SMED30008756

Overview
NameSMED30008756
Smed IDSMED30008756
Uniprot Best hitDynein heavy chain 6, axonemal OS=Homo sapiens OX=9606 GN=DNAH6 PE=2 SV=3 (E=0)
Length (bp)12736
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30008756 (SMED30008756) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30008756 (SMED30008756) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30008756 (SMED30008756) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30008756 (SMED30008756) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008756

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 30

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30008756SMESG000007049.1 Contig3743uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30008756SMESG000007049.1 Contig3743newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30008756SMESG000007049.1 Contig3743uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008756SMESG000007049.1 Contig3743newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30008756SMESG000074654.1 Contig3743uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30008756SMESG000074654.1 Contig3743newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30008756SMESG000074654.1 Contig3743uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008756SMESG000074654.1 Contig3743newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30008756SMESG000007049.1 SmedASXL_018374SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008756SMESG000007049.1 SmedASXL_008720SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008756SMESG000007049.1 SmedASXL_004998SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008756SMESG000007049.1 SmedASXL_005132SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008756SMESG000007049.1 dd_Smed_v4_14707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30008756SMESG000007049.1 dd_Smed_v4_14707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008756SMESG000007049.1 dd_Smed_v4_14707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008756SMESG000007049.1 dd_Smed_v4_14707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30008756SMESG000007049.1 dd_Smed_v4_14707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008756SMESG000007049.1 dd_Smed_v4_14707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008756SMESG000007049.1 dd_Smed_v4_6538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008756SMESG000007049.1 dd_Smed_v4_6538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30008756SMESG000007049.1 dd_Smed_v4_6538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008756SMESG000007049.1 dd_Smed_v6_6538_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30008756SMESG000007049.1 dd_Smed_v6_14707_0_9dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30008756SMESG000007049.1 dd_Smed_v6_14707_0_9dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30008756SMESG000007049.1 dd_Smed_v4_14707_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008756SMESG000007049.1 dd_Smed_v4_14707_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30008756SMESG000007049.1 dd_Smed_v4_14707_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008756SMESG000007049.1 dd_Smed_v4_6538_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30008756SMESG000007049.1 dd_Smed_v4_6538_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30008756SMESG000007049.1 dd_Smed_v4_6538_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30008756 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001040:1..51274 +59619
Homology
BLAST of SMED30008756 vs. Ensembl Human
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 4293.42 bits (11134), Expect = 0.000e+0
Identity = 2099/3450 (60.84%), Postives = 2627/3450 (76.14%), Query Frame = -2
Query: 1759 KIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETP--KVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK--NDGRCCENW 12093
