTEFAQDLEIVDKEQ---DGRNKIKSSYEESS-PTSNKWSCNPIYKMRR----------FYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPG-TDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLS-----IPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPSKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            ++ +CY ++ +N +++ +L SLP P+MVFLW  LS+PRP+K FW+ LI YT+ +++IK IFQF  I  ++++  N    PL    I G+E   +YAI DLI LL +FLHR  LK+ GLW+                 D  + + +L   D  Q   D   K+     ++S P S ++S   I ++ R          F+S +   +     DVY  MFLC+F+ F +++FG+ +FG   T+S +    ++  NK+P+PF+ M++ QF+ I+IDRAL+LRK +  K IF  F V+ IH W+FF +P +T++ FNS   P + Y +KC Y  LS+YQ+KSGYP RILGNF T+ F+ +N+  FK YM +PFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L        R S  +  +A   +   ++   E  +   +S       +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 2015 TDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKSRL--ATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLRNNHTLKARFSYSLTRKAPA-KGLKENVGDEHAISLDESF----EGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2805          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335183)

HSP 1 Score: 426.402 bits (1095), Expect = 1.118e-123
Identity = 278/909 (30.58%), Postives = 472/909 (51.93%), Query Frame = 3
Query: 1026 NLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNS--KNQEEYLKEQEXXXXXXXXXLLAISLGN--VAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFI--SFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRD-----HTEFAQDLEIVDKEQDGRN---------------KIKSSYEESS-PTSNKWSCNPIYKMRR----------FYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPG-TDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER--PSTDSK---STEKIVRFTQSRFLTNPEKANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPSKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
             L + +N +++ YR + R L  EK+ +K        +    R+ L +            F+ S  ++  E+  E+E    R    ++ + + +    +  ++ +CY ++ +N +++ +L SLP P+MVFLW  LS+PRP+K FW+ LI YT+ +++IK IFQF  I  ++++  N    PL    I G+E   +YAI DLI LL +FLHR  LK+ GLW+        +F +    +D+  D  N               K+     ++S P S ++S   I ++ R          F+S +   +     DVY  MFLC+F+ F +++FG+ +FG   T+S +    ++  NK+P+PF+ M++ QF+ I+IDRAL+LRK +  K IF  F V+ IH W+FF +P +T++ FNS   P + Y +KC Y  LS+YQ+KSGYP RILGNF T+ F+ +N+  FK YM +PFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R  P+   K     E  +   +S       +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1623 TLTIRLNRFSRNYRFVNRILAGEKKTLK-------ESSSLNRLGLSS------AAAMFHFLKSNLESAGEFNLEEENFAQRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKSRL--ATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESF----EGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2500          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335181)

HSP 1 Score: 426.402 bits (1095), Expect = 1.190e-123
Identity = 278/916 (30.35%), Postives = 475/916 (51.86%), Query Frame = 3
Query: 1026 NLIVLINTWTKEYRRIRRTLDNEKRLVK---------LKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXXXXXXXXXLLAISLGN--VAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFI--SFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRD-----HTEFAQDLEIVDKEQDGRN---------------KIKSSYEESS-PTSNKWSCNPIYKMRR----------FYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPG-TDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER--PSTDSK---STEKIVRFTQSRFLTNPEKANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPSKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
             L + +N +++ YR + R L  EK+ +K         L   + + + +   +E +  +        +S   +K   E+  E+E    R    ++ + + +    +  ++ +CY ++ +N +++ +L SLP P+MVFLW  LS+PRP+K FW+ LI YT+ +++IK IFQF  I  ++++  N    PL    I G+E   +YAI DLI LL +FLHR  LK+ GLW+        +F +    +D+  D  N               K+     ++S P S ++S   I ++ R          F+S +   +     DVY  MFLC+F+ F +++FG+ +FG   T+S +    ++  NK+P+PF+ M++ QF+ I+IDRAL+LRK +  K IF  F V+ IH W+FF +P +T++ FNS   P + Y +KC Y  LS+YQ+KSGYP RILGNF T+ F+ +N+  FK YM +PFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R  P+   K     E  +   +S       +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1649 TLTIRLNRFSRNYRFVNRILAGEKKTLKESSSLNRLGLSSAAAMFHFLKSNLERKQSI--------NSSPPAKGAGEFNLEEENFAQRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKSRL--ATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESF----EGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2538          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335182)

HSP 1 Score: 426.017 bits (1094), Expect = 1.487e-123
Identity = 261/809 (32.26%), Postives = 433/809 (53.52%), Query Frame = 3
Query: 1314 SEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFI--SFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRD-----HTEFAQDLEIVDKEQDGRN---------------KIKSSYEESS-PTSNKWSCNPIYKMRR----------FYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPG-TDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER--PSTDSK---STEKIVRFTQSRFLTNPEKANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPSKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            ++ +CY ++ +N +++ +L SLP P+MVFLW  LS+PRP+K FW+ LI YT+ +++IK IFQF  I  ++++  N    PL    I G+E   +YAI DLI LL +FLHR  LK+ GLW+        +F +    +D+  D  N               K+     ++S P S ++S   I ++ R          F+S +   +     DVY  MFLC+F+ F +++FG+ +FG   T+S +    ++  NK+P+PF+ M++ QF+ I+IDRAL+LRK +  K IF  F V+ IH W+FF +P +T++ FNS   P + Y +KC Y  LS+YQ+KSGYP RILGNF T+ F+ +N+  FK YM +PFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R  P+   K     E  +   +S       +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1728 TDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKSRL--ATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESF----EGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2518          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131119-76])

HSP 1 Score: 426.787 bits (1096), Expect = 1.755e-131
Identity = 225/593 (37.94%), Postives = 365/593 (61.55%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPE---KANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ-NQNNTYLNISLSMK-----TDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +R+F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P  F+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T+++F+     QL YFVKCIYF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +G + P+F  S+++N ++ LT+  F+     + +   +  +L+++  +D T   ++ +S+++W I+PP  K L + LS       + M    +R  +    +E    F   + +T  +   +  L+ L+N   N T V +  +FP F+ A   + S A  + Q  ++  Y +I L ++     +++   WW V+E+   Q          ++   L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct:  272 IRQFFYSLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYLNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKELTESDFKNFINSYNYVPSAMQFLEAYRAEDVTVAELEGSSNSLWTISPPSRKNLMDVLS-KEDQFPVTMTWSIQRNLSLGAKSE----FAMDKHVTYLDIKTRQELIALLNGTRN-TPVLIEQVFPCFIRA--PSDSNAKPIEQLYEDGVYKSIQLDLERSANSSEDLQEWWIVDELRSAQK--------QQREAGLQLYVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 846          

HSP 2 Score: 118.627 bits (296), Expect = 1.930e-26
Identity = 73/168 (43.45%), Postives = 102/168 (60.71%), Query Frame = 3
Query: 1278 LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTN-DRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWS 1778
            L  SL NV + +S+ VCY ++ILNHM+S ++ +L  P+++FLWAMLSVPRPSK FW+  I YTE+ IVIKY FQF F  FN++   D+  P   P IIG+EK + Y   DL+QLL +F HR  LK  GLW +     +   +      G  +    + E SP  + ++
Sbjct:   23 LCYSLYNVLVSHSQMVCYLVIILNHMISASVATLVLPVLIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFNQSIEVDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCYGLWDEE----EPRSVSPHTHSGAEEKAECFSEKSPVEDTYT 186          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: LO018508.1 (pep chromosome:GRCz11:2:54327160:54353625:1 gene:ENSDARG00000112723.1 transcript:ENSDART00000182320.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:LO018508.1)

HSP 1 Score: 416.387 bits (1069), Expect = 7.222e-131
Identity = 228/590 (38.64%), Postives = 352/590 (59.66%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTN-VYLPTIFPRFLTAYKRTLSEANSLHQNQ-NNTYLNISLSMKTDNA----MMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +R+F+  + +P+++   DVYV MFL + + F+II+FG+ +FG     AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP IT+++F+     QL YFVKCIYF LSAYQ++ GYP RILGNFLT+ +NY NLFLF+G+ ++PFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P+E S S+ +G   P+F  S+++N+++ +T                   +L+S+ P+D T   ++ +S+++W I+PP  + LK  L+  R    +      +R  +     E        ++    +      L +   NS+  V +  IFPR++    R  S++N+   +Q  N Y++I+L +   N+      WW VN+   G    P P         L I+I ++++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct:   26 IRQFFYNLVHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHQGGADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVVGKVIFQVILVFGIHFWMFFILPGITERRFSQNTIAQLWYFVKCIYFGLSAYQIRCGYPTRILGNFLTKSYNYANLFLFQGFRLIPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLEVSVSLTLGGLQPIFTMSAQQNHIKSVTGNAIM--------------FLESYFPEDLTIAHLEGSSNSLWTISPPSKENLKNMLNDTREPFPLTFTWSIQRNLSLGAKAET----AMGKYFIELDDETRKGLTDQLGNSSQRVTIKKIFPRYI----RAPSDSNAKPIDQLYNEYMDITLFLNKKNSSEGVQEWWIVNQTDSG----PLPGLNGSG---LQIYIISDQVSPPSLGFL-AGYGIMGLYMSVVLVIGKFVREFFSGISHTIMFEELPNVDRILKLCTDIFLVRETGELDLEEDLYAKLIFLYRSPETMIKWTRE 584          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131119-76])

HSP 1 Score: 426.017 bits (1094), Expect = 2.204e-123
Identity = 224/589 (38.03%), Postives = 363/589 (61.63%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ-NQNNTYLNISLSMK-----TDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            +R+F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P  F+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T+++F+     QL YFVKCIYF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +G + P+F  S+++N ++ LT+  F+     + +   +  +L+++  +D T   ++ +S+++W I+PP  K L + LS       + M    +R  +    +E  +      +L    +  L+ L+N   N T V +  +FP F+ A   + S A  + Q  ++  Y +I L ++     +++   WW V+E+   Q          ++   L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+
Sbjct: 2045 IRQFFYSLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYLNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKELTESDFKNFINSYNYVPSAMQFLEAYRAEDVTVAELEGSSNSLWTISPPSRKNLMDVLS-KEDQFPVTMTWSIQRNLSLGAKSEFAMD-KHVTYLDIKTRQELIALLNGTRN-TPVLIEQVFPCFIRA--PSDSNAKPIEQLYEDGVYKSIQLDLERSANSSEDLQEWWIVDELRSAQK--------QQREAGLQLYVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTR 2618          

HSP 2 Score: 118.627 bits (296), Expect = 4.063e-26
Identity = 73/168 (43.45%), Postives = 102/168 (60.71%), Query Frame = 3
Query: 1278 LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTN-DRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWS 1778
            L  SL NV + +S+ VCY ++ILNHM+S ++ +L  P+++FLWAMLSVPRPSK FW+  I YTE+ IVIKY FQF F  FN++   D+  P   P IIG+EK + Y   DL+QLL +F HR  LK  GLW +     +   +      G  +    + E SP  + ++
Sbjct: 1796 LCYSLYNVLVSHSQMVCYLVIILNHMISASVATLVLPVLIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFNQSIEVDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCYGLWDEE----EPRSVSPHTHSGAEEKAECFSEKSPVEDTYT 1959          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:ZFIN;Acc:ZDB-GENE-041111-255])

HSP 1 Score: 384.03 bits (985), Expect = 1.302e-109
Identity = 217/590 (36.78%), Postives = 351/590 (59.49%), Query Frame = 3
Query: 1806 FYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIV-RFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM------KTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            F+  + + ++    DVY  MFL + + F+IIIFG+ +FG  + +AD A   +  +++P  F+ M++ QF  +IIDRAL+LRK + GK IFQ+  V  IH W+FF LP +T++ FN     QL YF KCIYF LSAYQ++ GYP RILGNFLT+ FN++NLFLF+G+ +VPFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S +  +  V   P++ + ++ +G Y PLF  S ++ +++P T+  + ++      +  +  ++  +  +D     I+ +S +VW I+PP  ++L ++L      + + +    +R      + E    + + S    NP +A+L  L+        V++P +FP ++ A   + +EA  + Q        + ++++S+       T  A  WW+++ I   +  C            L + IFN+++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP  DRI KL  +I+LVRE  +L LEE+L +KLIFLYRS ETMIKWT+
Sbjct: 1858 FFQNILHAEYRASTDVYALMFLTDVVDFIIIIFGFWAFGKHSAAADIASS-LSEDQVPEAFLVMLLIQFSTMIIDRALYLRKSILGKLIFQVILVFGIHLWMFFILPAVTERMFNHNSVAQLWYFFKCIYFTLSAYQIRCGYPTRILGNFLTKKFNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKRIVKYGMGGLIILFLICIIWFPLLFISLVKSVVGVVNHPVDVTVTVKLGGYEPLFTMSVQQQSIQPFTESRYNQLNNQFSKNAVAMQFITMYSYEDIVTANIEGSSGSVWRISPPSRQELIKELLSSTGDMTLRLDWNFQRDLGKGGTVENTFDKHSISLAPKNPVRADLASLL-LGTRKDPVHVPHMFPNYIRA--PSGAEAKPVMQLFDGDEEGFQDVTVSLMREASVNTTGAQEWWDIS-IADCKESCN----------VLPMIIFNDKVSPPSLGFL-AGYGIMGLYVSVVLVIGKFVRGFFSEISHSIMFEELPCADRILKLCMDIFLVRETGELELEEELYSKLIFLYRSPETMIKWTR 2431          

HSP 2 Score: 121.709 bits (304), Expect = 3.970e-27
Identity = 69/150 (46.00%), Postives = 103/150 (68.67%), Query Frame = 3
Query: 1224 EEYLKEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFN---ETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLW 1664
            +E ++ +EF  S++R   L  +L NV   +SE VCYF+++LN++++ ++ SL  P++VFLWAMLSVPRPSK FW+  I YTE+++V+KY+FQF F  +N   E   +   P + P I+G+EK+ NY   DL+QLL +F HR  L+  GLW
Sbjct: 1596 DELIQSREFYSSQNRLLKLLFALYNVLAAHSELVCYFIIVLNNLVTASVISLVLPVLVFLWAMLSVPRPSKRFWMTAIIYTEVMVVVKYLFQFGFFPWNTEYELKLNEDKPFFPPRILGLEKTDNYIRYDLLQLLVLFFHRSLLQRYGLW 1745          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: si:dkey-11f4.7 (si:dkey-11f4.7 [Source:ZFIN;Acc:ZDB-GENE-070912-361])

HSP 1 Score: 264.618 bits (675), Expect = 1.733e-79
Identity = 126/280 (45.00%), Postives = 192/280 (68.57%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYS 2633
            +R+F+  + +P+++   DVY  MFL + + F+IIIFGY +FG  + +AD   + +  +++P  F+ M++ QF  +I+DRAL+LRK + GK +FQ+  V  IH W+FF LP +T+++FN     QL YFVKCIYF LSAYQ+K GYP R+LGNFLT++ NY NLFLF+G+ +VPFL ELR VMDW+WTD++++  +W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY++G  I+      +W PL+  S +  +  V   P++ S  +++  Y 
Sbjct:    9 IRQFFYDIIHPEYSPVCDVYALMFLIDVVNFIIIIFGYWAFGKHSAAADIT-ESLSEDQVPEAFLVMLLIQFSTMIVDRALYLRKTLLGKCVFQVVLVFGIHFWMFFILPGVTERRFNRNRVAQLWYFVKCIYFGLSAYQIKCGYPNRVLGNFLTKNHNYFNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSNWICVEDIYANIFILKCWREAEKKYPHRRGQRKKKVVKYTMGGFIIFALICIVWFPLLFMSLVKSVAGVTNQPLDVSIQLSILGYE 287          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: PIEZO2 (piezo-type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:100492729])