            +II I+RE   + FLY+   + +    Y  YNLKVVSY N+ K D+Y +S    THI   ++I+ I +DR+E EY  + ++ KIP F+ FR WKAF  WRK ++  K   C K L  +LFI+N  LRPALL + E+C+ +S MGLC +EK  TYTL +F  AQ+ +L EV  +L EFR   + V+R ACR +L   GF PDD        P        +  S++   +++  Y ++ +KMTYTEQA+KR++C RLT FIRL DYLI NTMH+L VN+V +LLN+++D+LK+TP+A+       ++ + I  E      +PE      P K+ ++   K  E+E  +   P+F+TE +L+VQ+LLF P  E F +GI   +   QNTVLSV NLVPD+YFD+FT P INNK E KTCG GPS+AA+F +D + H +I+Q  + I AAF +   YA+TF + + F+++NES DL A++  + D+ FF E   +YH++ +    +   + +G++L+D   +++ ++PSP RCL+V+N MLP  ++K+VDA+I E+QDAEY L   PT T +YV++L FL EIQ R+E LE E +++ +MY L++ + VPTPPEDFAV+ T+ PSI   +NAIDK++ DR+ +I +FC  L  D+ EL  EV +++    +P ILD+ A++ +++  L  L++ + +LQ RAF YKSYQKNFKVE ++ E LEEV+AELKLKQ+LWDS  EWD    EWL+ +F  L+PE L  Q +KY K V QLEKGLPPN VVP LK KVE+M+EK+ VI +L NP L+ RHW  IE  ++    ++E  LTL +L +L+VFD+ +E+++ISGQAS EA+LEA+LKKVE++W+ TE+V+LPH+DSKDVFILGGTD+IQ L DDS INVAT+ASSR++GP+K RVDEW K L LF +T+EEWL CQRNWLYLESIF+APDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T PGLL+TF+NNN LLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNP AVQPHLRKCFD+ISKL+FA+      K+   DG P      E  YTNDILAM+SPEGE+VSLGKGLKARGNVEEWLGKVEEAMF +LR+L + +I ++    R +W+ A H +Q++LTV Q+MWCR++T  LE      +Q + +FE   F+ LN LA +V+G LPKL R  L ALIT++VHARD+VTE+V+ KV  +  F+WQ+QLRYYWD  LDNCV RM+ S YTYGYEYLG  PRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAK+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRP AMMVP+Y LIAEVILYSEGFESSK LA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENPD  EDVVLIRAL+DSNLPKFL  DA LF  I+ DLFPGV++PEHDYG  +  I  V+    LQ     V KVIQFYET+ VRHGVMLVGPTGGGKTTVY +LA+ L NL   G+  E   YQ VK Y+LNPKSITMGELYGEVN LTLEW DGLM   VR    DTS+DH+W+I DGPVDALWIENMNTVLDDNKMLCLANSERIKLTP +HMLFEVQDL VASPATVSRCGMV+VDPEEL WMP+VKTW+  ++ KL  E  +Y+  +F++Y+D+GL F   KC Q + QV I+K+ T+C LLESL++G    NL ++  KLN  +   FVFCYLW +GGNL E+ +DSFD F+R +F+DN D R+P+ GDLWS + D  ++++D WE+I+P FK+N++VPFFEM+VPT DT+R+GYL+EKLL VK SVLFTG TGVGKSV+A+G LN I E+AGYVPV++NFSAQTSS RTQE+IE+KLE+KRK +LGAP NKR++IF+DDLNMP+LD YGSQPPIELLRQYQDFGGFYDR+KL W  IQD+T+ +AC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF +IL GF +DFP  V+    +IV A+VEIYN+M  DLLPTPAKSHYVFNLRDLSKC+QGILQCDP  +R++  +F+LFCHE QRVFHDRLIN+EDK +FH I+ EMA+K+FG  I+ E F+  PIIFGDF+K G +K +R+Y+ + D  K  N+L  YLDD+N+ + KE+KLVFF DAI+H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA + GY C QIEL RGY+Y+ FH DL+K+Y+  G+ +++ VFLFTDTQIVVEEFLEDINNILNSGEVP+LFE DE E+++   R  AKE G+SEGNRD +F++ I++VR  LHIVLCMSPVG +FRSRCRMFPSLVNCCTIDWF  WP EALL+V+K+ F  VD G +ELK KL LMC  +H SV+  +ER+Y EL+R YYTTPTSYLELI LYLSML+EK+KQ+++ RDRVKNGLTK+LETN L+  M+++L AL P L  K +D EALM+KL  DQE AD VR+ V+EDEA AKVKA+ETQAIADDAQRDLDEA+PAL+ A KALD+LDK DI+EIRVFT PP +V TVME++ +LL  K DW SAK +LGD  FLK+L +Y K+NI   +L KL++YI++P+F  E VEKVSKAC+S+ +WVRAMD+YS+ VK VEPK+++L  A  ELD  M  LR+KQA L  VE++I  LQ  YD  V EK++L   +ALT ARL RAGKLT AL DE+ RW ES+ KF EE+ N+ G+VF+ AACVAYYGAFT+ YR  L+  WI  C+ LEIP+    +L+ +LGD +E+RQWN++GLPRD +STEN ILVT+GRRWPLMIDPQ+QANRWIRNKE+ + LKIIKL++ NFLR LEN IRLG+P LLE++ ETLDPALEPILLKQ F+  GR LI LGDSDI+Y K+F+ Y+TTK+ NPHY+PE+CIKVTIINFTVT  GLEDQLL +V RLE+P LEEQR  LI+RIN DKNQL+  E +IL++LF SEGNILD+E+LI+TL +SK+TS     R+ EAE TEQ I VAR KY PVA +GSVMYFV+A+++EIDPMYQ+SLKYFK LFN TIE S K+++L++R+ +LL +T +  Y NV+RGLFE+ KL++SFMLC+++MRQ G +SD EW FFLRG  G+EK+RP KP  PW+    W    D+ +  PVF  L  +I    I + +G     +N ++ + Y       S+   +   +  E   +    +   L+SF KLIL+K   EEK+V  +T+FV  NLG +F+E PP DLP L+QDMS  +PLVF+LSTGSDPM  FQRFA+E     +  S   G   G    K   D     NW
Sbjct:  188 QIIKIIRENEHLGFLYMIPAVPRSSIEYDTYNLKVVSYENINKNDYYTISQRAVTHIY-NEDIEFIEIDRWEQEYLYHRELTKIPIFSLFRKWKAFSVWRKNVRSKKITGCQKSLQKNLFIVNPHLRPALLKINELCYHLSFMGLCYIEKCHTYTLQEFKAAQVIRLAEVTERLGEFRNEAKYVVRRACRFALRAAGFVPDDCAFG----PFEDYHKVQSSGSFINTPHELPTYGDS-EKMTYTEQASKRHYCMRLTCFIRLNDYLIENTMHILTVNAVNSLLNHLTDKLKRTPSAD-------VIQKWITEE------KPEV-----PDKKGTLMVEKQEEDESLI---PMFLTELMLTVQSLLFEPSLEDFLDGILGAVNHCQNTVLSVPNLVPDSYFDAFTSPYINNKLEGKTCGTGPSLAAVFEDDKNFHTIISQIKETIQAAFESARIYAATFEKFQIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGLLLIDTRLLREKLIPSPLRCLEVLNFMLPRQSKKKVDAIIFEAQDAEYKLEFVPTTTTEYVHSLLFLDEIQERIESLEDEGNIVTQMYKLMEQYQVPTPPEDFAVFATMKPSIVAVRNAIDKSVGDRESSIKQFCVHLGSDLEELNNEVNEVKLQAQDPQILDISADQDKIRLILNNLQSVLADLQKRAFQYKSYQKNFKVEVSKFEALEEVSAELKLKQLLWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLPPNSVVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEP------EKVYTNDILAMLSPEGERVSLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLETEHSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDVVLIRALQDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETLGNLQKLGI--ENSFYQAVKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKGISKKLTEETQEYILNLFQRYVDEGLHFINKKCSQAIPQVDISKVTTLCCLLESLILGKDGVNLAMEQTKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTFKYNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGVGKSVIAKGLLNKIQESAGYVPVYLNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLSDFPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEIQIFRLFCHECQRVFHDRLINNEDKHYFHVILTEMANKHFGIAIDLEYFLNKPIIFGDFIKFGADKADRIYDDMPDIEKTANVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEQVLAATRPRAKEVGISEGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFSQVDAGNEELKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLSALEPVLLAKSEDVEALMEKLAVDQESADQVRNTVQEDEATAKVKAEETQAIADDAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPSAKQLLGDSNFLKRLLEYDKENIKPQILAKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKTENLQQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAPWLPTATWFACCDLEESFPVFHGLTQNILSHPISIRLGSFETYINPQKWEGY-------SKMKHEDKHMRQEKEAAHQDPWSAGLSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTGSDPMGAFQRFARESGYSERVQSISLGQGQGPIAEKMVKDAMKSGNW 3595          

HSP 2 Score: 791.186 bits (2042), Expect = 0.000e+0
Identity = 366/603 (60.70%), Postives = 463/603 (76.78%), Query Frame = -3
Query:   63 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSK 1871
            F+   ++  Y ERVQ+ISLGQGQGP+AEKM+  A K G+WVFLQNCHLA SWM+ +EE++K  ++    + + FRLFLSSMP+ TFP++VLQNSVKVTNEPPKGLRANI+RAF EM+P FFE ++LG  WR++IFGICFFH+II +RKKFGPLGWNI YEF+DSDRECA+LNL ++C +G I WDAL YIT EITYGGRVTD WDQRCLR IL  FF P+T+ EDYKYS+SGIY+ P  +++ E+KD++++LPL+++PEIFGMHENANL FQ +ET  LINTIL+VQPR + GG G++ D+IV EL   +  ++ +K+  E A   LF  D +GRLNSLTTVL QEVDRFN LL +I  SL  L KAI GFVVMSEE+E VY +F NNQVP LWSN AYPSLKPL +WVKDL +R S    W+ +G PKS+W+ GFFFPQGFLTGTLQN+ARKY+ PID LSF++ V   YR+Q  V++  K ++FG+ +  D  L SP DGVLVHG++MD  RWDD+   I  ++ G+M  VLP++H  P+ +Y+P  T Y  PLYKT  RAG LSTTG STNFVV V LP+ +  ++WI  G+AL+C+ S+
Sbjct: 3556 FQRFARESGYSERVQSISLGQGQGPIAEKMVKDAMKSGNWVFLQNCHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMPSNTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGKKWRQIIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLKLYCKEGKIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPETLEEDYKYSESGIYFAPMADSLQEFKDYIENLPLIDDPEIFGMHENANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLGQEVDRFNNLLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVPALWSNTAYPSLKPLGSWVKDLILRTSFVDLWLKRGQPKSYWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYSVIPTYRDQAAVIEAAKTVQFGQELPMDMELPSPEDGVLVHGMFMDASRWDDKEMVIEDALPGQMNPVLPVVHFEPQQNYKPSPTLYHCPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRSKDYWIAKGSALLCQLSE 4158          
BLAST of SMED30008756 vs. Ensembl Human
Match: DNAH1 (dynein axonemal heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2940])

HSP 1 Score: 2124.36 bits (5503), Expect = 0.000e+0
Identity = 1177/2808 (41.92%), Postives = 1715/2808 (61.08%), Query Frame = -2
Query: 1801 MNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEK---GLPPNQVVPV-LKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLN-----AAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPN---LNVDAQKLNPTIAIA---FVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNG-DCRMPSQG--------DLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFF--------EMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSV-VARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLN-WITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFF------ADFPQQVRGC------TENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKL----PIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAK---SSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD--------------WASAKSVLGDP-YFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 10020