HSP 1 Score: 514.998 bits (1325), Expect = 5.542e-155
Identity = 301/766 (39.30%), Postives = 451/766 (58.88%), Query Frame = 3
Query: 1278 LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVD-PLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWR--DHTEFAQDLEIVDKEQDGRNKIKSSY-----EESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLH--QNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            L  +L N  +  SE VCYF++ILNHM+S ++ +L  P+++FLWAMLSVPRPSK FW+  I YTE+ IVIKY FQF F  +N+  +   D P + P I+GIEK + Y   DL+QLL +F HR  LK +GLW   D TE A D +  D E    +  + S+         P+       PI   R+F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P  F+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+     QL YFVKCIYF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S+++N ++ L    F+ +   +K + P+  +L+S+  +D T   ++  S+++W I+PP    + E+L               + P   +  +  I R+  S    N         +   F+   ++   I+P  L A    ++    LH    + NT         ++    WW VN   Q        D        L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+
Sbjct: 1214 LIYALYNTLVARSEMVCYFVIILNHMISASMITLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPWNKNVDYTKDKPYFPPNIMGIEKKEGYVHYDLVQLLALFFHRSILKCHGLWDEDDVTEKATDKDDTDGEISEASGRRDSFFILYILCFFPSRILQIYVPI---RQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERKFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVTNKPLDVSITITLGGYQPIFTMSAQQNQLQGLNDNEFKHLHNIYKGNTPAMQFLESYMQEDITIAGLEGNSNSLWTISPPSRTMMIERL--------------IQEPDFTAVISWSIRRYIISSLFYN---------LPNSFSYRPIF--HIYPLCLKA-PSDVTAKPILHVLLRKENT---------SEGVREWWVVN---QSHKEFIKKDG-------LELWVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTR 1929          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: PIEZO2 (piezo-type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:100492729])

HSP 1 Score: 513.842 bits (1322), Expect = 4.516e-154
Identity = 310/828 (37.44%), Postives = 468/828 (56.52%), Query Frame = 3
Query: 1191 GSHSFVNSKNQEEYLKEQEXXXXXXXXXL-LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVD-PLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWR--DHTEFAQDLEIVDKE-------QDGRNKIKSSY-------------EESSPTSNKWSCNP--------------IY-KMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDN----AMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
             S   +N    +E L++ E   +     L L  +L N  +  SE VCYF++ILNHM+S ++ +L  P+++FLWAMLSVPRPSK FW+  I YTE+ IVIKY FQF F  +N+  +   D P + P I+GIEK + Y   DL+QLL +F HR  LK +GLW   D TE A D +  D E       +D    +KS               EE +    K + +               IY  +R+F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P  F+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+     QL YFVKCIYF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S+++N ++ L    F+ +   +K + P+  +L+S+  +D T   ++  S+++W I+PP    + E+L               + P   +  +  I R   ++     EK                         ++   +T  E   +  NQ   ++NIS+ ++ +N       WW VN   Q        D        L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+
Sbjct: 1290 ASELLLNKMFYDEELEDSEKFYTTQPRPLQLIYALYNTLVARSEMVCYFVIILNHMISASMITLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPWNKNVDYTKDKPYFPPNIMGIEKKEGYVHYDLVQLLALFFHRSILKCHGLWDEDDVTEKATDKDDTDGEISEASGRRDSVGSLKSVNLAASVESVHVHFPEEKTAIRRKSTSSGSQISRRSSYSSILQIYVPIRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERKFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVTNKPLDVSITITLGGYQPIFTMSAQQNQLQGLNDNEFKHLHNIYKGNTPAMQFLESYMQEDITIAGLEGNSNSLWTISPPSRTMMIERL--------------IQEPDFTAVISWSI-RSLGAKAEVTGEKYT-----------------------ISLAGQTRRELADMMNNQE--FVNISVLLRKENTSEGVREWWVVN---QSHKEFIKKDG-------LELWVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTR 2065          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: PIEZO2 (piezo-type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:100492729])

HSP 1 Score: 512.301 bits (1318), Expect = 7.804e-154
Identity = 304/798 (38.10%), Postives = 457/798 (57.27%), Query Frame = 3
Query: 1278 LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVD-PLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWR--DHTEFAQDLEIVDKE-------QDGRNKIKSSY-------------EESSPTSNKWSCNP--------------IY-KMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDN----AMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            L  +L N  +  SE VCYF++ILNHM+S ++ +L  P+++FLWAMLSVPRPSK FW+  I YTE+ IVIKY FQF F  +N+  +   D P + P I+GIEK + Y   DL+QLL +F HR  LK +GLW   D TE A D +  D E       +D    +KS               EE +    K + +               IY  +R+F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P  F+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+     QL YFVKCIYF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S+++N ++ L    F+ +   +K + P+  +L+S+  +D T   ++  S+++W I+PP    + E+L               + P   +  +  I R   ++     EK                         ++   +T  E   +  NQ   ++NIS+ ++ +N       WW VN   Q        D        L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+
Sbjct: 1246 LIYALYNTLVARSEMVCYFVIILNHMISASMITLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPWNKNVDYTKDKPYFPPNIMGIEKKEGYVHYDLVQLLALFFHRSILKCHGLWDEDDVTEKATDKDDTDGEISEASGRRDSVGSLKSVNLAASVESVHVHFPEEKTAIRRKSTSSGSQISRRSSYSSILQIYVPIRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERKFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVTNKPLDVSITITLGGYQPIFTMSAQQNQLQGLNDNEFKHLHNIYKGNTPAMQFLESYMQEDITIAGLEGNSNSLWTISPPSRTMMIERL--------------IQEPDFTAVISWSI-RSLGAKAEVTGEKYT-----------------------ISLAGQTRRELADMMNNQE--FVNISVLLRKENTSEGVREWWVVN---QSHKEFIKKDG-------LELWVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTR 1991          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: chordc1 (cysteine and histidine rich domain containing 1 [Source:Xenbase;Acc:XB-GENE-962949])

HSP 1 Score: 476.478 bits (1225), Expect = 1.059e-140
Identity = 297/805 (36.89%), Postives = 469/805 (58.26%), Query Frame = 3
Query: 1278 LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETT---NDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLW------------------RDHTEFAQDLEIVDK-----EQDGRNKIKSSYEESSPTSNKWSC-------NPIYK-MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM---------KTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWT 3539
            L ++L N    +SE +CYF++ILN+M+S +L SL  P+++FLW MLS+ +PSK FW+  I +TE+++VIKY+FQF F  +N  T    +   P + P ++G+EKS +Y   DLIQLL +F HR  L + GLW                  +   + +QDLE          Q  R + + S +E    SN W+C         IY+ ++ F+  + + K     DVY FMFL + + F+II+FG+ +FG  + +AD A   +  +++P  F+ M++ QF  ++IDRAL+LRK V GK IFQ+  V+ IH W+FF LP +T++ FN     QL YFVKCIYFALSAYQ++ GYP RILGNFLT+ +N++NLFLF+G+ +VPFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S +  +  V   PI+ + +  +G Y PLF  S+++ +++P T + +E +    +    +  ++  +  +D     I+ +S +VW I+PP  ++++++L    + + +    + Q    +  T   ++EK  +  +       E A+LL  +      T V +  +FP+++ A      EAN + Q   ++  +YL++ + +          T + + WW +             D   +    L + IFN+++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +IY+VRE  +L LEE+L AKLIFLYRS ETMIKWT
Sbjct: 1368 LLLALYNFVAAHSELLCYFIIILNNMVSASLISLFLPILIFLWGMLSIHKPSKRFWMTAIIFTEVMVVIKYLFQFGFFPWNNYTILVRNEGKPFFPPRVLGLEKSDSYIKYDLIQLLMLFFHRSLLMSYGLWDRKDLDLEERTPGKDKGSKTEIQASQDLEPAGGSSSSLRQRKRKESQGSVQERGAESN-WTCAVQFTSLRNIYQPVKAFFHDILHTKNRAATDVYAFMFLADVVDFVIIVFGFWAFGKHSAAADIASS-LSDDQVPEAFLVMVLIQFSTMVIDRALYLRKTVLGKLIFQVILVIGIHVWMFFILPAVTERMFNQNTVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIIVFLICIIWFPLLFMSLVRSVVGVVNHPIDVTVTFKLGGYEPLFTMSAQQQSIQPFTPQQYEALTYEFERQPTAMQFITLYSYEDIVTARIEGSSGSVWGISPPSREQMRKELQNGSSDITLRFTWDFQRDLAKGGTVEHTSEKHTKDLEPGSQERMELADLLQGV----RDTPVSIQHLFPKYIRAPNG--PEANPVKQLQPDEEESYLDVEVQLNRMRVAEGNSTSSFVEWWVITL----------KDCEGEDCNILPMVIFNDKVSPPSLGFL-AGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIYVVRERGELELEEELYAKLIFLYRSPETMIKWT 2153          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: chordc1 (cysteine and histidine rich domain containing 1 [Source:Xenbase;Acc:XB-GENE-962949])

HSP 1 Score: 476.478 bits (1225), Expect = 1.204e-140
Identity = 297/805 (36.89%), Postives = 469/805 (58.26%), Query Frame = 3
Query: 1278 LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETT---NDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLW------------------RDHTEFAQDLEIVDK-----EQDGRNKIKSSYEESSPTSNKWSC-------NPIYK-MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM---------KTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWT 3539
            L ++L N    +SE +CYF++ILN+M+S +L SL  P+++FLW MLS+ +PSK FW+  I +TE+++VIKY+FQF F  +N  T    +   P + P ++G+EKS +Y   DLIQLL +F HR  L + GLW                  +   + +QDLE          Q  R + + S +E    SN W+C         IY+ ++ F+  + + K     DVY FMFL + + F+II+FG+ +FG  + +AD A   +  +++P  F+ M++ QF  ++IDRAL+LRK V GK IFQ+  V+ IH W+FF LP +T++ FN     QL YFVKCIYFALSAYQ++ GYP RILGNFLT+ +N++NLFLF+G+ +VPFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S +  +  V   PI+ + +  +G Y PLF  S+++ +++P T + +E +    +    +  ++  +  +D     I+ +S +VW I+PP  ++++++L    + + +    + Q    +  T   ++EK  +  +       E A+LL  +      T V +  +FP+++ A      EAN + Q   ++  +YL++ + +          T + + WW +             D   +    L + IFN+++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +IY+VRE  +L LEE+L AKLIFLYRS ETMIKWT
Sbjct: 1420 LLLALYNFVAAHSELLCYFIIILNNMVSASLISLFLPILIFLWGMLSIHKPSKRFWMTAIIFTEVMVVIKYLFQFGFFPWNNYTILVRNEGKPFFPPRVLGLEKSDSYIKYDLIQLLMLFFHRSLLMSYGLWDRKDLDLEERTPGKDKGSKTEIQASQDLEPAGGSSSSLRQRKRKESQGSVQERGAESN-WTCAVQFTSLRNIYQPVKAFFHDILHTKNRAATDVYAFMFLADVVDFVIIVFGFWAFGKHSAAADIASS-LSDDQVPEAFLVMVLIQFSTMVIDRALYLRKTVLGKLIFQVILVIGIHVWMFFILPAVTERMFNQNTVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIIVFLICIIWFPLLFMSLVRSVVGVVNHPIDVTVTFKLGGYEPLFTMSAQQQSIQPFTPQQYEALTYEFERQPTAMQFITLYSYEDIVTARIEGSSGSVWGISPPSREQMRKELQNGSSDITLRFTWDFQRDLAKGGTVEHTSEKHTKDLEPGSQERMELADLLQGV----RDTPVSIQHLFPKYIRAPNG--PEANPVKQLQPDEEESYLDVEVQLNRMRVAEGNSTSSFVEWWVITL----------KDCEGEDCNILPMVIFNDKVSPPSLGFL-AGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIYVVRERGELELEEELYAKLIFLYRSPETMIKWT 2205          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 422.935 bits (1086), Expect = 2.363e-122
Identity = 226/591 (38.24%), Postives = 367/591 (62.10%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +R+F+  + +P ++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+  +  QL YFVKC+YF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++  VKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ +    + E  +    +  +  +L+++E +D T   ++  S+++W I+PP  +K+ ++L+ P +   +      +R  T     E I     S  L    + ++  +I   +T+ ++T V +  I+P ++ A   + S+      ++NN ++NI++ +  DN       WW +N  + G S   N  S +     L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2197 IRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMTLGAKAE-IATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMNITIILFRDNVTKSNSEWWVLN--LTG-SRIFNQGSQA-----LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2775          

HSP 2 Score: 107.457 bits (267), Expect = 1.030e-22
Identity = 72/151 (47.68%), Postives = 97/151 (64.24%), Query Frame = 3
Query: 1275 LLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFN---ETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQD 1718
            LL  ++ N  +  SE VCYF++ILNHM S ++ +L  P+++FLWAMLSVPRPS+ FW+  I YTE+ IV+KY FQF F  +N   E   +R  P + P IIG+EK + Y + DLIQLL +F HR  LK +GLW +        +IVD   D
Sbjct: 1935 LLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLEIYKER--PYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDED-------DIVDSNTD 2076          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 422.935 bits (1086), Expect = 2.549e-122
Identity = 226/591 (38.24%), Postives = 367/591 (62.10%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +R+F+  + +P ++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+  +  QL YFVKC+YF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++  VKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ +    + E  +    +  +  +L+++E +D T   ++  S+++W I+PP  +K+ ++L+ P +   +      +R  T     E I     S  L    + ++  +I   +T+ ++T V +  I+P ++ A   + S+      ++NN ++NI++ +  DN       WW +N  + G S   N  S +     L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2172 IRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMTLGAKAE-IATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMNITIILFRDNVTKSNSEWWVLN--LTG-SRIFNQGSQA-----LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2750          

HSP 2 Score: 107.457 bits (267), Expect = 1.020e-22
Identity = 72/151 (47.68%), Postives = 97/151 (64.24%), Query Frame = 3
Query: 1275 LLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFN---ETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQD 1718
            LL  ++ N  +  SE VCYF++ILNHM S ++ +L  P+++FLWAMLSVPRPS+ FW+  I YTE+ IV+KY FQF F  +N   E   +R  P + P IIG+EK + Y + DLIQLL +F HR  LK +GLW +        +IVD   D
Sbjct: 1910 LLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLEIYKER--PYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDED-------DIVDSNTD 2051          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 422.55 bits (1085), Expect = 2.877e-122
Identity = 226/591 (38.24%), Postives = 367/591 (62.10%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +R+F+  + +P ++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+  +  QL YFVKC+YF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++  VKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ +    + E  +    +  +  +L+++E +D T   ++  S+++W I+PP  +K+ ++L+ P +   +      +R  T     E I     S  L    + ++  +I   +T+ ++T V +  I+P ++ A   + S+      ++NN ++NI++ +  DN       WW +N  + G S   N  S +     L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2243 IRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMTLGAKAE-IATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMNITIILFRDNVTKSNSEWWVLN--LTG-SRIFNQGSQA-----LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2821          

HSP 2 Score: 107.457 bits (267), Expect = 1.034e-22
Identity = 72/151 (47.68%), Postives = 97/151 (64.24%), Query Frame = 3
Query: 1275 LLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFN---ETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQD 1718
            LL  ++ N  +  SE VCYF++ILNHM S ++ +L  P+++FLWAMLSVPRPS+ FW+  I YTE+ IV+KY FQF F  +N   E   +R  P + P IIG+EK + Y + DLIQLL +F HR  LK +GLW +        +IVD   D
Sbjct: 1981 LLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLEIYKER--PYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDED-------DIVDSNTD 2122          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:MGI Symbol;Acc:MGI:3603204])

HSP 1 Score: 366.696 bits (940), Expect = 6.704e-104
Identity = 225/606 (37.13%), Postives = 359/606 (59.24%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM----------------KTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            ++RF+  + + K+    DVY  MFL + +  +IIIFG+ +FG  + + D A   +  +++P  F+ M++ QF  ++IDRAL+LRK V GK  FQ+  V+ IH W+FF LP +T++ F+     QL YFVKCIYFALSAYQ++ GYP RILGNFLT+ +N++NLFLF+G+ +VPFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S I  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+ +    +  +  ++  + P+D     I+ +S  +W I+PP   ++K++L    A + +    N Q    +  T   + EK    T      +  +  L  L+  + + + V +P +FP+++ A      EAN + Q   ++   YL + + +                K  + + WW V E+   ++ C            L + IF++++S    G + + YGI+G+Y +   VV +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+
Sbjct: 1958 LQRFFHDILHTKYRAATDVYALMFLADIVDIIIIIFGFWAFGKHSAATDIASS-LSDDQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGKLAFQVVLVVAIHIWMFFILPAVTERMFSQNAVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPQAYEELSQQFDPYPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKQELYNGTADITLRFTWNFQRDLAKGGTVEYTNEK---HTLELAPNSTARRQLAQLLEGRPDQS-VVIPHLFPKYIRAPNG--PEANPVKQLQPDEEEDYLGVRIQLRREQVGTGASGEQAGTKASDFLEWW-VIELQDCKADCN----------LLPMVIFSDKVSPPSLGFL-AGYGIVGLYVSIVLVVGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTR 2544          