            + + Q  A  Y + ++ F +     + L  +  E +    LW +  +W      W+ +    ++ E L     +  K + +  K    +P  Q V + ++ ++E+ +  + +I  L NP ++ RHW+ + + IN      +  LT  + +E+N+ D+ E + +++  A  E ++E  L K+E+ W    + VLP+K + D +IL   DE  QL DD  +    ++ S +  P + R++ W   L L  + +EEWLNCQR+WLYLE IFS+ DI +QLP E+K + ++++ +K+IM+   +    +   +   +LD+ ++ N++LD +QK L  YLE+KR  FPRFYFLS+DELLEIL+QT++P AVQPHLRKCF+ I++L F                    QE     +I  M S EGE+V L   +    NVE+WL +VE +M  ++  ++ ++I  + T+ R +W+     Q+ +   Q  W  E+   LE      L+  + F   C Q L+ L  LVRG L ++ RA L ALI + VHA+D+V+++++E V  +N F+W  QLRYYW  T ++  +R  N+ + YGYEYLG S RLVITPLTDRCYL L GAL L  GGAPAGPAGTGKTETTKDL K+LA Q VVFNCSD LD+  MG+FF GLA +GAW CFDEFNRIDIEVLSV+AQQ+ TI+ A+  ++ RFMFEG EI LV +CA FITMNPGYAGRTELPDNLKALFRP+AMMVPDY +I E+ LYS GF  +  LA+K+T  +KL SEQLS QDHYDFGMRA+K+V+  AG LKRENP   E+++ +RA+RD N+PKFL++D +LF  I+ DLFP ++  + DYG     I     NS L+     + K IQ YET  VRHG+MLVGPTG GK+T Y VLA  +++L      + G+      Y+ V  Y+LNPKSITMG+LYGE + LT EW DG+    +R   + +  + +W + DGPVDA+WIENMNTVLDDNK LCL++ E IKLT  + M+FEVQDL+VASPATVSRCGMVY++P  LG MPF++ WL  +   LK    ++   +F  ++++ + F ++   + +A  +     ++ +LL+     P  P      + ++KL+  + +    F+F  +W +G     S   SF +++R K E+       P +G        D   S  +    + + ++++  V   +   PF          +IVPT+DT++  +LL+ LL  K+ VL  G TG GK++ ++   L N++ +  Y+  F+ FSA+TS+N+TQ+ I++KL+K+RK V G P  +  I FIDDLNMP L+TYG+QPPIELLRQ+ D GG+YDR  +  +  + D+    A GPPGGGRN V+ RL+RHF   S     E+S ++IF++IL  +         + ++V G       TE +V A + +Y  + + LLPTPAKSHY FNLRDLSK  QG+L  DP+ V D+  + +L+ HE  RVF DRL+N ED+ +F Q++     ++        +F K+    PI++GDFM PG +   + YE +T  +K+  ++  Y++D+N  ++ ++KLV FMDA+ HI RI+R +RQ  GNALL+GVGG+G+ SLTRLA+ M  Y CFQIEL + Y  + +  D+KK+    G+ N    FLF+DTQI  E FLEDINN+LNSG++P+L+  DE ++++   R   +E G+ +  +  +      RVR+N+H+VLCMSP+G  FR+R R FPSLVNCCTIDWF  WP EAL +VA    +    ++  ++E++  L  +C  IH SV+K+   + AEL RH Y TP SYLEL+ ++  ++ +KK +L T ++R+K+GL K+L T+E +A M+ +L ++ P LE+  KDT   M+++  D   A+  R+ V+ +E  A  KAK+ QAIADDAQ+DLDEA+PAL+ A+ +L  L+KND+ E+R    PP  V+ V+E+VC++ G K                W   K +L DP +FL+ L  + KDNI + ++K ++ YID+  F    + KVSKAC S+  WVRAM  Y    K VEPK++ L  A  +L      L + +  L  VE+ IA +Q  Y   +T+K+ LE        RL RAGKL   L+DEK RW E+V      L N+ GDV + A  VAY G FT  YR  L   W+ + R   +P +   TL+G LG+  ++R W   GLP D +S EN ++    +RW   IDPQ QAN+WI+N E  N L + KLS+ +FLR++EN IR G P LLE++GE LDPALEP+LLKQT+ + G T++ LGD+ I Y +DF++YITTKL NPHY PEI  K+T+INFT++P GLEDQLLG+V   ERP+LEE +N LII     + +L+  E++IL  L  SEGN +D  +LI  L  SK+ +AE   ++  AE TE+ I + R +YIPVA R  +++F V+++A +DPMYQ+SL++F  +F + I NS+++ +L++RI  +    T + Y+NV R LFEK KL+F+F+LC++IM   G I+  EW + L   GG      E P   W+S   W +++ +S+ +P FS+  +D  +   E  +   ++  + E      PLP                      G +D  L  FQKL++++    +K+   + +FV  NL  RF+EP   +L ++F+D +  +PL+FVLS G+DP     +FA+E K   K S+   G   G
Sbjct:  986 LKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININV-RPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYK-ATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLF--------------------QE---DLEITHMYSAEGEEVQLCFSIYPSSNVEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALE---AGNLRSQL-FPQLC-QQLSDLVALVRGKLSRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYW--TNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGM------YEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLRKLPPLLK-PYEEHFKALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFF-KPFLPREGLKKIPSEKLSRIVELIEPWFIFSLIWSVGATGDSSGRTSFSHWLRLKMENEQLTLLFPEEGLVFDYRLEDAGISGTNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIGPTGTGKTLTISDKLLKNLALD--YISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEEDRSWFDQLLKRCMEQW------EVTFNKVCPFQPILYGDFMSPGSDV--KSYELITSESKMMQVIEEYIEDYNQINTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVSTMRPYIQEQGL-QPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPELESSQEEIQ-GLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVPHTSEPTLIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLS--GGSISIMTENPAPDWLSDRAWRDILALSN-LPTFSSFSSDFVKHLSEFRVIFDSLEPHRE------PLP----------------------GIWDQYLDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQG 3710          

HSP 2 Score: 494.582 bits (1272), Expect = 5.551e-139
Identity = 262/599 (43.74%), Postives = 370/599 (61.77%), Query Frame = -3
Query:   75 YMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYY--PPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIA-AGGTGRTTDDIVYELADQILEKLIDKINPE---EAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPD-GVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK-YISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALIC 1844
            + +++ AISLGQGQGP AE MM ++ + G WVF QNCHLA SWM  LE +++    NP +VH +FRL+L+S+P+  FP+S+LQN  K+T EPP+G+RAN+ ++++ +   F  +    + ++ L+  +C FH   L+R+KFGPLG+NI YEF+D D    I  L MF  +   I +  L Y   EI YGGRVTD WD+RC+ NIL  F++P  +  ++ YS SGIY+  PP ++ ++ Y  ++ SLPL + PEIFG+H+NAN++F   ET  L+ TI+ +QP+ + AG  GR  ++IV ++   IL K+ + IN +      P L+         S+ TVL+QEV R+N+LL VI  +L  L KA+KG VVMS +LE +  +  NN VP LWS  AYPSLKPLS+WV DL  R      W+  G P  FW+ GFFFPQ FLTGTLQN+ARK+   ID +SF+F V                     + EA   L+  P  G  +HGL+++G RWD E  Q+  S   E+   + ++ ++P  + + +    Y+ P+YKT  RAG LSTTG STN+V+AV +PT Q    WI  G ALIC
Sbjct: 3696 FSKKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEHI--NPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVRANLLKSYSSLGEDFLNSCHKVMEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYNPDVLSPEHSYSASGIYHQIPPTYD-LHGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPKSSSAGSQGR--EEIVEDVTQNILLKVPEPINLQWVMAKYPVLYE-------ESMNTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFVISIDTISFDFKV---------------------MFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWLLPTPNRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALIC 4261          
BLAST of SMED30008756 vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 2112.04 bits (5471), Expect = 0.000e+0
Identity = 1130/2732 (41.36%), Postives = 1676/2732 (61.35%), Query Frame = -2
Query: 1813 FKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREITAIL----EDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVP-VFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDE-LKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSG-WIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKK-RPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFG 9969
            FK+EQ   +DL+ +  EL   Q +W+   +W+  +NEW    F+ L  E + T      + + +L K       +++   + K+EQ +  M +I++L NP L+ERHW Q+ D I  +F +  E  TL +++EL +  + E++ EIS  A+ E ++E  L+ + + W +T+  ++P+KD K    L GT+E+ Q  +D+ + ++T+ +SR V   +  VD W + L L  + IE  L  QR W+YLE+IF   DI++QLP+E+  F  V+ ++K IM ++ K   A+R+T  PGLLDT    N +L+ IQK L+ YLE+KR IFPRFYFLSND+LLEIL Q+RNP AVQPHL+KCFD I  L       P  +                  + + M S +GE +     +   G VE WLG VE+ M + LR LLR           +R++W+K  A Q+V+T  Q+ W  ++T  L    E   ++ L+ M   +V     LNK +  +RG L K+ R  + AL+T+ +HARD++ ++ K  + D+N F+W  QLR+YW+  LD+CV+R +N+ + Y YEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR +SGLAQ+GAW CFDEFNRI+IEVLSV+A Q++ I +A AA ++ F F+G EI LV +C  FITMNPGYAGRTELP+NLK++FRPIAM+VPD  LIAE+IL+ EGF + K LA+K+  +Y L  +QLS+QDHYDFG+RAL S+L  AG+ +R  PD  ++ VL+ ++RD N+ K    DA LF AI+QDLFP +ELP  DYG+ +  +E  I + GLQ  P  + KV Q YET   RH  M+VG TG GKT  + +L   LS+L  AG     P++  V+ + LNPK++++GELYGE +  T EW DG++  ++R  C D   D +W++ DGPVD LWIENMN+V+DDNK+L L N ERI +   V +LFEV+DL++ASPATVSRCGMVY D  +LGW P+V++WL     + K EV + L  MFEK I+  L F +  C + +     + I ++C+L  +L       N   D +     + + FVF  +W +  ++ E      D+++R   E  G    P++  ++  + D   R    +E  +P  +++    PF++++VPTVDT+R+ YL+  L+  +  +L  G  G GK+ +A+  L ++  +   V V +N SAQT+SN  Q +IE+++EK+ K V      K +I F+DDLNMP  D +GSQPP+EL+R + D+G +YDR K     I++M L AA GPPGGGR  +S RL   F + ++  P++  + +IF +++     DF ++V+     +  A +++YN +    LPTP K HY+FNLRD+SK  QG+L+ +      KS + +L+ HE  RVF DRL++  D   F  I+++    +F          K P IFGDF+K       ++YE LTD   +K ++ + L+++N++ S   M+LV F +AI+HI RI R+I Q RGN LLVG+GG+G+QSL RLA+ +  Y  FQIE+ + Y    F  D+K++Y   G+  + T F+F DTQI  E FLEDINNIL+SGEVP+L++PDE+E +       A+   V E + D +F + I RV+NNLHIVLC+SP+G  FR+  R +P+LVNC TI+WF+ WP+EALL VA+     VD+G  E +  K+A +   +H SVA+ S++   EL+RH Y TPT YLEL++ Y  +L EK+++L+ + ++++ GL KI ET E +  M +EL   + ++ + QK  E  +  +   + +AD  +  V  +     V+  + QA+AD+AQ+DL+EA+PALE A++AL++L+K DI EI+ +  PP  V+ VM++V +L G +  WA AK  LG+  F+K L ++ KDNI + +LKK+  Y   P+F  + + +VS A +SL +WVRAM++Y +  + VEPK+ R+  A  +L E    L + Q +L  V  K+  L+K YD  + +K+ L         +L+RAG L + LA EK RW E+V    E+LG +VGD  + AA ++Y G F ++YR E+++  WIG+  EL++P S    +   L +  ++R WN +GLP D  STEN I+VTRG RW LMIDPQ QA +WI+N E    LKII L   ++LR LE+ I  G P LL+++ E LDP L P+L K      GR L+ +GD ++EY+ +F+ YITTKLSNPHY PE   K TI+NF V  QGLE QLLG V R ERPELEEQ+++L+I I   K +L+  E+ IL+LL E+ G++LD   L+NTL+ SK+T+ E T+++  +E TE    +AR  Y P A R S+++FV+ +M  IDPMYQFSL  + +LF  +I+ S +S  LE+RI  L    T A Y    R LFE+ KL+FSF +C +I+  +G ++  E+ FFLRG   ++++ + + P   W++   W+N+ ++ D +  F  L+N   Q                            P +  +  +    E A  L G ++      Q++++V++  ++++  C+T F+  NLG+RF+EPP  ++  + +D +  SPLVF+LS G DP +   + A+   +  +  +   G