HSP 2 Score: 114.39 bits (285), Expect = 7.369e-25
Identity = 76/229 (33.19%), Postives = 122/229 (53.28%), Query Frame = 3
Query: 1125 KISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXXXXXXXXXLLAISLG-NVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRV---DPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTE--FAQD-LEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPI 1790
            +    + G  EL A     +   S   ++ +     L+E E   ++    L  +  G      +SE +CYF++ILNHM++ +  SL  P++VFLWAML++PRPSK FW+  I +TE+++V KY+FQF F  +N     R     P + P I+G+EK+ +Y   DL+QL+ +F HR  L   GLW DH E  + +D      K+++ + + ++  E  S T       P+
Sbjct: 1623 QAGTSLHGSQELLANARTRMRTASELLLDRRLHIPELEEAERFEAQQGRTLRLLRAGYQCVAAHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFQFGFFPWNSYVVLRRYENKPYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLLCYGLW-DHEEDRYPKDHCRSSVKDREAKEEPEAKLESQSETGTGHPKEPV 1850          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:MGI Symbol;Acc:MGI:3603204])

HSP 1 Score: 366.696 bits (940), Expect = 7.338e-104
Identity = 225/606 (37.13%), Postives = 359/606 (59.24%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM----------------KTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            ++RF+  + + K+    DVY  MFL + +  +IIIFG+ +FG  + + D A   +  +++P  F+ M++ QF  ++IDRAL+LRK V GK  FQ+  V+ IH W+FF LP +T++ F+     QL YFVKCIYFALSAYQ++ GYP RILGNFLT+ +N++NLFLF+G+ +VPFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S I  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+ +    +  +  ++  + P+D     I+ +S  +W I+PP   ++K++L    A + +    N Q    +  T   + EK    T      +  +  L  L+  + + + V +P +FP+++ A      EAN + Q   ++   YL + + +                K  + + WW V E+   ++ C            L + IF++++S    G + + YGI+G+Y +   VV +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+
Sbjct: 1957 LQRFFHDILHTKYRAATDVYALMFLADIVDIIIIIFGFWAFGKHSAATDIASS-LSDDQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGKLAFQVVLVVAIHIWMFFILPAVTERMFSQNAVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPQAYEELSQQFDPYPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKQELYNGTADITLRFTWNFQRDLAKGGTVEYTNEK---HTLELAPNSTARRQLAQLLEGRPDQS-VVIPHLFPKYIRAPNG--PEANPVKQLQPDEEEDYLGVRIQLRREQVGTGASGEQAGTKASDFLEWW-VIELQDCKADCN----------LLPMVIFSDKVSPPSLGFL-AGYGIVGLYVSIVLVVGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTR 2543          

HSP 2 Score: 114.39 bits (285), Expect = 7.184e-25
Identity = 76/229 (33.19%), Postives = 122/229 (53.28%), Query Frame = 3
Query: 1125 KISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXXXXXXXXXLLAISLG-NVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRV---DPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTE--FAQD-LEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPI 1790
            +    + G  EL A     +   S   ++ +     L+E E   ++    L  +  G      +SE +CYF++ILNHM++ +  SL  P++VFLWAML++PRPSK FW+  I +TE+++V KY+FQF F  +N     R     P + P I+G+EK+ +Y   DL+QL+ +F HR  L   GLW DH E  + +D      K+++ + + ++  E  S T       P+
Sbjct: 1622 QAGTSLHGSQELLANARTRMRTASELLLDRRLHIPELEEAERFEAQQGRTLRLLRAGYQCVAAHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFQFGFFPWNSYVVLRRYENKPYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLLCYGLW-DHEEDRYPKDHCRSSVKDREAKEEPEAKLESQSETGTGHPKEPV 1849          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q9H5I5|PIEZ2_HUMAN (Piezo-type mechanosensitive ion channel component 2 OS=Homo sapiens OX=9606 GN=PIEZO2 PE=1 SV=2)

HSP 1 Score: 429.869 bits (1104), Expect = 7.016e-124
Identity = 226/591 (38.24%), Postives = 371/591 (62.77%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +++F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+  +  QL YFVKC+YF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ + +++F +  +       +  +L+++E +D T   ++  S+++W I+PP  +K+  +L  P +S  +      +R  +    +E I     S  L N  + N+  +I   +T+ + T V +  I+P ++ A   + S+      ++NN +++I++ +  DN       WW +N +   + Y PN  +       L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2171 IKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSE-IATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMDITIILSRDNTTKYNSEWWVLN-LTGNRIYNPNSQA-------LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2749          

HSP 2 Score: 125.946 bits (315), Expect = 1.543e-27
Identity = 76/165 (46.06%), Postives = 102/165 (61.82%), Query Frame = 3
Query: 1275 LLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVD-PLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLW--RDHTEFAQDLEIVDKE-------QDGRNKIKS 1739
            LL  ++ N  +  SE VCYF++ILNHM+S ++ +L  P+++FLWAMLSVPRPS+ FW+  I YTE+ IV+KY FQF F  +N+      D P   P IIG+EK + Y + DLIQLL +F HR  LK +GLW   D TE     E  D E       +D  + +KS
Sbjct: 1909 LLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKNVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDEDDMTESGMAREESDDELSLGHGRRDSSDSLKS 2073          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|M9MSG8|PIEZO_DROME (Piezo-type mechanosensitive ion channel component OS=Drosophila melanogaster OX=7227 GN=Piezo PE=2 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 2.174e-122
Identity = 261/809 (32.26%), Postives = 433/809 (53.52%), Query Frame = 3
Query: 1314 SEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFI--SFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRD-----HTEFAQDLEIVDKEQDGRN---------------KIKSSYEESS-PTSNKWSCNPIYKMRR----------FYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPG-TDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER--PSTDSK---STEKIVRFTQSRFLTNPEKANLLHLI-----------NTKFNSTN------VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAM--MWWEVNEIIQGQSYCPNP--DSPSKKYLF------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            ++ +CY ++ +N +++ +L SLP P+MVFLW  LS+PRP+K FW+ LI YT+ +++IK IFQF  I  ++++  N    PL    I G+E   +YAI DLI LL +FLHR  LK+ GLW+        +F +    +D+  D  N               K+     ++S P S ++S   I ++ R          F+S +   +     DVY  MFLC+F+ F +++FG+ +FG   T+S +    ++  NK+P+PF+ M++ QF+ I+IDRAL+LRK +  K IF  F V+ IH W+FF +P +T++ FNS   P + Y +KC Y  LS+YQ+KSGYP RILGNF T+ F+ +N+  FK YM +PFLYELR ++DW+  DS++  + W+++EDIFS I++++C R  ET +P  R + +  + K  +G  I++    CIWGPL + +          P   S SI +G Y P++  ++  +++  +  + + +M   +     +  ++  ++  D   + +   S ++W I PP  ++L   L     +LK        R  P+   K     E  +   +S       +A L+H++           N   N T       V +P + P+F+       +   S+   ++  Y  + + M  DN    +WWE+ +      YC +   +    K+ +      + ++ FN++   + F  + ++ GI+G+Y  +  +  RF+++F    +  I  E+LP VDR+ +L  +IYLVRE  +  LEE L AKL+FLYRS ET+IKWT+
Sbjct: 1728 TDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQ---PLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKSRL--ATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYT-TNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLR-NNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESF----EGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRD------YCNDTFYNETLSKFAYSNCTSGIVMYTFNDKKFPSTFSFL-TAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTR 2518          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q8CD54|PIEZ2_MOUSE (Piezo-type mechanosensitive ion channel component 2 OS=Mus musculus OX=10090 GN=Piezo2 PE=1 SV=2)

HSP 1 Score: 422.55 bits (1085), Expect = 2.011e-121
Identity = 226/591 (38.24%), Postives = 367/591 (62.10%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLI---NTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMM----WWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +R+F+  + +P ++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T++KF+  +  QL YFVKC+YF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++  VKY +G +I++     +W PL+  S I  +  V   P++ S +I +G Y P+F  S++++ ++ +    + E  +    +  +  +L+++E +D T   ++  S+++W I+PP  +K+ ++L+ P +   +      +R  T     E I     S  L    + ++  +I   +T+ ++T V +  I+P ++ A   + S+      ++NN ++NI++ +  DN       WW +N  + G S   N  S +     L + +FN+++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2241 IRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMTLGAKAE-IATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENN-FMNITIILFRDNVTKSNSEWWVLN--LTG-SRIFNQGSQA-----LELVVFNDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2819          

HSP 2 Score: 107.457 bits (267), Expect = 7.170e-22
Identity = 72/151 (47.68%), Postives = 97/151 (64.24%), Query Frame = 3
Query: 1275 LLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFN---ETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQD 1718
            LL  ++ N  +  SE VCYF++ILNHM S ++ +L  P+++FLWAMLSVPRPS+ FW+  I YTE+ IV+KY FQF F  +N   E   +R  P + P IIG+EK + Y + DLIQLL +F HR  LK +GLW +        +IVD   D
Sbjct: 1979 LLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLEIYKER--PYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWDED-------DIVDSNTD 2120          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q92508|PIEZ1_HUMAN (Piezo-type mechanosensitive ion channel component 1 OS=Homo sapiens OX=9606 GN=PIEZO1 PE=1 SV=4)

HSP 1 Score: 387.497 bits (994), Expect = 8.888e-110
Identity = 225/596 (37.75%), Postives = 357/596 (59.90%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKI----NMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSMKTDNA------MMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            +RRF+  + + K+    DVY  MFL + + F+IIIFG+ +FG  + + D     +  +++P  F+ M++ QF  +++DRAL+LRK V GK  FQ+  VL IH W+FF LP +T++ FN  +  QL YFVKCIYFALSAYQ++ GYP RILGNFLT+ +N++NLFLF+G+ +VPFL ELR VMDW+WTD++++   WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S +  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+         +  ++  + P+D     I+ +S  +W I+PP   ++K +L    A + +    N Q    +  T   + EK +           + A+LL   + +    +V +P +FP+++ A      EAN + Q   N+   YL + + ++ +        + WW V E+ + ++ C            L + IF++++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+
Sbjct: 1942 LRRFFHDILHTKYRAATDVYALMFLADVVDFIIIIFGFWAFGKHSAATDITSS-LSDDQVPEAFLVMLLIQFSTMVVDRALYLRKTVLGKLAFQVALVLAIHLWMFFILPAVTERMFNQNVVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSSWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLVRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQ----SVVIPNLFPKYIRAPNG--PEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWW-VIELQECRTDCN----------LLPMVIFSDKVSPPSLGFL-AGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTR 2518          

HSP 2 Score: 115.161 bits (287), Expect = 3.150e-24
Identity = 62/126 (49.21%), Postives = 85/126 (67.46%), Query Frame = 3
Query: 1311 YSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRV---DPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTE 1679
            +SE +CYF++ILNHM++ +  SL  P++VFLWAMLS+PRPSK FW+  I +TEI +V+KY+FQF F  +N     R     P + P I+G+EK+  Y   DL+QL+ +F HR  L   GLW DH E
Sbjct: 1686 HSELLCYFIIILNHMVTASAGSLVLPVLVFLWAMLSIPRPSKRFWMTAIVFTEIAVVVKYLFQFGFFPWNSHVVLRRYENKPYFPPRILGLEKTDGYIKYDLVQLMALFFHRSQLLCYGLW-DHEE 1810          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q0KL00|PIEZ1_RAT (Piezo-type mechanosensitive ion channel component 1 OS=Rattus norvegicus OX=10116 GN=Piezo1 PE=1 SV=3)

HSP 1 Score: 375.941 bits (964), Expect = 5.571e-106
Identity = 223/603 (36.98%), Postives = 355/603 (58.87%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKI-VRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQ---NQNNTYLNISLSM----------------KTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            +RRF+  + + K+    DVY  MFL + +  ++IIFG+ +FG  + + D A   +  +++P  F+ M++ QF  ++IDRAL+LRK V G   FQ+  V+ IH W+FF LP +T++ F      QL YFVKCIYFALSAYQ++ GYP RILGNFLT+ +N++NLFLF+G+ +VPFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI++F    IW PL+  S I  +  V   PI+ + ++ +G Y PLF  S+++ ++ P T + +EE+ +    +  +  ++  + P+D     I+ +S  +W I+PP   ++K +L    A + +      +R      S E    + T      +  +  L  L+  + + + V +P +FP+++ A      EAN + Q   ++   YL + + +                K  + + WW V E+   Q+ C            L + IF++++S    G + + YGI+G+Y +   VV +F+R F+S+IS+ I  EELP VDRI KL  +I+LVRE ++L LEE+L AKLIFLYRS ETMIKWT+
Sbjct: 1946 LRRFFHDILHTKYRAATDVYALMFLADIVDIVVIIFGFWAFGKHSAATDIASS-LSDDQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGNLAFQVVLVVAIHLWMFFILPAVTERMFRQNAVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPEDYEELSQQFDPYPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKHELYNGTADITLRFTWNFQRDLAKGGSVEYTNEKHTLELAPNSTARRQLAQLLEGRPDQS-VVIPHLFPKYIRAPNG--PEANPVKQLQPDEEEDYLGVRIQLRREQVGTGTSGEQAGTKASDFLEWW-VIELQDCQAECN----------LLPMVIFSDKVSPPSLGFL-AGYGIVGLYVSIVLVVGKFVRGFFSDISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTR 2532          

HSP 2 Score: 113.235 bits (282), Expect = 1.101e-23
Identity = 65/166 (39.16%), Postives = 98/166 (59.04%), Query Frame = 3
Query: 1311 YSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRV---DPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFA---QDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPI 1790
            +SE +CYF++ILNHM++ +  SL  P++VFLWAML++PRPSK FW+  I +TE+++V KY+FQF F  +N     R     P + P I+G+EK+ +Y   DL+QL+ +F HR  L   GLW DH E           +K+Q+   + ++  E    T       P+
Sbjct: 1673 HSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFQFGFFPWNSYIVLRRYENKPYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLLCYGLW-DHEEDGVPKDHCRSSEKDQEAEEESEAKLESQPETGTGHPEEPV 1837          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A504YS87 (Piezo-type mechanosensitive ion channel component OS=Fasciola gigantica OX=46835 GN=FGIG_01349 PE=3 SV=1)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 483/985 (49.04%), Postives = 639/985 (64.87%), Query Frame = 3
Query:  918 DETDKKIEKPAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKI-SNEVDGRIELEAIVVEIVGDGSHSF-------------------------------VNSKNQEEYLKEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFN---ETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKE-----------------------------QDGRNKIKSSYEE-------SSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINT-----------------KFNSTN-VYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTD--NAMMWWEVN------------EIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 3563
            D T   I++    E CWSKFKAS +I Y FI ++ D+LI L+N  T++YRRIRRT+D EKRLVK ++++ I + +   R  LEA + E+V + +                                  + S  Q  Y +E+ FR+SRS  FLL I++GN+AI+YSE+ CYFLLILNHM S  + SLPYPL VFLW MLSVPRP+K FWI LITYTE+VIVIKYIFQF FI FN   E  +   + LW+P + G++K+ +YA+ DLIQL+ +FLHRGYLKNNGLWRDHTEFAQDLE+V +E                             ++  N++ S+ ++        S T   W  NP  K+ RFY KMT+P++NKKVDVY++MFLCEFIAF I+IFGYVSFGP T   DNAF+FIK+N+IP+PFI+M++ QF+FIIIDR LFL+KQV GKFIFQI HVLLIH WL F LPHIT+  FN+ +APQLLY +KC+YF+LSAYQ++SGYP RILGNFLT+++NY+NL LFKGY+I+PFLYELRNVMDWMWT S+++ YHWME+EDI++KIFVLKCWR  E  +PT RG NR    K  +G L+L FFF C WGP+ +SSFIG TF   PP+ C+FSI+ G + P+F F+SRE N+  +++    + K CH+    +  +L +FE  D   I ID  S N+W ITPP    L+EKL+  ++ L ++    C R + + ++ +  V    SR L + EK  LL ++N                   F +T+ V L    PR++   K  L  A +    Q  TY+N+S ++  D      WWE+             E+++G        + +K    L+I  +NER+SD++FG +FS+YGI+G+YAAY F+ +R LRT YSNISY+I  EELP+VDRI  L +EIYLVREN  LRLEEQL+AKL FLYRSSETMIKWT+H K  ++
Sbjct: 2197 DVTQGSIQQ--REEGCWSKFKASCMIGYMFIISSVDSLIRLLNGLTRQYRRIRRTIDQEKRLVKRRLIANIDATQEHSRHHLEAAMFEVVANTAEQLQPLMRNNVESAPCTNRDLPHEHMRSEHYTVPMGSTYQHHYQREKAFRQSRSHAFLLLIAMGNLAIVYSEWFCYFLLILNHMRSSTILSLPYPLTVFLWGMLSVPRPTKTFWIFLITYTEVVIVIKYIFQFRFIYFNDPLEKPSVSAEALWLPRLFGLDKNDHYALFDLIQLISLFLHRGYLKNNGLWRDHTEFAQDLELVVEENRAAQMRRASRHSVERPKRESSSHAVLEGENSNNQVLSTSQQLSTINPRMSATGKSW--NPFAKLHRFYLKMTDPRYNKKVDVYIYMFLCEFIAFWIMIFGYVSFGPSTGMGDNAFEFIKSNRIPLPFISMLLVQFIFIIIDRGLFLQKQVLGKFIFQIIHVLLIHGWLSFILPHITRSPFNASVAPQLLYLIKCVYFSLSAYQIRSGYPHRILGNFLTKNYNYLNLILFKGYLIIPFLYELRNVMDWMWTRSALSLYHWMELEDIYAKIFVLKCWRRSEIAYPTPRGVNRPAGKKALVGGLLLSFFFLCFWGPMALSSFIGATFDFNPPVLCTFSISFGGFPPIFEFTSREGNILRISESVHLDFKRCHEKDKQTFGFLNNFEAKDVRYITIDGFSGNIWAITPPSHSTLREKLADSKSDLLLHFHMRCRRHTKEIQTGQTSVEDIFSRRLGSNEKHQLLRVLNQSTSVEGLEESASSQEEPSFRTTDPVVLDATMPRYVLLRKDRLRAAYA-KLGQKETYVNVSFNIHHDRLQTQSWWELKEREGPEPVDPCFEVLRGSVLGSKQRAAAK---VLSIVTYNERVSDSLFGKVFSNYGIIGMYAAYIFLANRLLRTIYSNISYVIRLEELPHVDRILNLCNEIYLVRENNLLRLEEQLVAKLFFLYRSSETMIKWTRHPKHIID 3173          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A4S2LHK5 (Piezo-type mechanosensitive ion channel component OS=Opisthorchis felineus OX=147828 GN=CRM22_007115 PE=3 SV=1)