Sbjct: 1210 FKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKD-KGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKW-----------------EAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSI---LNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAG----DPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEK---RPKAEV-EPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVN-PADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLR---EIEGS--FPNKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLV-VNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFLK-----EPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESS-DSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITEL-DKLTNFHGLMNSFEQ---------------------------YPRDWHLWYTNAAPEKAM-LPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMAQRFHALSLG 3870          

HSP 2 Score: 392.889 bits (1008), Expect = 3.108e-108
Identity = 225/596 (37.75%), Postives = 338/596 (56.71%), Query Frame = -3
Query:   78 ERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKK-RSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDY-KYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIA-AGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDL-FHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKS-FWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK--YISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQES-NFWINMGAALI 1838
            +R  A+SLGQGQ P+A +++      G WVFL NCHL+ SWM  L+++V++ + E+P   H +FRL+LSS+P   FPIS+LQ S+K+T EPPKGL+AN+ R +  MS   F        ++KL+F +CFFHS++L+RKKF  LGWNI Y F+DSD E +   L ++  +     WDAL Y+ A I YGG VTD WD+R L   +  +F  +++   + + S    Y+ P+  ++  YK+++  LP ++ PE FG H NA+++ QI E Q L +T+L +QP+I      G+T ++ V ELA  + +K+ + I+ E  +  L   P      + L  VL+QE+ R+N L+  I  SL  L+K I+G +VMS  LE ++    +  VP LW   AYPS KPL+ W +DLAMR      W  +  P   FWL GF FP GFLT  LQ+ AR+ +  +D LS+EFIV                      ++    +  P DGV V GLY++G  WD +N  ++ +   +++ ++P +H  P  +   +S K  Y  P Y    RAG    +    +FV+ + L +   + + WI  G AL+
Sbjct: 3862 QRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDP---HPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIPEMIDYEGTQKLLALDP------SPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGK-AYPSQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIV--------------------STVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPA-ESRKKSAKGMYSCPCYYYPNRAG----SSDRASFVIGIDLRSGAMTPDHWIKRGTALL 4422          
BLAST of SMED30008756 vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 2112.04 bits (5471), Expect = 0.000e+0
Identity = 1130/2732 (41.36%), Postives = 1676/2732 (61.35%), Query Frame = -2
Query: 1813 FKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREITAIL----EDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVP-VFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDE-LKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSG-WIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKK-RPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFG 9969
            FK+EQ   +DL+ +  EL   Q +W+   +W+  +NEW    F+ L  E + T      + + +L K       +++   + K+EQ +  M +I++L NP L+ERHW Q+ D I  +F +  E  TL +++EL +  + E++ EIS  A+ E ++E  L+ + + W +T+  ++P+KD K    L GT+E+ Q  +D+ + ++T+ +SR V   +  VD W + L L  + IE  L  QR W+YLE+IF   DI++QLP+E+  F  V+ ++K IM ++ K   A+R+T  PGLLDT    N +L+ IQK L+ YLE+KR IFPRFYFLSND+LLEIL Q+RNP AVQPHL+KCFD I  L       P  +                  + + M S +GE +     +   G VE WLG VE+ M + LR LLR           +R++W+K  A Q+V+T  Q+ W  ++T  L    E   ++ L+ M   +V     LNK +  +RG L K+ R  + AL+T+ +HARD++ ++ K  + D+N F+W  QLR+YW+  LD+CV+R +N+ + Y YEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR +SGLAQ+GAW CFDEFNRI+IEVLSV+A Q++ I +A AA ++ F F+G EI LV +C  FITMNPGYAGRTELP+NLK++FRPIAM+VPD  LIAE+IL+ EGF + K LA+K+  +Y L  +QLS+QDHYDFG+RAL S+L  AG+ +R  PD  ++ VL+ ++RD N+ K    DA LF AI+QDLFP +ELP  DYG+ +  +E  I + GLQ  P  + KV Q YET   RH  M+VG TG GKT  + +L   LS+L  AG     P++  V+ + LNPK++++GELYGE +  T EW DG++  ++R  C D   D +W++ DGPVD LWIENMN+V+DDNK+L L N ERI +   V +LFEV+DL++ASPATVSRCGMVY D  +LGW P+V++WL     + K EV + L  MFEK I+  L F +  C + +     + I ++C+L  +L       N   D +     + + FVF  +W +  ++ E      D+++R   E  G    P++  ++  + D   R    +E  +P  +++    PF++++VPTVDT+R+ YL+  L+  +  +L  G  G GK+ +A+  L ++  +   V V +N SAQT+SN  Q +IE+++EK+ K V      K +I F+DDLNMP  D +GSQPP+EL+R + D+G +YDR K     I++M L AA GPPGGGR  +S RL   F + ++  P++  + +IF +++     DF ++V+     +  A +++YN +    LPTP K HY+FNLRD+SK  QG+L+ +      KS + +L+ HE  RVF DRL++  D   F  I+++    +F          K P IFGDF+K       ++YE LTD   +K ++ + L+++N++ S   M+LV F +AI+HI RI R+I Q RGN LLVG+GG+G+QSL RLA+ +  Y  FQIE+ + Y    F  D+K++Y   G+  + T F+F DTQI  E FLEDINNIL+SGEVP+L++PDE+E +       A+   V E + D +F + I RV+NNLHIVLC+SP+G  FR+  R +P+LVNC TI+WF+ WP+EALL VA+     VD+G  E +  K+A +   +H SVA+ S++   EL+RH Y TPT YLEL++ Y  +L EK+++L+ + ++++ GL KI ET E +  M +EL   + ++ + QK  E  +  +   + +AD  +  V  +     V+  + QA+AD+AQ+DL+EA+PALE A++AL++L+K DI EI+ +  PP  V+ VM++V +L G +  WA AK  LG+  F+K L ++ KDNI + +LKK+  Y   P+F  + + +VS A +SL +WVRAM++Y +  + VEPK+ R+  A  +L E    L + Q +L  V  K+  L+K YD  + +K+ L         +L+RAG L + LA EK RW E+V    E+LG +VGD  + AA ++Y G F ++YR E+++  WIG+  EL++P S    +   L +  ++R WN +GLP D  STEN I+VTRG RW LMIDPQ QA +WI+N E    LKII L   ++LR LE+ I  G P LL+++ E LDP L P+L K      GR L+ +GD ++EY+ +F+ YITTKLSNPHY PE   K TI+NF V  QGLE QLLG V R ERPELEEQ+++L+I I   K +L+  E+ IL+LL E+ G++LD   L+NTL+ SK+T+ E T+++  +E TE    +AR  Y P A R S+++FV+ +M  IDPMYQFSL  + +LF  +I+ S +S  LE+RI  L    T A Y    R LFE+ KL+FSF +C +I+  +G ++  E+ FFLRG   ++++ + + P   W++   W+N+ ++ D +  F  L+N   Q                            P +  +  +    E A  L G ++      Q++++V++  ++++  C+T F+  NLG+RF+EPP  ++  + +D +  SPLVF+LS G DP +   + A+   +  +  +   G
Sbjct: 1210 FKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKD-KGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKW-----------------EAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSI---LNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAG----DPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEK---RPKAEV-EPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVN-PADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLR---EIEGS--FPNKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLV-VNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFLK-----EPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESS-DSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITEL-DKLTNFHGLMNSFEQ---------------------------YPRDWHLWYTNAAPEKAM-LPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMAQRFHALSLG 3870          

HSP 2 Score: 392.889 bits (1008), Expect = 3.108e-108
Identity = 225/596 (37.75%), Postives = 338/596 (56.71%), Query Frame = -3
Query:   78 ERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKK-RSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDY-KYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIA-AGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDL-FHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKS-FWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK--YISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQES-NFWINMGAALI 1838
            +R  A+SLGQGQ P+A +++      G WVFL NCHL+ SWM  L+++V++ + E+P   H +FRL+LSS+P   FPIS+LQ S+K+T EPPKGL+AN+ R +  MS   F        ++KL+F +CFFHS++L+RKKF  LGWNI Y F+DSD E +   L ++  +     WDAL Y+ A I YGG VTD WD+R L   +  +F  +++   + + S    Y+ P+  ++  YK+++  LP ++ PE FG H NA+++ QI E Q L +T+L +QP+I      G+T ++ V ELA  + +K+ + I+ E  +  L   P      + L  VL+QE+ R+N L+  I  SL  L+K I+G +VMS  LE ++    +  VP LW   AYPS KPL+ W +DLAMR      W  +  P   FWL GF FP GFLT  LQ+ AR+ +  +D LS+EFIV                      ++    +  P DGV V GLY++G  WD +N  ++ +   +++ ++P +H  P  +   +S K  Y  P Y    RAG    +    +FV+ + L +   + + WI  G AL+
Sbjct: 3862 QRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDP---HPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIPEMIDYEGTQKLLALDP------SPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGK-AYPSQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIV--------------------STVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPA-ESRKKSAKGMYSCPCYYYPNRAG----SSDRASFVIGIDLRSGAMTPDHWIKRGTALL 4422          
BLAST of SMED30008756 vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 2061.19 bits (5339), Expect = 0.000e+0
Identity = 1222/3169 (38.56%), Postives = 1807/3169 (57.02%), Query Frame = -2