HSP 1 Score: 853.203 bits (2203), Expect = 0.000e+0
Identity = 486/997 (48.75%), Postives = 639/997 (64.09%), Query Frame = 3
Query:  837 ESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKPA---HPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVG------DGSHSFVNSKNQE------------EYL--------KEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETT---NDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIV-----------DKEQDGRNKIKSSYEESSP------------TSNKWSC---------NPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTK-----------------FNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNA--MMWWEVNE-IIQGQSYCPN----PDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 3563
            E      P +   T  SS S+    S D+       PA     E CWSKFKA  L+ Y F+ ++ D+LI L+N  TK YR IRR ++ EKR VKL V++   +     +++E  V  +V        G   F++ +  +            E+L        +E+ FR+SRSR FLL I+LGN+AI+YSE+ CY LL++NHM S N+ SL YPL+VFLW MLSVPRP+K FWI LITYTE+VIVIKYIFQF FI+FN+ +    D  + LWIP ++G+EKS +YAI DL+QL+ +FLHRG+LKN+GLWRDHTEF QDL++V           + EQ G + ++    ES+             TS + +          NP  K+RRFY KMT+P+FNKKVDVY++MFLCEFI+F II+FGYVSFGP T   DNAF+FI++N++P PF+ M++ QF+FIIIDR LFLRKQV GKFIFQI HVLLIH WLFF LPHITK  F +  APQLLY +KC+YF+LSAYQ++SGYPLRILGNFLT+ +NYINL LFKGY+IVPFLYELRN+MDWMWT+S+++ YHWME+ED+++KIFV KCWR  E  +PT RG NR    K  +G LIL FFF C+W PL +SSFIG TFV  PP+ C+FS+++G + P+F F+SRE N+  + ++  +    CH+  L +  +L +FE DD   I ID  S N+W ITPP    L +KLS   + L ++    C R + + ++++  V    SR L   EK  L  ++NT                   +S+ V L  + PR+L   +  L  A +    + NTY+N+S  +  D A    WWE+ E  I     C      P         L+I  FNER+SD++FG  F +YGILG+Y AY F+V+R  RT Y+NISY+I  EELP+VDRI  L +EIYLVRENK LRLEEQL+AKL FLYRSSETMIKWT+H K  ++
Sbjct: 2173 EKRAAGKPAMLAFTRSSSKSLDNPDSEDQLGDDSNTPAAQQREEGCWSKFKAFCLVTYLFLLSSVDSLIYLLNGLTKHYRNIRRRIEREKRCVKLNVINNTQHPEQSPLDIEVAVFNVVSKSPEHVSGGVPFLDPQISDRCRAALVPGQSIEHLDALDRHQQREKAFRQSRSRPFLLLIALGNMAIVYSEWFCYLLLVVNHMRSSNILSLVYPLVVFLWGMLSVPRPTKTFWIFLITYTEVVIVIKYIFQFRFITFNDPSLKPADSAEALWIPRLLGVEKSGHYAIFDLVQLISLFLHRGFLKNDGLWRDHTEFVQDLQLVAERNKVAERVQNGEQVGPDFLRLLSTESAASQMVEGHNVDAVTSGRLTVSRRDALHTWNPFAKLRRFYHKMTDPQFNKKVDVYIYMFLCEFISFWIIMFGYVSFGPSTGMGDNAFEFIRSNRVPFPFVCMLLVQFIFIIIDRGLFLRKQVLGKFIFQILHVLLIHGWLFFILPHITKSPFTAGFAPQLLYLIKCVYFSLSAYQIRSGYPLRILGNFLTKKYNYINLILFKGYLIVPFLYELRNIMDWMWTNSTLSLYHWMELEDVYAKIFVHKCWRRSEIAYPTPRGVNRPAGKKALVGGLILAFFFACLWIPLALSSFIGATFVFNPPVLCTFSLSIGGFPPVFEFTSREGNILKIRQQDLDSFTRCHEKDLQTVGFLNNFEVDDLRYITIDGFSGNIWAITPPSYDTLVKKLSDASSDLLLHSHMQCRRKTKEIQTSQISVEDIFSRKLQPLEKIELYDVLNTTAVGSAANNTQVKLSSRVLSSSPVTLNAVMPRYLVLKRDRLRPAYAT-LGRENTYINVSFVIHRDPAKNQSWWELKERAITSSDACFEKLRFPTLGDSWADALSIMTFNERVSDSLFGKWFFTYGILGMYGAYLFLVNRLFRTVYTNISYVIRLEELPHVDRILNLCNEIYLVRENKLLRLEEQLVAKLFFLYRSSETMIKWTRHPKRIID 3168          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A4Z2DRN6 (Piezo-type mechanosensitive ion channel component OS=Schistosoma japonicum OX=6182 GN=EWB00_009369 PE=3 SV=1)

HSP 1 Score: 852.047 bits (2200), Expect = 0.000e+0
Identity = 494/1063 (46.47%), Postives = 654/1063 (61.52%), Query Frame = 3
Query:  771 QDNQLTNDQAQLSLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKPAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSK--ISNEVDGRIELEAIVVEIVG----------DGSHSFVNSKNQ-------------------------EEYLKEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETT---NDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQDG---------------------RNKIKS------------------SYEESS----PTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINT----------KFNST--------------------NVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTD--NAMMWWEVNEIIQGQSYCPNPDSPSKKYLF-----------------LTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 3563
            QD+Q+   +       +  N   S+ + +   + D N + N+ P     D+T ++     H ESCWSKFKAS LI Y F  ++ D+LI  +N  T++YRRIRRT+D EKRLVK +V+S    +NE   R++LEA V+EI+              H   N +N                          +++ +E+ FR+SRS  FLL I++GN+AI+YSE  CYFLLI NHM S +L SLPYPLMV LW MLSVPRP+K FWI LITYTEIVIVIKYIFQF F  FN+ T    +  + LW+P I+GI K+ +YA+ DL+QL+ +FLHRGYLKNNGLWRD+TEF  DLE++ +E                         NK+K+                   Y +SS    PT+   + NP+ K++RFY KMT+P++NKKVDVY++MFLCEFIAF II+FGYVSFGP T   DNAF+F+K+N+IP PFI+M++ QF+FIIIDR LFL+KQV GKFIFQI HV+LIH WLFF LPHIT+  F S +APQLLY +KC+YF+LSAYQ++SGYP RILGNFLT+++NYINL LFKGY+++PFLYELRNVMDWMWT S+++ YHWME+ED++SKIF+LKCWR  E  +PT RG+NR +  K   G L+L+FFF C WGP+ ++SFIG TF   PP+ C+FS + G + P F F+SRE N+  +          CH+    +  +L +FE +D   + ID  S N+W ITPP  + L  KL    + L ++    C R + + +S+   V    SR L+  EK  LL ++N+          K N+T                    +V L  + PR++   K  L  A +   N   TY+N+S  M  D  +   WWE+ E           +SP+    F                 L+I  FNER+SD++FG +F++YGI+G+YAAY F+  R LRT YSNISY+I  EELP+VDRI  L HEIYLVREN  L LEEQL+AKL FLYRSSETMIKWT+H K  +E
Sbjct: 2187 QDDQIITQRK------FVKNIHSSQPFSDNNGFSDVNDNGNASPY----DKT-RRHSVHQHAESCWSKFKASCLIAYMFFLSSVDSLIRFLNGLTRQYRRIRRTIDQEKRLVKRRVISNNPFTNE-QSRVQLEAAVLEIISTTPERQLSLLSPQHIETNPQNNVKRSSEASDYLIHHNSLDNFDNTDLQDHEREKAFRQSRSYGFLLLIAVGNLAIVYSELFCYFLLIFNHMRSSSLLSLPYPLMVLLWGMLSVPRPTKTFWIFLITYTEIVIVIKYIFQFKFFHFNDATLRPIESAEALWLPRILGINKNDDYAVFDLVQLISLFLHRGYLKNNGLWRDYTEFTHDLELIVQENKAVELSHSKQAICSRPLASSCIYLNKLKTDVDKDDGLYSSVHNTFVQQYPQSSHFPVPTTGGKTWNPLVKLKRFYLKMTDPRYNKKVDVYIYMFLCEFIAFWIILFGYVSFGPSTGMGDNAFEFLKSNRIPFPFISMLLVQFIFIIIDRGLFLQKQVLGKFIFQIIHVVLIHGWLFFILPHITRSPFTSGLAPQLLYLIKCVYFSLSAYQIRSGYPRRILGNFLTKNYNYINLVLFKGYLLLPFLYELRNVMDWMWTSSALSLYHWMELEDVYSKIFILKCWRRSELAYPTPRGQNRDISKKALTGGLLLLFFFICFWGPMALTSFIGATFDVNPPVLCTFSFSFGGFPPTFEFTSREGNIFTVNASELNNFIRCHEKDKQTFGFLHNFEWNDLRYVTIDGFSGNIWAITPPSYQALLMKLRSADSDLLLHFHMKCRRSTKEIQSSHTSVEDIFSRKLSPLEKLQLLMVLNSTNSIFPSSDYKRNTTYTTFINNDNMSTMSHQSRIDSVTLNAVLPRYVLLKKDKLRGAYAFLGNP-QTYVNVSFHMHQDLTSRQAWWELKEKTN--------NSPTSDPCFEVIRHPTLSINAIEANVLSILTFNERVSDSLFGKVFNNYGIIGMYAAYIFLASRLLRTMYSNISYVIRLEELPHVDRILNLCHEIYLVRENNLLLLEEQLVAKLFFLYRSSETMIKWTRHPKHIVE 3228          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A564YVM1 (Piezo_RRas_bdg domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9946 PE=4 SV=1)

HSP 1 Score: 847.425 bits (2188), Expect = 0.000e+0
Identity = 501/1133 (44.22%), Postives = 673/1133 (59.40%), Query Frame = 3
Query:  507 QNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSEHDELSSLPDAYNT-----PPPAHISETTTEDSFHSAAIQDNQLTNDQAQLSLDLYSANTPESEKYLNPLI--YRDTNI--------------SSNSVPELISNDETDKKIEK------PAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDG-RIELEAIVVEIVGDGS----------------------------------------HSFVNSKNQEEYL----KEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPL-----WIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNK---------------IKSSYEESSPTSNKW----SCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLIN----------TKF-NSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDN--AMMWWEVNEIIQGQSYC---------PNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWK 3551
             N +NPL L+N+AME G RSA R+++R      ++    R S+V  G  +   SE  E++             PP   +S+  T D                + L++ L   +T E +   N +   Y DT++              ++  +P    +D+T   + +      P   E CWS+FKA  L+++ F+ +T     V +N+ T+E+RRIRRT+D EKR VK K L   +    G R+ LE++V++++  G+                                            +S   E+ L    +E+EFRRSR   FLL I++GN+ +++SE VCYF+LI+NH+ S N+ SL YPLMVFLW MLSVPRP+K FWI+LITYTE+VI+IKYIFQF FI FN  + D+V        W+P I G+EK+ +Y I DLIQLLFIF+HR YLKN GLWRD TEF +DL           K               I S+Y ++S          + NPI KMRRFY KMT+P++N+KVDVYV+MF+CEF+AF IIIFGY SFGP T   DNAF+FIKTN+IP PFI MII Q VFI++DRALFLRKQV GKFIFQIFHV+LIH +LFF LP IT   F    A  +LYFVKCIYF LSAYQ++SGYP  ILGNFLT+++NYINL LFK Y+I+PF+YE+R+VMDWMWTDS ++ YHWME+EDI++K+FV+KCWR  E  +PT  GR R L VKY +G+LIL+F F C WGPL++ SFI  TF    P+ECS ++ VG +  L+ F+SRENN+  +      E+++C+  +  +  ++ +F+ +D + +  D  S+ +W ITPP  ++L  +L+   + + I     C R +    S+   V    SR LT+ E+     ++N          T F N+  V L   FPRFL A K  L  A S +  Q  TY+N+S S++TD      WW + E+    + C          +    S   LF +I IFNER+SDN+ G IFSSYGI+G+YAAY F   R LR  YS+ISY I  +ELP+VDR+  L H+IYLVREN KL LEE L AKLIFLYRSSETMIKWT+H K
Sbjct:  354 HNHMNPLQLLNQAMEHGMRSAARQYRRRNMVTHQS----RMSTVTDG--MTGQSEESEMAGASSVKQNVVSLRPPRPPLSKQPTLDGTQGGTGTAEAAIGTASNLNV-LNGGSTYEVDPLANKVDDNYYDTDVFDQPDMSPVPLRNGNTGQMPGRAGSDDTLSHLSREVMEGAPGKSEGCWSRFKAGCLVLHIFLLSTIQTTTVWLNSITREHRRIRRTIDIEKRKVKQKALYIFNRSSTGTRVTLESVVLDVISGGASPCQLVPESNAYGGGASGRRRDRQTPAWIEGVPELDDEFQEEMRDSLRSEQALTWEQREREFRRSRPSLFLLLIAVGNLIVVHSELVCYFVLIINHLRSANVISLVYPLMVFLWGMLSVPRPTKTFWISLITYTELVIIIKYIFQFRFIEFN--SPDQVSATLARTHWLPAIFGVEKTDSYGIWDLIQLLFIFMHRSYLKNYGLWRDDTEFKEDLIKAGAANKVNTKRNANQNQNQNNNEDLIVSTYSKASNNQGSSSSSSTLNPITKMRRFYVKMTDPRYNQKVDVYVYMFICEFLAFWIIIFGYQSFGPSTGMGDNAFEFIKTNRIPAPFIGMIIIQSVFIVLDRALFLRKQVLGKFIFQIFHVILIHVYLFFILPQITMTPFTVGSARAVLYFVKCIYFGLSAYQIRSGYPRHILGNFLTKNYNYINLVLFKAYLIMPFVYEVRSVMDWMWTDSPLSLYHWMELEDIYAKVFVMKCWRRSEIEYPTPLGRKRALWVKYLVGMLILLFAFVCFWGPLVVFSFIDTTFAINVPVECSQTLAVGGFPALYFFTSRENNLLHVNGSFLSEIRQCNALNQGTTGFVDNFKTEDVSNMTFDTVSERLWTITPPMYRRLMNELADDSSQMSITFHVTCRRTARPVDSSATRVEQFFSRPLTHKERLEFRAVLNESLALSSPNSTGFTNTKTVRLDLAFPRFLFAQKSNLRNA-SGNLAQPYTYINVSASLETDQYTNQRWWVLEEVGLAGAPCYGSVNNLSEADMHYRSHNRLF-SIIIFNERVSDNLLGKIFSSYGIIGMYAAYIFFASRILRMIYSDISYQISLQELPHVDRLLNLCHDIYLVRENGKLNLEELLFAKLIFLYRSSETMIKWTRHPK 1475          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A3Q0KMS3 (Piezo-type mechanosensitive ion channel component OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 833.943 bits (2153), Expect = 0.000e+0
Identity = 487/1071 (45.47%), Postives = 646/1071 (60.32%), Query Frame = 3
Query:  759 SAAIQDNQLTNDQAQLSLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKPAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKI-SNEVDGRIELEAIVVEIVG---------------------------DGSHSFVNSKNQ-------------EEYLKEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETT---NDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQ---------------------------------------DGRNKIKSSYEESS--PTSNKWSC-----NPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLIN-TKF-------NSTNVY---------------------------LPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTD--NAMMWWEVNEIIQGQSY---C------PNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLE 3563
            S AI D Q   D     + ++      S     P  + D N SS+     I++++  +K     H E CWSKFKAS LI Y F  ++ D+LI  +N  T++YRRIRRT+D EKRLVK +V+S + S     R  LE+  +EI+                            D  + ++   N              +++ +E+ FR+SRS  FLL I++GN+AI+YSE  CYFLLI NHM S +L SLPYPLMV LW MLSVPRP+K FWI LITYTEIVIVIKYIFQF F  FN+      +  +PLW+P IIGI K+ +YA+ DL+QL+ +FLHRGYLKNNGLWRD TEF  DLE++ +E                                         G N     Y ++S  P++          NP+ K++RFY KMT+P++NKKVDVY++MFLCEFIAF I+IFGYVSFGP T   DNAF+F+K+N++P+PFI+M++ QF+FII DR LFL+KQV GKFIFQI HV+LIH WLFF LPHIT+  F S +APQLLY +KC+YF+LSAYQ++SGYP RILGNFLT+++NYINL LFKGY++VPFLYELRNVMDWMWT S+++ YHWME+ED++SKIF+LKCWR  E  +PT RG+NR    K   G L+L+FFF C WGP+ ++SFIG TF   PP+ C+FS + G + P F F+SRE N+  +          CH+    +  +L +FE +D   + ID  S N+W ITPP  + L  KL  P + L ++    C R + + +S+   V    SR L+  EK  LL ++N T F       N  ++Y                           L ++ PR++   K  L  A +   +   TY+N+S  +  D  +   WWE+ E I        C      P   + + +   L++  FNER+SD++FG +F++YGI+G+YAAY F+  R LRT YSNISY+I  EELP+VDRI  L HEIYLVREN  L LEEQL+AKL FLYRSSETMIKWT+H K  +E
Sbjct: 2155 SYAIMDKQSAEDN---QITVFEKPIKTSHSSSRP--FDDNNGSSD-----INDNDKLRKDSVHQHAEGCWSKFKASCLIAYMFFLSSVDSLIRFLNGLTRQYRRIRRTIDQEKRLVKRRVISYLPSTNEQLRAHLESAALEIISTTPERQLSLFNPQLIERNIQNNEKRSNDTMNPYLIRDNSLDDLDNNTPVTDLQDHEREKAFRQSRSYGFLLLIAVGNLAIVYSELFCYFLLIFNHMHSASLLSLPYPLMVLLWGMLSVPRPTKTFWIFLITYTEIVIVIKYIFQFKFFHFNDAILRPTESAEPLWLPRIIGINKNDDYAVFDLVQLISLFLHRGYLKNNGLWRDDTEFTHDLELIVQENKAAQLSCSKQGTSSRQLASSGVCLNKSKTDLGKDDGLFTGGCNMFVQLYPQTSHYPSTASGGGGGKTWNPLVKLKRFYLKMTDPRYNKKVDVYIYMFLCEFIAFWIMIFGYVSFGPSTGMGDNAFEFLKSNRVPLPFISMLLVQFIFIITDRGLFLQKQVLGKFIFQIIHVVLIHGWLFFILPHITRSPFTSGLAPQLLYLIKCVYFSLSAYQIRSGYPRRILGNFLTKNYNYINLVLFKGYLLVPFLYELRNVMDWMWTSSALSLYHWMELEDVYSKIFILKCWRRSELAYPTPRGQNRDTSKKALTGGLLLLFFFICFWGPMALTSFIGATFDVNPPVLCTFSFSFGGFPPTFEFTSREGNIFTVNSSELNNFIRCHEKDKQTFGFLHNFEWNDLRYVTIDGFSGNIWAITPPSYQALLMKLRSPESDLLLHFHMKCRRSTKEIQSSHTSVEDIFSRKLSPSEKLQLLMVLNSTNFTFPISDSNRNSLYRTSIMNNNNNSNSMLTRSYQSQIDSVTLNSVLPRYVLLKKDKLRGAYAFLGDP-QTYVNVSFHIHQDLISHQTWWELKEKINSSPSSDPCFEVIRHPTLSNNAVEANVLSVLTFNERVSDSLFGKVFNNYGIIGMYAAYIFLASRLLRTAYSNISYVIRLEELPHVDRILNLCHEIYLVRENNLLLLEEQLVAKLFFLYRSSETMIKWTRHPKHIVE 3214          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2-like [Source:NCBI gene;Acc:103047759])

HSP 1 Score: 432.18 bits (1110), Expect = 1.557e-125
Identity = 227/593 (38.28%), Postives = 366/593 (61.72%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSL---HQNQNNTYLNISLSMK-TDNA----MMWWEVNEIIQGQ-SYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            +R+F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P  F+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T+++F+  +  QL YFVKCIYF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +G + P+F  S+++N ++ +T+  F +    + +   +  +L+++  +D T+  ++  S+++W I+PP  K L E LS       + M    +R  +     E +       +L    +  L++L+N   N   V +  +FP F+    R  S++N+    H   +N Y +I+L +K +DN+      WW V++   G         +  K+   L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+ 
Sbjct: 2240 IRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNMVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKDVTEAEFLKFMNSYNYIPGAMQFLEAYTAEDVTEAELEGNSNSLWTISPPSRKSLMEVLS-KEDQFPVTMSWTIQRNLSLGAKAE-VAMDKHVTYLDTNTRQELINLLNGTRNKA-VIIKEVFPCFI----RAPSDSNAKPIDHLYGDNGYKDITLDLKRSDNSSGEIQEWWIVDQPSAGMIDMKSGVKTEQKREAGLRLYVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTRE 2823          

HSP 2 Score: 117.087 bits (292), Expect = 8.504e-26
Identity = 74/151 (49.01%), Postives = 99/151 (65.56%), Query Frame = 3
Query: 1224 EEYLKEQEXXXXXXXXXL-LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTN-DRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRD 1670
            +E L+E E   S     L L  +L N+ + +SE VCY ++ILNHM+S ++ +L  P+++FLWAMLSVPRPSK FW+  I YTE+ IVIKY FQF F  FN+    D+  P   P IIG+EK + Y   DL+QLL +F HR  LK +GLW +
Sbjct: 1958 DEELEESERFYSSQPQILQLCYALYNMLVAHSEMVCYLVIILNHMISASVATLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFNQNIELDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCHGLWDE 2108          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2-like [Source:NCBI gene;Acc:103047759])

HSP 1 Score: 429.098 bits (1102), Expect = 1.672e-124
Identity = 229/594 (38.55%), Postives = 367/594 (61.78%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLP--SKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSL---HQNQNNTYLNISLSMK-TDNA----MMWWEVNEIIQGQ-SYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            +R+F+  + +P+++   DVYV MFL + + F+II+FG+ +FG  + +AD     +  +++P  F+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T+++F+  +  QL YFVKCIYF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +G + P+F  S+++N ++ +T+  F  +  C+    P  +  +L+++  +D T+  ++  S+++W I+PP  K L E LS       + M    +R  +     E +       +L    +  L++L+N   N   V +  +FP F+    R  S++N+    H   +N Y +I+L +K +DN+      WW V++   G         +  K+   L +++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+
Sbjct: 2093 IRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNMVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKDVTEAEFLNLM-CNICFFPQGAMQFLEAYTAEDVTEAELEGNSNSLWTISPPSRKSLMEVLS-KEDQFPVTMSWTIQRNLSLGAKAE-VAMDKHVTYLDTNTRQELINLLNGTRNKA-VIIKEVFPCFI----RAPSDSNAKPIDHLYGDNGYKDITLDLKRSDNSSGEIQEWWIVDQPSAGMIDMKSGVKTEQKREAGLRLYVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTR 2676          

HSP 2 Score: 116.701 bits (291), Expect = 1.082e-25
Identity = 74/151 (49.01%), Postives = 99/151 (65.56%), Query Frame = 3
Query: 1224 EEYLKEQEXXXXXXXXXL-LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTN-DRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRD 1670
            +E L+E E   S     L L  +L N+ + +SE VCY ++ILNHM+S ++ +L  P+++FLWAMLSVPRPSK FW+  I YTE+ IVIKY FQF F  FN+    D+  P   P IIG+EK + Y   DL+QLL +F HR  LK +GLW +
Sbjct: 1805 DEELEESERFYSSQPQILQLCYALYNMLVAHSEMVCYLVIILNHMISASVATLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFNQNIELDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCHGLWDE 1955          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 426.402 bits (1095), Expect = 1.310e-123
Identity = 231/596 (38.76%), Postives = 367/596 (61.58%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER-----PSTDSKSTEKIVRFTQSRFLTNPEKANLLHLIN-TKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNE----IIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWK 3551
            +R+F+  + +P ++   DVYV MFL + + F+II+FG+ +FG     AD     +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP +T+++F+     QL YFVKCIYF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ ++PFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S S+ +G + P+F  S+++ N+  +T   F+   +    +  +  +L+++   D T   ++ +S+++W I+PP  K L   L+   +   + M    +R       ++  + +KI+   +    T  + A LL   N T  +   V + +IFPR+L    R  S++N+    Q +T +++ L+   D+   WW VN+    +++ +S   N DSP      L ++IF++++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE L AKLIFLYRS ETMIKWT+  K
Sbjct: 2109 IRQFFYNLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHQGGADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVVLVFGIHFWMFFILPGVTERRFSQNRIAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLIPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNTPLDVSVSLTLGGFQPIFTMSAQQKNLNSITSAKFDNFVKHFSKNSFAVQFLEAYVYQDLTVAHLEGSSNSMWTISPPSKKNLIGMLNQADSDFPLTMTWSIQRNLSLGAKSEMATGKKIINLDKE---TKIQLAKLLIETNSTDAHKKPVCIKSIFPRYL----RAPSDSNAKLIEQLSTDIDLFLNRAEDSNKEWWVVNQTKFGLLKLESVKIN-DSPR-----LELYIFSDQVSPPSLGFL-AGYGIMGLYMSVVLVIGKFVREFFSGISHTIMFEELPNVDRILKLCTDIFLVRETGELDLEEDLYAKLIFLYRSPETMIKWTREKK 2689          

HSP 2 Score: 116.316 bits (290), Expect = 1.768e-25
Identity = 69/131 (52.67%), Postives = 90/131 (68.70%), Query Frame = 3
Query: 1278 LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRD 1670
            L  +L N+ + +SE V Y ++ILNHM+S ++ +L  P+++FLWAMLSVPRPSK FW+  I YTE+ IVIKY FQF+F  FN+   DR  P   P IIG+EK   Y   DLIQLL +F HR  LK +GLW +
Sbjct: 1837 LCYALYNLLVAHSEMVSYLVIILNHMISASMVTLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFSFFPFNQNMIDRNKPYHPPNIIGVEKKDGYVHYDLIQLLTLFFHRSILKCHGLWDE 1967          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:ZFIN;Acc:ZDB-GENE-041111-255])

HSP 1 Score: 382.874 bits (982), Expect = 2.900e-109
Identity = 220/589 (37.35%), Postives = 354/589 (60.10%), Query Frame = 3
Query: 1803 RFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIV-RFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSE-ANSLHQNQNNTYLNISLSMKTD------NAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            RF+  + + ++    DVY  MFL + + F+II+FG+ +FG  + +AD A   +  +++P  F+ M++ QF  ++IDRAL+LRK V GK IFQI  V  IH W+FF LP +T++ FN     QL YFVKCIYF LSAYQ++ GYP RILGNFLT+ +N++NLFLF+G+ +VPFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI+ F    IW PL+  S +  +  V   P++ + ++ +G Y PLF  S ++ +++P T+  +  + E    +  +  ++  +  +D     I+ +S +VW I+PP  +++ ++L    A + + +    +R      + E    + + +    NP +A+L  L+     +  V +P +FP ++ A     ++  + L++     Y N++LS+  D       A  WW+++          + D  S     L + IFN+++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE+L +KLIFLYRS ETMIKWT+
Sbjct: 1900 RFFHNILHAEYRAATDVYALMFLTDVVDFIIIVFGFWAFGKHSAAADIA-STLSEDQVPEAFLVMLLIQFSTMVIDRALYLRKAVLGKLIFQIILVFGIHLWMFFILPAVTERMFNQNFVAQLWYFVKCIYFTLSAYQVRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIVFFLICIIWFPLLFISLVRSVVGVVNHPVDVTVTVKLGGYEPLFTMSVQQQSIQPFTEADYNHLTELFGSNAVAMQFITLYSYEDIVTANIEGSSGSVWRISPPSRQEVIKELLGSPADMTLRLAWNFQRDLNKGGTVENTFDKHSINLEPGNPVRADLASLLVGN-RTEPVRVPHMFPNYIRAPNGAEAKPVSQLYEGDEEGYQNVTLSLMRDGSLNGSGAQEWWDIS--------VADCDQSSGACGVLPMIIFNDKVSPPSLGFL-AGYGIMGLYVSVVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEELYSKLIFLYRSPETMIKWTR 2477          

HSP 2 Score: 121.709 bits (304), Expect = 3.469e-27
Identity = 63/135 (46.67%), Postives = 94/135 (69.63%), Query Frame = 3
Query: 1278 LAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVD---PLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDH 1673
            L  +L NV   +SE  CYF+++LN+ ++ ++ SL  P+++FLWAML+VPRPSK+FW+  I YTE+++V+KY+FQF F  +N     R++   P + P I+G+EK+ NY   DL+QLL +F HR  L+  GLW DH
Sbjct: 1609 LLFALYNVLACHSELACYFIIVLNNAVTASVISLVLPILIFLWAMLAVPRPSKSFWMTAIVYTEVMVVVKYLFQFGFFPWNSEYETRLNENKPFFPPRILGLEKTDNYIRYDLLQLLALFFHRSLLQRYGLW-DH 1742          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:ZFIN;Acc:ZDB-GENE-041111-255])

HSP 1 Score: 68.9366 bits (167), Expect = 1.557e-11
Identity = 67/283 (23.67%), Postives = 130/283 (45.94%), Query Frame = 3
Query: 2493 YSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKK-LKEKLSIPRASLKINMQAVCERPSTDSKSTEKIV-RFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTD------NAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILG 3314
            Y +G LI+ F    IW PL+  S +  +  V   P++ + ++ +G Y PLF  S ++ +++P T+  +  + E    +  +  ++  +  +D     I+ +S +VW I+PP  ++ +KE L  P A + + +    +R      + E    + + +    NP +A+L  L+    N T+  +P +FP ++ A     +EA  + Q     Y N++LS+  D       A  WW+++          + D  S     L + IFN++    +    FS + + G
Sbjct:   44 YGMGGLIVFFLICIIWFPLLFISLVRSVVGVVNHPVDVTVTVKLGGYEPLFTMSVQQQSIQPFTEADYNHLTELFGSNAVAMQFITLYSYEDIVTANIEGSSGSVWRISPPSRQEVIKELLGSP-ADMTLRLAWNFQRDLNKGGTVENTFDKHSINLEPGNPVRADLASLL--VGNRTD-RVPHMFPNYIRAPNG--AEAKPVSQLYEEGYQNVTLSLMRDGSLNGSGAQEWWDIS--------VADCDQSSGACGVLPMIIFNDKDHGAVRIRDFSLHHVRG 312          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009619.1 (pep scaffold:Pmarinus_7.0:GL484020:1370:4517:1 gene:ENSPMAG00000008693.1 transcript:ENSPMAT00000009619.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.479 bits (306), Expect = 6.390e-32
Identity = 61/129 (47.29%), Postives = 85/129 (65.89%), Query Frame = 3
Query: 3159 WWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            WW + ++          D P ++   + I +F++R+S    G + + YGILG+YA+   VV +F+R F+S IS+ I  EELPNVDR+ KL  +I+LVRE  +L+LEE L AKLIFLYRS ETMIKWT+ 
Sbjct:   75 WWSLRQL--------RSDCPGRRCDDIRIIVFSDRVSPPSLGFL-AGYGILGLYASVVLVVGKFVREFFSGISHSIMFEELPNVDRVLKLCTDIFLVRETGELQLEEDLYAKLIFLYRSPETMIKWTRE 194          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO30292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T173])

HSP 1 Score: 208.764 bits (530), Expect = 2.529e-57
Identity = 111/319 (34.80%), Postives = 182/319 (57.05%), Query Frame = 3
Query: 1959 IKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHK-----------------FHLPSKDYLQSFEPD--DATQII---IDYASDNVWLITPPGLKKLKEKL 2849
            ++ N +P  F+ M+++QF  IIIDR L+LRK V  K  F +F  +  H ++F  +P++TK+ F   I    +Y   C+YF LSAYQ++SGYP RILGNFLT+ +   +  LF+G+  +PFL ELR+V+DW+ TD+++  YHW+++EDI++ I+VLKC+R  E  W   RG+   ++ K+++G L++      IW PL+  S+I   +   PP + +F++++G Y PLF  S++E  +  L     + +K  H                  F+   K  + +F  D  D   ++   I   S ++W I+PP  + +   L
Sbjct:  161 VEENVVPKTFLYMLLSQFFLIIIDRCLYLRKYVFAKLFFLLFLTVSFHVFMFIVVPYVTKRPFFKNIPAIFMYIFMCMYFGLSAYQVRSGYPTRILGNFLTKSYTLTSGVLFQGFQAIPFLLELRSVLDWVCTDTTLTLYHWLKMEDIYANIYVLKCYRESEKTWFQGRGQKYWMLSKWTVGGLLVALLVIVIWFPLLFMSYINSVYTSNPPQDATFTLSIGGYQPLFRVSAQEQFLERLNNTKIDRIKTQHPGLHQGADTQPPLQVAIIFNCVLKIQIDTFLADYHDRGTVVLVKITGNSSSIWQISPPSRQLMMHDL 479          

HSP 2 Score: 92.8189 bits (229), Expect = 2.884e-19
Identity = 41/80 (51.25%), Postives = 64/80 (80.00%), Query Frame = 3
Query: 3306 ILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQH 3545
            I+G+Y  + ++V +F+R F+++ISY I  +E+PNVD++ KL  +I++VRE+K  +LEE L AKL+FLYRS ET+IKWT++
Sbjct:  496 IIGLYVGFVWLVGKFVRLFFTSISYRIMFDEMPNVDKVLKLCLDIFMVRESKSFKLEEDLFAKLMFLYRSPETLIKWTKY 575          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO47370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM3])

HSP 1 Score: 160.614 bits (405), Expect = 1.334e-40
Identity = 125/404 (30.94%), Postives = 202/404 (50.00%), Query Frame = 3
Query:  954 PESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNE---KRLVKLKVLSKISNEVDGRIELEAIVVEIVGD-------GSHSFVNSKNQEEY----LKEQEXXXXXXXXXLLAISLGNVAIIYS-----EFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTN----DRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKE-------------QDGRNKIKSS-----YEESSPTSNKWSCNPIYK-MRRFYSKMTNPKFNK-KVDVYVFMFLCEFIAFLIIIFGYVSF-GPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDR 2033
            PE   ++ K     +YY+     D +I +++  +K+YR I   L +E   KRL KL+      + +  R    +     V D       GS +  + ++ + +    +   +   S  +   + ++  +VA +Y+     + +CY L+ILNHM+   L S+P P +VF+W MLS+PRP+K +WI +ITYT+IVIVIKY+F+F F   N   +    D+ DPL    IIGIE+  + +  DL+ LL ++ HR  LK +GLWRD        E+ +                  RN   SS     Y+     S +   N I + ++ F +++ +P+     VDVY  MF C+FI F+II+F + +F  P           ++ N +P  F+ M+++QF  IIIDR
Sbjct:  105 PEGLVTRLKKLFSWIYYYFAIAIDKVIDVLSDISKDYREIADQLKHERKEKRLEKLRRGRYSYSSLRARTLAASASAAEVSDSDVIENKGSATSRSDEDADSWSVLNIDLDDTDASNWKHSHMRVARFSVAFVYALLAHTDIICYLLMILNHMVYACLLSMPLPFLVFMWGMLSIPRPTKRYWITVITYTQIVIVIKYLFKFQFKFINNCNSSDGPDKNDPLCPARIIGIERDSHTSAYDLLLLLALYFHRYSLKVHGLWRDKAAHDDHDELYEPPLSPNSPKSEPTPFAGSRNMAASSPDSEQYQSDVEDSGESLWNKICRSVKAFLNRIYDPEVGSGAVDVYAIMFACQFIIFIIILFSWSAFSSPEPQRQAQFVKIVEENVVPKTFLYMLLSQFFLIIIDR 508          

HSP 2 Score: 112.079 bits (279), Expect = 3.624e-25
Identity = 50/144 (34.72%), Postives = 88/144 (61.11%), Query Frame = 3
Query: 2283 LFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECH 2714
            L +   +  +PFL ELR+V+DW+ TD+++  YHW+++EDI++ I+VLKC+R  E  W   RG+   ++ K+++G L++      IW PL+  S+I   +   PP + +F++++G Y PLF  S++E  +  L     + +K  H
Sbjct:  503 LIIIDRFQAIPFLLELRSVLDWVCTDTTLTLYHWLKMEDIYANIYVLKCYRESEKTWFQGRGQKYWMLSKWTVGGLLVALLVIVIWFPLLFMSYINSVYTSNPPQDATFTLSIGGYQPLFRVSAQEQFLERLNNTKIDRIKTQH 646          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO47369 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM2])

HSP 1 Score: 93.5893 bits (231), Expect = 5.260e-23
Identity = 41/83 (49.40%), Postives = 66/83 (79.52%), Query Frame = 3
Query: 3306 ILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKS 3554
            I+G+Y  + ++V +F+R F+++ISY I  +E+PNVD++ KL  +I++VRE+K  +LEE L AKL+FLYRS ET+IKWT++ ++
Sbjct:    1 IIGLYVGFVWLVGKFVRLFFTSISYRIMFDEMPNVDKVLKLCLDIFMVRESKSFKLEEDLFAKLMFLYRSPETLIKWTKYKRA 83          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: piezo1 (piezo type mechanosensitive ion channel component 1 [Source:NCBI gene;Acc:101175341])

HSP 1 Score: 457.603 bits (1176), Expect = 2.592e-134
Identity = 288/790 (36.46%), Postives = 457/790 (57.85%), Query Frame = 3
Query: 1311 YSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFN---ETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGL-------------------WRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKM------------RRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANS-----LHQNQNNTYLNISLSMKTD------NAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            +SE +CY +++LN+++S ++ S+  P++VFLWAML++PRPSK FW+  I YTE+++V+KYIFQF F S+N   E T ++  P + P I+G+EK+ NY   DL+QLL +F HR  L    L                    +      +++ +  KE++   ++++  E+    ++    +   K+            + F+  + + K     DVY  MFL + + F+IIIFG+ +FG  + +AD A   +  +++P  F+ M++  F  +IIDRAL+LRK V GK IFQ   VL IH W+FF LP +T++KFN     QL YFVKCIYF LSAYQ++ GYP RILGNFLT++F ++NLFLF+G+ +VPFL ELR VMDW+WTD++++  +WM VEDI++ IF++KC R  E  +P  +G+ ++ +VKY +G LI+ F    IW PL+  S +  +  V   PI+ + ++ +G Y PLF  S ++ +++P     +EE+ +  K +  +  ++  +  +D     I+ +S +VW I+PP  +++ ++L   +  L + +    +R      + E     T  ++  + E  NL+          N   P + P F   Y R  + A +     L++   + YL I+LS+K+D          WW++   ++G   C  P         L + IFN+++S    G + + YGI+G+Y +   V+ +F+R F+S IS+ I  EELP VDRI KL  +I+LVRE  +L LEE+L +KLIFLYRS ETMIKWT+
Sbjct: 1494 HSELLCYLIIVLNNVVSASVISVVLPILVFLWAMLALPRPSKRFWMTAIVYTEVMVVLKYIFQFGFFSWNSAHEMTVNKDRPFFPPRILGLEKTDNYLRYDLLQLLALFFHRALLMVCTLNLKSFRPDQEALLAKAAALRKKEALVPEEIHLRAKEEEEEMRLRAKKEQLELETDLTVASARLKVYESLKDVQSSPAQNFFKNLMHNKHQASTDVYALMFLTDMVDFVIIIFGFWAFGKHSAAADIA-STLSEDQVPEAFLVMLLIHFSTMIIDRALYLRKAVLGKLIFQGILVLGIHVWMFFILPSVTERKFNQNFVAQLWYFVKCIYFGLSAYQIRCGYPTRILGNFLTKNFGHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIVFFLICIIWFPLLFISLVRSVVGVVNHPIDVTVTVKLGGYEPLFTMSVQQQSIQPFNNSQYEELTKMFKDN-TAMQFITLYSYEDIVTAQIEGSSGSVWRISPPSRQEVIKELLGSQVDLTLRLAWNFQRDLGKGGTVEH----TFDKYSIDLEPGNLVRAELASLLIGNRTEPVLVPNFFPNYIRAPNGAEAKPVSQLYKGGEDGYLGITLSLKSDRSSNSSGTREWWDIA--VEG---CVPPSCG-----VLRMVIFNDKVSPPSLGFL-AGYGIMGLYVSVVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEELYSKLIFLYRSPETMIKWTR 2266          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:101174622])

HSP 1 Score: 404.445 bits (1038), Expect = 1.992e-116
Identity = 225/595 (37.82%), Postives = 348/595 (58.49%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKL------KEKLSIPRA-SLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMK-----TDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            M++F+  + +P+++   DVYV MFL + + F+II+FG+ +FG    S  +    +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP IT+K+FN     Q+ YFVKCIYF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD+S++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +  + P+F  S+++  +  +TK   +              +L+++ P+D     +  +S+++W I+PP    L      +E+ SI  + S++ N+    E  S   K+            L    K NL+ L+N   ++ N  +      FLT                 N  ++I L+M+     +  A  WW VN+  Q       P    K    L I++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE + +KLIFLYRS ETMIKWT+
Sbjct: 2053 MKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFG--KHSTADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVLLVFGIHFWMFFILPIITEKRFNENTVAQMWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTSLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVVLLICIVWFPLLFMSLVKSVAGVVNAPLDVSVTITLAGFQPIFTMSAQQKQLWNVTKTAIQ--------------WLENYTPEDLIIAELKGSSNSLWTISPPSRDNLIDMLRSQEEFSITVSWSIQRNLSLGAEAESAYGKNV---------MVLNQETKQNLILLLNGAADAANTQVI-----FLTG----------------NKMIDIHLTMQRAQNDSGQAQEWWIVNQTEQSII----PKIGRKHEAGLEIYVFSDQVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHKIMFEELPNVDRILKLCTDIFLVRETGELDLEEDMYSKLIFLYRSPETMIKWTR 2596          

HSP 2 Score: 116.316 bits (290), Expect = 1.656e-25
Identity = 72/168 (42.86%), Postives = 101/168 (60.12%), Query Frame = 3
Query: 1287 SLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRV---DPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLW-----RDHTEFAQD---------LEIVDKEQDGRNKIKS 1739
            +L N+ + +SEFVCY ++I+NHM+S +  SL  P+ +FLWAMLSVPRPSK +W+  I YTE+ IVIKY  QF F  F  + N R+    P +   IIG+EK   Y + DL+QLL +F HR  LK +GLW     ++  E A+            + +KE+   N +KS
Sbjct: 1793 ALYNMLVAHSEFVCYLVIIINHMVSASCVSLVLPVTIFLWAMLSVPRPSKRYWMTAIVYTEVTIVIKYFCQFGF--FPHSKNYRLYKNAPYYPANIIGVEKKDGYVLYDLVQLLALFFHRSILKCHGLWDEDDPKERKEAARQSESEYEEKEKSVREKERSSTNTMKS 1958          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:101174622])

HSP 1 Score: 399.823 bits (1026), Expect = 7.570e-115
Identity = 227/604 (37.58%), Postives = 355/604 (58.77%), Query Frame = 3
Query: 1797 MRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCER-PSTDSKST--EKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVY-------------LPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMK-----TDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQ 3542
            M++F+  + +P+++   DVYV MFL + + F+II+FG+ +FG    S  +    +  +++P PF+ M++ QF  +++DRAL+LRK V GK IFQ+  V  IH W+FF LP IT+K+FN     Q+ YFVKCIYF LSAYQ++ GYP R+LGNFLT+ +NY+NLFLF+G+ +VPFL ELR VMDW+WTD+S++   W+ VEDI++ IF+LKCWR  E  +P  RG+ ++ VVKY +G +I++     +W PL+  S +  +  V   P++ S +I +  + P+F  S+++  +  +TK   +              +L+++ P+D     +  +S+++W I+PP    L + L   +    I +    +R P+ DS     + I+  T    L   +   ++ L   +F     Y             L  + PR++ A  +  S+A S+ Q   N  ++I L+M+     +  A  WW VN+  Q       P    K    L I++F++++S    G + + YGI+G+YA+   V+ +F+R F+S IS+ I  EELPNVDRI KL  +I+LVRE  +L LEE + +KLIFLYRS ETMIKWT+
Sbjct: 2167 MKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGK--HSTADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVLLVFGIHFWMFFILPIITEKRFNENTVAQMWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTSLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVVLLICIVWFPLLFMSLVKSVAGVVNAPLDVSVTITLAGFQPIFTMSAQQKQLWNVTKTAIQ--------------WLENYTPEDLIIAELKGSSNSLWTISPPSRDNLIDMLR-SQEEFSITVSWSIQRYPNIDSPLMMFDHIIPHTLQLCLKKKKLFYVILLNIFQFLFVIFYFIFFKQNLFRKKTLTKLIPRYIRAPSK--SDATSVEQ-LGNKMIDIHLTMQRAQNDSGQAQEWWIVNQTEQS----IIPKIGRKHEAGLEIYVFSDQVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHKIMFEELPNVDRILKLCTDIFLVRETGELDLEEDMYSKLIFLYRSPETMIKWTR 2745          

HSP 2 Score: 118.627 bits (296), Expect = 2.779e-26
Identity = 74/166 (44.58%), Postives = 102/166 (61.45%), Query Frame = 3
Query: 1287 SLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRV---DPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLW-RDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNK 1772
            +L N+ + +SEFVCY ++I+NHM+S +  SL  P+ +FLWAMLSVPRPSK +W+  I YTE+ IVIKY  QF F  F  + N R+    P +   IIG+EK   Y + DL+QLL +F HR  LK +GLW  D  +  ++  + +KE           E SSP S+K
Sbjct: 1904 ALYNMLVAHSEFVCYLVIIINHMVSASCVSLVLPVTIFLWAMLSVPRPSKRYWMTAIVYTEVTIVIKYFCQFGF--FPHSKNYRLYKNAPYYPANIIGVEKKDGYVLYDLVQLLALFFHRSILKCHGLWDEDDPKERKEASVREKES----------EPSSPLSHK 2057          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: ENSORLT00000004626.2 (pep primary_assembly:ASM223467v1:7:7477416:7483305:1 gene:ENSORLG00000003710.2 transcript:ENSORLT00000004626.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 368.622 bits (945), Expect = 2.139e-113
Identity = 220/618 (35.60%), Postives = 338/618 (54.69%), Query Frame = 3
Query: 1722 RNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSK-DYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPR---ASLKINMQAVCERPS--TDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKS 3554
            R +IK    ++     + S +    +R+F+  + +P+++   DVY  MFL + + F++ I+GY +FG  +  AD   + +  +++P  F+ M++ QF  +I+DRAL+L+K + GK +FQ+  V  IH W+FF LP +T+++FN     QL YFVKCIYF LSAYQ+K GYP RILGNFLT+++NY+NLFLF+G+ +VPFL ELR VMDW+WTD++++   W+ VEDI++ IFVLKCWR  E  +P   G+ ++ VVKY +G  I+      IW PL+  S +     V   P+E S  +++  Y PLF  S++E N+                F L S   +L ++E +D     I   +  +W I+P     + E+LSI     AS+ +N++AV E      D    + IV   +       ++ +L  L               F R ++   +  S A+    +Q                  WW V E        P   S   K   + I +FN+++S +  G + + +GI+G+Y +   V+ +F+R F++ IS  I  EELP VDR+ KL  +I++VRE  ++ LEE L  KLIFLYRS ETMIK T+   S
Sbjct:    1 RQQIKERMLQAKAAIIEVSLHIYLPIRQFFYDIIHPEYSPVCDVYALMFLIDVVNFIVTIYGYWAFGKYSAVADIT-ESLSEDQVPEAFLVMLLMQFGTMIVDRALYLKKSLLGKCVFQVVLVFGIHFWMFFILPGVTERRFNRNPIAQLWYFVKCIYFGLSAYQIKCGYPNRILGNFLTKNYNYLNLFLFQGFRMVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYANIFVLKCWRESEKKYPHPPGQKKKKVVKYGMGGFIIFALISIIWFPLLFMSLVQSAAGVTNQPVEVSIQLSIAGYEPLFTMSAQEQNLV------------ASLFLLQSAMQFLMNYEAEDIIVAKIKSDASLLWSISPASRAAMIEELSISSHLNASISMNVEAVGEHTVKFNDKALKDGIVSMLKGNSSKPSDRPDLQAL--------------AFFRPMSIKLQQASGASDKEADQ------------------WWVVEEC------SPVLTSSEPKCHSIEIVVFNDKVSPSSLGFL-AGHGIVGLYMSVVLVIGKFVREFFNGISRSIMFEELPCVDRVLKLCTDIFVVRETGEMELEETLFEKLIFLYRSPETMIKMTREKDS 566          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: piezo1 (piezo type mechanosensitive ion channel component 1 [Source:NCBI gene;Acc:101175341])

HSP 1 Score: 71.633 bits (174), Expect = 1.350e-12
Identity = 63/269 (23.42%), Postives = 122/269 (45.35%), Query Frame = 3
Query: 2493 YSLGXXXXXXXXXXXWGPLMISSFI-GITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANS-----LHQNQNNTYLNISLSMKTDNA------MMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNER 3263
            Y +G LI+ F    IW PL+  S +  +  V   PI+ + ++ +G Y PLF  S ++ +++P     +EE+ +  K +  +  ++  +  +D     I+ +S +VW I+PP  +++ ++L   +  L + +    +R      + E     T  ++  + E  NL+          N   P + P F   Y R  + A +     L++   + YL I+LS+K+D +        WW++   ++G   C  P         L + IFN++
Sbjct:   41 YGMGGLIVFFLICIIWFPLLFISLVRSVVGVVNHPIDVTVTVKLGGYEPLFTMSVQQQSIQPFNNSQYEELTKMFKDNATAMQFITLYSYEDIVTAQIEGSSGSVWRISPPSRQEVIKELLGSQVDLTLRLAWNFQRDLGKGGTVEH----TFDKYSIDLEPGNLVRAELASLLIGNRTEPVLVPNFFPNYIRAPNGAEAKPVSQLYKGGEDGYLGITLSLKSDRSSNSSGTREWWDI--AVEG---CVPPSCG-----VLRMVIFNDK 295          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000051188.1 (SMESG000051188.1)

HSP 1 Score: 1875.52 bits (4857), Expect = 0.000e+0
Identity = 1003/1159 (86.54%), Postives = 1059/1159 (91.37%), Query Frame = 3
Query:  129 VVRSGDKYLFXXXXXXXXXXXXXXXXXXCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLXXXXXXXXXXXXXXXXXXXXXXXXXXNPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSEHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLSLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKPAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADN 3605
            VVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSEHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQL+LDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEK AHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSH+FVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTD+SVA +HWMEVED+F KIFVLKCWR  E  +PT RG  RRL  KYS+G L+L FFF C WGPL +SSFIG TFVK PPIEC+FSI+VG YSPLF F SRENN++ L K TF++MKEC+K   P  DYL SFE  D TQI ID +SD+VW ITPP L+KLK KL     SLKINMQA+CER S+DSK+TEK+VR T ++ L   +K NLL  I    +S  V +  IFPRFLTAYKRTLSEA +L ++ N TYLN++LSMK +N   WWE+ EI+ G++YC N   P + +  LT+FIF+ER+SDN+FGH+FS+YGI+G+YAAY FV HR LR FYS+ISYII  EELP+VDRI  LL+EIYLVRENK  RLEEQLIAKLIFLYRS+ETMIKWT+H KS L  N +E+  +D  DN
Sbjct: 1419 VVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSEHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLTLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKSAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHNFVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDTSVALFHWMEVEDVFCKIFVLKCWRRSELEYPTVRGNTRRLASKYSVGGLLLAFFFICFWGPLTLSSFIGTTFVKNPPIECTFSISVGGYSPLFYFISRENNLKSLPKDTFDKMKECYKNFSPPTDYLMSFEAGDVTQISIDGSSDDVWTITPPSLEKLKVKLR-STESLKINMQAICERRSSDSKTTEKMVRHTNTKQLDENDKKNLLKAIEANQSSYVVQIDAIFPRFLTAYKRTLSEATALLKDHNQTYLNLTLSMKKENEARWWEIQEIVAGETYCSNEKIPKQSHSNLTVFIFSERVSDNLFGHLFSNYGIIGMYAAYIFVAHRVLRAFYSDISYIIRCEELPHVDRILNLLNEIYLVRENKMFRLEEQLIAKLIFLYRSTETMIKWTRHNKSILSKN-MEKTKSDAIDN 2575          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000051188.1 (SMESG000051188.1)

HSP 1 Score: 1867.43 bits (4836), Expect = 0.000e+0
Identity = 1003/1174 (85.43%), Postives = 1059/1174 (90.20%), Query Frame = 3
Query:  129 VVRSGDKYLFXXXXXXXXXXXXXXXXXXCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLXXXXXXXXXXXXXXXXXXXXXXXXXXNPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMS---------------EHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLSLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKPAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADN 3605
            VVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMS               EHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQL+LDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEK AHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSH+FVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTD+SVA +HWMEVED+F KIFVLKCWR  E  +PT RG  RRL  KYS+G L+L FFF C WGPL +SSFIG TFVK PPIEC+FSI+VG YSPLF F SRENN++ L K TF++MKEC+K   P  DYL SFE  D TQI ID +SD+VW ITPP L+KLK KL     SLKINMQA+CER S+DSK+TEK+VR T ++ L   +K NLL  I    +S  V +  IFPRFLTAYKRTLSEA +L ++ N TYLN++LSMK +N   WWE+ EI+ G++YC N   P + +  LT+FIF+ER+SDN+FGH+FS+YGI+G+YAAY FV HR LR FYS+ISYII  EELP+VDRI  LL+EIYLVRENK  RLEEQLIAKLIFLYRS+ETMIKWT+H KS L  N +E+  +D  DN
Sbjct: 1423 VVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSSVGLDIHGSRQTRRSEHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLTLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKSAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHNFVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDTSVALFHWMEVEDVFCKIFVLKCWRRSELEYPTVRGNTRRLASKYSVGGLLLAFFFICFWGPLTLSSFIGTTFVKNPPIECTFSISVGGYSPLFYFISRENNLKSLPKDTFDKMKECYKNFSPPTDYLMSFEAGDVTQISIDGSSDDVWTITPPSLEKLKVKLR-STESLKINMQAICERRSSDSKTTEKMVRHTNTKQLDENDKKNLLKAIEANQSSYVVQIDAIFPRFLTAYKRTLSEATALLKDHNQTYLNLTLSMKKENEARWWEIQEIVAGETYCSNEKIPKQSHSNLTVFIFSERVSDNLFGHLFSNYGIIGMYAAYIFVAHRVLRAFYSDISYIIRCEELPHVDRILNLLNEIYLVRENKMFRLEEQLIAKLIFLYRSTETMIKWTRHNKSILSKN-MEKTKSDAIDN 2594          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000051188.1 (SMESG000051188.1)

HSP 1 Score: 1865.51 bits (4831), Expect = 0.000e+0
Identity = 1003/1174 (85.43%), Postives = 1059/1174 (90.20%), Query Frame = 3
Query:  129 VVRSGDKYLFXXXXXXXXXXXXXXXXXXCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLXXXXXXXXXXXXXXXXXXXXXXXXXXNPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMS---------------EHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLSLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKPAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADN 3605
            VVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMS               EHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQL+LDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEK AHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSH+FVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTD+SVA +HWMEVED+F KIFVLKCWR  E  +PT RG  RRL  KYS+G L+L FFF C WGPL +SSFIG TFVK PPIEC+FSI+VG YSPLF F SRENN++ L K TF++MKEC+K   P  DYL SFE  D TQI ID +SD+VW ITPP L+KLK KL     SLKINMQA+CER S+DSK+TEK+VR T ++ L   +K NLL  I    +S  V +  IFPRFLTAYKRTLSEA +L ++ N TYLN++LSMK +N   WWE+ EI+ G++YC N   P + +  LT+FIF+ER+SDN+FGH+FS+YGI+G+YAAY FV HR LR FYS+ISYII  EELP+VDRI  LL+EIYLVRENK  RLEEQLIAKLIFLYRS+ETMIKWT+H KS L  N +E+  +D  DN
Sbjct: 1418 VVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSSVGLDIHGSRQTRRSEHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLTLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKSAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHNFVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDTSVALFHWMEVEDVFCKIFVLKCWRRSELEYPTVRGNTRRLASKYSVGGLLLAFFFICFWGPLTLSSFIGTTFVKNPPIECTFSISVGGYSPLFYFISRENNLKSLPKDTFDKMKECYKNFSPPTDYLMSFEAGDVTQISIDGSSDDVWTITPPSLEKLKVKLR-STESLKINMQAICERRSSDSKTTEKMVRHTNTKQLDENDKKNLLKAIEANQSSYVVQIDAIFPRFLTAYKRTLSEATALLKDHNQTYLNLTLSMKKENEARWWEIQEIVAGETYCSNEKIPKQSHSNLTVFIFSERVSDNLFGHLFSNYGIIGMYAAYIFVAHRVLRAFYSDISYIIRCEELPHVDRILNLLNEIYLVRENKMFRLEEQLIAKLIFLYRSTETMIKWTRHNKSILSKN-MEKTKSDAIDN 2589          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000051188.1 (SMESG000051188.1)

HSP 1 Score: 1864.35 bits (4828), Expect = 0.000e+0
Identity = 1003/1174 (85.43%), Postives = 1059/1174 (90.20%), Query Frame = 3
Query:  129 VVRSGDKYLFXXXXXXXXXXXXXXXXXXCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLXXXXXXXXXXXXXXXXXXXXXXXXXXNPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMS---------------EHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLSLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKPAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADN 3605
            VVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMS               EHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQL+LDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEK AHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSH+FVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTD+SVA +HWMEVED+F KIFVLKCWR  E  +PT RG  RRL  KYS+G L+L FFF C WGPL +SSFIG TFVK PPIEC+FSI+VG YSPLF F SRENN++ L K TF++MKEC+K   P  DYL SFE  D TQI ID +SD+VW ITPP L+KLK KL     SLKINMQA+CER S+DSK+TEK+VR T ++ L   +K NLL  I    +S  V +  IFPRFLTAYKRTLSEA +L ++ N TYLN++LSMK +N   WWE+ EI+ G++YC N   P + +  LT+FIF+ER+SDN+FGH+FS+YGI+G+YAAY FV HR LR FYS+ISYII  EELP+VDRI  LL+EIYLVRENK  RLEEQLIAKLIFLYRS+ETMIKWT+H KS L  N +E+  +D  DN
Sbjct: 1402 VVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSSVGLDIHGSRQTRRSEHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLTLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKSAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHNFVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDTSVALFHWMEVEDVFCKIFVLKCWRRSELEYPTVRGNTRRLASKYSVGGLLLAFFFICFWGPLTLSSFIGTTFVKNPPIECTFSISVGGYSPLFYFISRENNLKSLPKDTFDKMKECYKNFSPPTDYLMSFEAGDVTQISIDGSSDDVWTITPPSLEKLKVKLR-STESLKINMQAICERRSSDSKTTEKMVRHTNTKQLDENDKKNLLKAIEANQSSYVVQIDAIFPRFLTAYKRTLSEATALLKDHNQTYLNLTLSMKKENEARWWEIQEIVAGETYCSNEKIPKQSHSNLTVFIFSERVSDNLFGHLFSNYGIIGMYAAYIFVAHRVLRAFYSDISYIIRCEELPHVDRILNLLNEIYLVRENKMFRLEEQLIAKLIFLYRSTETMIKWTRHNKSILSKN-MEKTKSDAIDN 2573          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000051188.1 (SMESG000051188.1)

HSP 1 Score: 1858.57 bits (4813), Expect = 0.000e+0
Identity = 1003/1197 (83.79%), Postives = 1059/1197 (88.47%), Query Frame = 3
Query:  129 VVRSGDKYLFXXXXXXXXXXXXXXXXXXCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLXXXXXXXXXXXXXXXXXXXXXXXXXXNPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMS--------------------------------------EHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLSLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKPAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEXXXXXXXXXLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAXXXXXXXXXXXXHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRNRRLVVKYSLGXXXXXXXXXXXWGPLMISSFIGITFVKYPPIECSFSINVGDYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQIIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKSTEKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTLSEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSKKYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNISYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSETMIKWTQHWKSTLEANQVERVSADDADN 3605
            VVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMS                                      EHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQL+LDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEK AHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSH+FVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTD+SVA +HWMEVED+F KIFVLKCWR  E  +PT RG  RRL  KYS+G L+L FFF C WGPL +SSFIG TFVK PPIEC+FSI+VG YSPLF F SRENN++ L K TF++MKEC+K   P  DYL SFE  D TQI ID +SD+VW ITPP L+KLK KL     SLKINMQA+CER S+DSK+TEK+VR T ++ L   +K NLL  I    +S  V +  IFPRFLTAYKRTLSEA +L ++ N TYLN++LSMK +N   WWE+ EI+ G++YC N   P + +  LT+FIF+ER+SDN+FGH+FS+YGI+G+YAAY FV HR LR FYS+ISYII  EELP+VDRI  LL+EIYLVRENK  RLEEQLIAKLIFLYRS+ETMIKWT+H KS L  N +E+  +D  DN
Sbjct: 1419 VVRSGDKYLFEGDSDEDDEDVEGDIDESCSKKMTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPISESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINPLHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSSVGLDIHGSRQTRRKTIHQPYSCQTLRRSNAVVIEDASEHDELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLTLDLYSANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKSAHPESCWSKFKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLSKISNEVDGRIELEAIVVEIVGDGSHNFVNSKNQEEYLKEQEFRRSRSRFFLLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVPRPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGIEKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGRNKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLCEFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFIIIDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLLYFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLYELRNVMDWMWTDTSVALFHWMEVEDVFCKIFVLKCWRRSELEYPTVRGNTRRLASKYSVGGLLLAFFFICFWGPLTLSSFIGTTFVKNPPIECTFSISVGGYSPLFYFISRENNLKSLPKDTFDKMKECYKNFSPPTDYLMSFEAGDVTQISIDGSSDDVWTITPPSLEKLKVKLR-STESLKINMQAICERRSSDSKTTEKMVRHTNTKQLDENDKKNLLKAIEANQSSYVVQIDAIFPRFLTAYKRTLSEATALLKDHNQTYLNLTLSMKKENEARWWEIQEIVAGETYCSNEKIPKQSHSNLTVFIFSERVSDNLFGHLFSNYGIIGMYAAYIFVAHRVLRAFYSDISYIIRCEELPHVDRILNLLNEIYLVRENKMFRLEEQLIAKLIFLYRSTETMIKWTRHNKSILSKN-MEKTKSDAIDN 2613          
The following BLAST results are available for this feature:
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIEZO21.461e-12438.24piezo type mechanosensitive ion channel component ... [more]
PIEZO21.870e-12438.24piezo type mechanosensitive ion channel component ... [more]
PIEZO22.347e-12438.24piezo type mechanosensitive ion channel component ... [more]
PIEZO11.851e-11037.75piezo type mechanosensitive ion channel component ... [more]
PIEZO21.383e-6649.54piezo type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pezo-11.938e-10127.07Piezo-type mechanosensitive ion channel component ... [more]
pezo-11.925e-9727.07Piezo-type mechanosensitive ion channel component ... [more]
pezo-11.925e-9727.07Piezo-type mechanosensitive ion channel component ... [more]
pezo-12.052e-9727.07Piezo-type mechanosensitive ion channel component ... [more]
pezo-12.507e-9727.07Piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Piezo1.098e-12332.26gene:FBgn0264953 transcript:FBtr0335175[more]
Piezo1.118e-12332.14gene:FBgn0264953 transcript:FBtr0347414[more]
Piezo1.118e-12330.58gene:FBgn0264953 transcript:FBtr0335183[more]
Piezo1.190e-12330.35gene:FBgn0264953 transcript:FBtr0335181[more]
Piezo1.487e-12332.26gene:FBgn0264953 transcript:FBtr0335182[more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piezo2a.21.755e-13137.94piezo-type mechanosensitive ion channel component ... [more]
LO018508.17.222e-13138.64pep chromosome:GRCz11:2:54327160:54353625:1 gene:E... [more]
piezo2a.22.204e-12338.03piezo-type mechanosensitive ion channel component ... [more]
piezo11.302e-10936.78piezo-type mechanosensitive ion channel component ... [more]
si:dkey-11f4.71.733e-7945.00si:dkey-11f4.7 [Source:ZFIN;Acc:ZDB-GENE-070912-36... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIEZO25.542e-15539.30piezo-type mechanosensitive ion channel component ... [more]
PIEZO24.516e-15437.44piezo-type mechanosensitive ion channel component ... [more]
PIEZO27.804e-15438.10piezo-type mechanosensitive ion channel component ... [more]
chordc11.059e-14036.89cysteine and histidine rich domain containing 1 [S... [more]
chordc11.204e-14036.89cysteine and histidine rich domain containing 1 [S... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Piezo22.363e-12238.24piezo-type mechanosensitive ion channel component ... [more]
Piezo22.549e-12238.24piezo-type mechanosensitive ion channel component ... [more]
Piezo22.877e-12238.24piezo-type mechanosensitive ion channel component ... [more]
Piezo16.704e-10437.13piezo-type mechanosensitive ion channel component ... [more]
Piezo17.338e-10437.13piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H5I5|PIEZ2_HUMAN7.016e-12438.24Piezo-type mechanosensitive ion channel component ... [more]
sp|M9MSG8|PIEZO_DROME2.174e-12232.26Piezo-type mechanosensitive ion channel component ... [more]
sp|Q8CD54|PIEZ2_MOUSE2.011e-12138.24Piezo-type mechanosensitive ion channel component ... [more]
sp|Q92508|PIEZ1_HUMAN8.888e-11037.75Piezo-type mechanosensitive ion channel component ... [more]
sp|Q0KL00|PIEZ1_RAT5.571e-10636.98Piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YS870.000e+049.04Piezo-type mechanosensitive ion channel component ... [more]
A0A4S2LHK50.000e+048.75Piezo-type mechanosensitive ion channel component ... [more]
A0A4Z2DRN60.000e+046.47Piezo-type mechanosensitive ion channel component ... [more]
A0A564YVM10.000e+044.22Piezo_RRas_bdg domain-containing protein OS=Hymeno... [more]
A0A3Q0KMS30.000e+045.47Piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piezo2a.21.557e-12538.28piezo-type mechanosensitive ion channel component ... [more]
piezo2a.21.672e-12438.55piezo-type mechanosensitive ion channel component ... [more]
PIEZO21.310e-12338.76piezo type mechanosensitive ion channel component ... [more]
piezo12.900e-10937.35piezo-type mechanosensitive ion channel component ... [more]
piezo11.557e-1123.67piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009619.16.390e-3247.29pep scaffold:Pmarinus_7.0:GL484020:1370:4517:1 gen... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO302922.529e-5734.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473701.334e-4030.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473695.260e-2349.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piezo12.592e-13436.46piezo type mechanosensitive ion channel component ... [more]
PIEZO21.992e-11637.82piezo type mechanosensitive ion channel component ... [more]
PIEZO27.570e-11537.58piezo type mechanosensitive ion channel component ... [more]
ENSORLT00000004626.22.139e-11335.60pep primary_assembly:ASM223467v1:7:7477416:7483305... [more]
piezo11.350e-1223.42piezo type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051188.10.000e+086.54SMESG000051188.1[more]
SMESG000051188.10.000e+085.43SMESG000051188.1[more]
SMESG000051188.10.000e+085.43SMESG000051188.1[more]
SMESG000051188.10.000e+085.43SMESG000051188.1[more]
SMESG000051188.10.000e+083.79SMESG000051188.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008757 ID=SMED30008757|Name=Piezo-type mechanosensitive ion channel component|organism=Schmidtea mediterranea sexual|type=transcript|length=3999bp
ATCATTTATTGGAATTTTCTTACGTTTTGTCAGTGTTTTCACATTTTATT
GAATTTTATTTTTTTAAGTACCTAAACTTGGATAGTTTTAAAATGCTAGA
TGTATTATTAAAAATATTATGTAATTAAGTTGTTCGATCCGGTGATAAAT
ACCTTTTTGAGGGTGACTCTGATGAAGATGATGAAGATGTAGAGGGAGAT
ATTGATGAATCTTGTTCAAAAAAAATGACAGTTACATCTGAAGATACGTT
TGATAAAAACACATCAAACAACCAAAATAAAAAATGTTCAGTGGATTCTT
TGGATTCACAAGGATTGTTTAATGCTGTTAATGTTGTTACAAGTCATTCC
AGAAATTTACTAAAGCCCATTAGTGAAAGTAGATGTTCAACAGAGTCATC
GCGCAAGAGTTTGGATAATCAAAATAAAATTATAAAGGAAATAAATAAAA
AGGATGCCAAAGACTCAGATAGCTCTGAAGAAGATGATGCTAACCCGCTT
CAAGTTCAAAATACTATAAATCCACTTCATTTAATAAATAGGGCTATGGA
ACAAGGACCTAGATCTGCTATTCGAGAATTTAAACGAACTCAATCCGAAT
GCAAAGAAAATTTACCGTCGAATCGTCGATCCAGTGTACACTTAGGAAGT
CGGTTAGAATCAATGTCTGAGCACGATGAGTTAAGCTCATTACCAGATGC
TTACAATACTCCACCTCCTGCACATATTTCTGAAACTACTACCGAAGATT
CCTTTCATTCTGCAGCAATTCAAGATAATCAGTTGACCAATGACCAAGCC
CAACTGAGTTTAGATTTATATTCCGCTAATACGCCTGAAAGTGAAAAATA
TTTGAATCCGTTAATCTACAGGGACACCAACATCAGCTCAAACTCTGTGC
CGGAATTGATTTCTAATGATGAAACCGATAAAAAGATAGAAAAACCAGCG
CATCCCGAAAGCTGTTGGAGTAAATTCAAAGCTAGTATTCTAATTGTTTA
CTACTTCATTCAAACTACGACGGATAATTTAATTGTTCTGATAAATACTT
GGACCAAGGAATATCGAAGAATCAGACGTACTTTAGACAATGAAAAACGA
CTAGTTAAACTCAAAGTATTATCAAAAATCAGCAATGAAGTTGATGGAAG
AATTGAATTAGAAGCAATAGTTGTAGAAATTGTTGGCGATGGAAGTCATA
GTTTTGTCAATTCCAAGAATCAAGAAGAGTATTTGAAGGAACAGGAATTT
CGACGTTCTAGATCGAGGTTCTTTTTGCTTGCAATATCATTAGGAAATGT
CGCAATAATATATTCTGAATTTGTATGTTACTTTCTTTTGATTCTAAATC
ATATGTTGTCTGGGAATTTGTTTTCTCTGCCATATCCTCTCATGGTATTT
TTATGGGCTATGCTTTCAGTTCCTCGGCCATCCAAAAACTTTTGGATTGC
ATTAATTACTTATACGGAGATAGTGATCGTAATCAAATATATTTTTCAAT
TCAATTTTATCAGTTTTAATGAAACTACCAACGACCGAGTTGATCCTTTG
TGGATTCCCCTTATAATTGGCATTGAAAAATCTAAAAATTATGCTATTCT
TGATTTAATACAATTGCTTTTTATATTCCTTCATCGTGGATATTTAAAAA
ATAATGGACTATGGAGAGATCACACAGAATTTGCTCAAGATTTGGAAATT
GTCGATAAAGAACAGGATGGAAGAAATAAAATCAAATCCTCATACGAAGA
ATCTTCTCCGACATCAAACAAATGGTCCTGTAATCCCATTTATAAAATGA
GAAGATTTTATTCGAAAATGACAAATCCAAAGTTCAATAAGAAAGTGGAT
GTTTATGTTTTTATGTTCCTTTGTGAATTTATCGCATTTCTGATAATTAT
ATTTGGTTATGTTTCATTTGGTCCTGGGACTGATTCTGCTGATAATGCGT
TTGATTTCATTAAAACAAATAAAATTCCTGTGCCTTTTATAACAATGATA
ATTACTCAGTTTGTATTCATTATTATTGACAGAGCGCTTTTCCTAAGAAA
ACAAGTTAAAGGAAAGTTCATATTTCAAATATTTCATGTCCTATTGATAC
ACGCGTGGCTATTTTTTGCATTACCTCACATTACAAAGAAAAAATTTAAT
TCTCAAATAGCTCCTCAACTTTTATATTTTGTAAAATGTATTTACTTTGC
TCTTTCAGCATACCAAATGAAATCTGGTTATCCTTTAAGGATTCTTGGAA
ATTTTTTGACTCGAGATTTTAATTATATTAATTTGTTCTTATTCAAAGGA
TACATGATCGTTCCTTTTCTATATGAACTGAGAAATGTCATGGACTGGAT
GTGGACTGATTCTTCCGTTGCCTTCTATCACTGGATGGAAGTTGAGGACA
TCTTCAGTAAGATTTTCGTTCTCAAATGTTGGCGATATGGCGAAACGATT
TGGCCGACAGAAAGAGGAAGAAATCGACGATTAGTCGTCAAATATTCACT
TGGAATATTAATATTAATATTTTTCTTTTTCTGCATTTGGGGGCCCCTGA
TGATTAGCAGCTTTATTGGGATCACCTTTGTCAAATATCCACCGATTGAA
TGCTCATTCTCTATTAATGTTGGTGATTATAGCCCTTTATTCGTATTCAG
CTCTCGGGAGAACAACATGAGACCCTTGACTAAAAAAACGTTTGAGGAAA
TGAAAGAATGCCATAAATTTCATTTGCCGTCAAAGGATTACTTGCAAAGT
TTTGAACCGGATGATGCCACGCAAATCATTATTGACTACGCATCGGATAA
CGTTTGGCTGATAACCCCTCCCGGTTTGAAGAAGCTAAAAGAAAAATTAT
CAATTCCAAGAGCTTCATTGAAGATAAATATGCAAGCAGTTTGTGAAAGG
CCGTCCACAGATTCAAAATCCACTGAGAAAATTGTCCGATTTACGCAATC
GAGATTCCTAACGAATCCTGAGAAAGCAAATTTGTTGCATTTGATAAATA
CCAAATTCAACTCAACAAATGTTTATCTGCCCACAATTTTCCCGAGATTT
CTCACGGCCTATAAGCGAACTCTCTCCGAGGCCAATTCTCTGCATCAGAA
TCAAAATAATACGTATTTGAACATTAGCTTATCAATGAAAACCGACAACG
CAATGATGTGGTGGGAGGTCAATGAGATCATCCAAGGTCAGTCATATTGC
CCAAATCCCGACAGCCCATCCAAGAAATATTTGTTTCTTACAATTTTCAT
CTTCAATGAACGCATATCCGATAATATTTTCGGACATATATTTAGTAGTT
ATGGAATATTAGGAATCTATGCGGCGTACTTTTTTGTGGTTCATCGGTTT
CTGCGGACCTTTTATTCCAACATCTCCTACATCATACCAGCAGAGGAATT
GCCAAATGTCGATCGGATCCACAAATTGCTCCACGAGATTTATTTAGTGC
GAGAAAATAAAAAGCTTCGACTGGAAGAACAATTGATAGCGAAGTTGATA
TTTCTGTACCGGTCATCAGAAACTATGATCAAGTGGACGCAGCACTGGAA
GTCCACCCTTGAAGCTAATCAGGTGGAACGGGTCAGTGCTGATGATGCTG
ACAACGGGCTGTCTATGATTTCTGTGGACAACACCAGTCGAGAGAGCTTT
GTCAGTCTTGTCAATGATCATTCCGTGAAAACTTAGTTTAATAAAACAAT
TCATCTATTGTTTTAATCAACTGTAAATTGTCTCATGTGATCAATTGAAA
TATTTTATTTTCTAGGAATATTTTTACTTTGACGAGAAACTTTACAAATT
TTATTATTAGATTTTTCCATATTCTATCTCAGTTTATTTAATAAACTTTT
CTGGTTTTTATTTCGTTTTCTTTGACTTATATTTTCCATAATTTAAACAA
TTTTGACAAAAAAATATCTTTATTAATAAAAAAAATTTTTGGTGACATTT
CATGAATTTATTGAATTGGAAAGGGGGGGGGCACGCGTCAATGTACGGA
back to top

protein sequence of SMED30008757-orf-1

>SMED30008757-orf-1 ID=SMED30008757-orf-1|Name=SMED30008757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1154bp
MTVTSEDTFDKNTSNNQNKKCSVDSLDSQGLFNAVNVVTSHSRNLLKPIS
ESRCSTESSRKSLDNQNKIIKEINKKDAKDSDSSEEDDANPLQVQNTINP
LHLINRAMEQGPRSAIREFKRTQSECKENLPSNRRSSVHLGSRLESMSEH
DELSSLPDAYNTPPPAHISETTTEDSFHSAAIQDNQLTNDQAQLSLDLYS
ANTPESEKYLNPLIYRDTNISSNSVPELISNDETDKKIEKPAHPESCWSK
FKASILIVYYFIQTTTDNLIVLINTWTKEYRRIRRTLDNEKRLVKLKVLS
KISNEVDGRIELEAIVVEIVGDGSHSFVNSKNQEEYLKEQEFRRSRSRFF
LLAISLGNVAIIYSEFVCYFLLILNHMLSGNLFSLPYPLMVFLWAMLSVP
RPSKNFWIALITYTEIVIVIKYIFQFNFISFNETTNDRVDPLWIPLIIGI
EKSKNYAILDLIQLLFIFLHRGYLKNNGLWRDHTEFAQDLEIVDKEQDGR
NKIKSSYEESSPTSNKWSCNPIYKMRRFYSKMTNPKFNKKVDVYVFMFLC
EFIAFLIIIFGYVSFGPGTDSADNAFDFIKTNKIPVPFITMIITQFVFII
IDRALFLRKQVKGKFIFQIFHVLLIHAWLFFALPHITKKKFNSQIAPQLL
YFVKCIYFALSAYQMKSGYPLRILGNFLTRDFNYINLFLFKGYMIVPFLY
ELRNVMDWMWTDSSVAFYHWMEVEDIFSKIFVLKCWRYGETIWPTERGRN
RRLVVKYSLGILILIFFFFCIWGPLMISSFIGITFVKYPPIECSFSINVG
DYSPLFVFSSRENNMRPLTKKTFEEMKECHKFHLPSKDYLQSFEPDDATQ
IIIDYASDNVWLITPPGLKKLKEKLSIPRASLKINMQAVCERPSTDSKST
EKIVRFTQSRFLTNPEKANLLHLINTKFNSTNVYLPTIFPRFLTAYKRTL
SEANSLHQNQNNTYLNISLSMKTDNAMMWWEVNEIIQGQSYCPNPDSPSK
KYLFLTIFIFNERISDNIFGHIFSSYGILGIYAAYFFVVHRFLRTFYSNI
SYIIPAEELPNVDRIHKLLHEIYLVRENKKLRLEEQLIAKLIFLYRSSET
MIKWTQHWKSTLEANQVERVSADDADNGLSMISVDNTSRESFVSLVNDHS
VKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027272Piezo
IPR031334Piezo_RRas-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0008381mechanically-gated ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031334Piezo non-specific cation channel, R-Ras-binding domainPFAMPF12166Piezo_RRas_bdgcoord: 695..727
e-value: 3.0E-13
score: 49.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..97
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 123..155
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 129..143
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 378..397
NoneNo IPR availableTMHMMTMhelixcoord: 407..429
NoneNo IPR availableTMHMMTMhelixcoord: 351..373
NoneNo IPR availableTMHMMTMhelixcoord: 683..700
NoneNo IPR availableTMHMMTMhelixcoord: 585..607
NoneNo IPR availableTMHMMTMhelixcoord: 646..663
NoneNo IPR availableTMHMMTMhelixcoord: 614..636
NoneNo IPR availableTMHMMTMhelixcoord: 543..565
IPR027272Piezo familyPANTHERPTHR13167UNCHARACTERIZEDcoord: 57..727