Query: 1837 PLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPV-INNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVE-LRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQ-VRMEPL-EREADVIKEMYDLIDAFNVPTPPEDFAVYQTLY-------PSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIV--------AQLEKGLPPNQ------------------------VVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLK---ARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIEN-SGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKL-KIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVG-----PGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVR----NKFEDN--------GDCRMPSQGDLWSSYADLHSR-KMDLWEKIVPVFKF-NKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFF--ADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKL-----PI--------IFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGV-SEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD---------------WASAKSVLGDPYFLKKLADYPKDNIPEALLKKLK-RYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDP-WISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYG 11043
            P+F  E       + F P  +  ++ +  +++R    + +VQ +   ++    + PV ++ +  E                  LH  ++    A+        K+  T+VE      +     +++  +T  +  + + E   ++        L+ +     M+ +D   +K  +    +   +++   +    RKE + +  E +  +      P  T + ++ ++++ + + V +E L  R  +  ++M   +D F  P   ED A+  T+        P  D     I+ A   ++   ++  A  +K I E+ +E + + +      +  ++    +V++  ++++ +   +Q   F  K  ++ FK E  +  +L+++   ++  Q  ++ + +W      W+   F+ LN E +     ++ + +         +L+K L   +                        +   + ++++  +E +  ++ L NP ++ RHW+QI +I+ Y  +  +   TL K+++LN+  Y E+ E IS  AS E SLE  +  +   W+   + +  ++D+  V IL   DEIQ + DD  I   T+  S  + P +  +  W   L    +TI+EWL  Q  WLYLE IF + DI +Q+P E + F +VD+ +++IM+   K P  + AT+  GLL+  +N N+LL++I K L AYLE KR+ FPRF+FLSNDE+LEIL++T++PL VQPHL+KCF+ I+KL+F             +P            DI AM S EGE+V L   +    ARG VE+WL +VE+ M  ++  ++  +   +    R +W++    Q+VL + QM W  E     ++V+    +G+  +  +    LN++  LVRG L K  R TL AL+T++VHARD+V +M+K  VS    F W  QLRYYW++  +N  VR+ N    Y YEYLG SPRLVITPLTDRCY  L+GA  L+LGGAP GPAGTGKTETTKDLAK+LA QCVVFNCSDGLDY  MG+FF GLA SGAW CFDEFNRI++EVLSV+AQQ++ I+ A   K+  F+FEG E+KL   C   ITMNPGYAGR+ELPDNLK LFR +AMMVP+Y LIAE+ LYS GF +++ L+ K+   Y+LCSEQLS Q HYD+GMRA+K+VLV AG LK + P++ ED++L+R+++D N PKFL  D  LF  I  DLFPG++LPE DY  F LE  +   N   LQ     + K+IQ YE + VRHG MLVG     KT V +VLA  L+ +N  G  EE    + V    +NPKSITMG+L+G+ + ++ EW DG++    R   +  + D +WV+ DGP+D LWIE+MNTVLDDNK LCL + E I+++P + ++FE  DLS ASPATVSRCGM+Y++P +LGW P V +WLNS+ G L + E    L G+F   I   L   + KC + +   +   + ++ RL E LL       P + ++ V        I   F+F  +W IGG+        FD F+R     K ++N         +C    +G ++    +L ++ +   W +++      +K++   ++IVPT+DTIR+ +L++  +   + +LF G TG GKSV  +  L N  E   Y P +IN SA+TS+N+ Q +I  +L+K+RK V G P  K+ IIFIDD+NMP L+ YG+QPPIELLRQ+ D G +YD    + IT+ D+ L AA GPPGGGRNPV+ R +RHF + SI + S+ ++ +IF+SI+  +    +FP +       IV   +EIY +   +LLPTP KSHY FNLRD S+ I+G L  +   V +K  + +LF HE  RVF+DRLIN +D+ +  Q+   +   +F E+     F  L     P+        +FGD+M P LE  +R+Y  + +     +++   LD++N      M LV F   ++H++RI R+++Q  GNALLVG+GG+G+QSLTRLA  M   + FQ E+ + Y  N +  D+K +    G+  Q TVFL TDTQI  E FLEDI+++LN+GEVP++F  DE + ++ G R  A+      E +   +F F +NR ++NLH+V+  SP+G +FR+R R FPSL+NCCTIDWF +WPE+AL  VA    E +++ E E + ++  +C   HTS+   SERF  EL RH Y T TSYLELI  +  +LT+K++ ++  + R  NGL K+      +  M++ELV L+P+LE+ + +   +MQ +  +  Q +  R  VK DE +A  KA+E QA+ ++ + DL EA+PALE A+ ALD L   DI  ++   NPP  V+ VM +VC++   K +               W  +K +LGD  FL+ L +Y KDNIP  +++K++  Y+ +P F    V K S A   L  W+ AM++Y +  K V PKK RL  A K L E M  L QK+AEL  VE+ +  LQ  +     EK ALE  + L + +L+RA +L   L  EK RW ++         N+ GDV + A  +AY GAFTS +R      W   C++ +IP SE   L   LGD  ++R WN  GLP D  S +N ++V   RRWPLMIDPQ QAN+WI+N E  NQL +IKLS+ +++RTLENCI+ G P LLE++GE LDP+LEP+LL+QTF + G   I LG+  IEYS DFK YITTKL NPHYMPE+  KV+++NF +TP+GLEDQLLG V   ERPELEE+RN LI++   +K QL+  E +IL+ L  SEGNIL+ E  I  L+ +K+ S E TK+   AE TE KI  +R  Y P+A   SV++F +A++A IDPMYQ+SL +F  L+ N+I +S KS+ LE+R++ L    T   Y N+ R LFEKDKL+FSF+LC  ++     I   E  F L   GG+  K  EK  DP W+    W  +   S+  P F  L     Q   E       I  ++E +++  P P                         D  L   QK+I+++    +KI   IT +V   LG +FVEPPP DL   + D +   PL+FVLS G+DPM    +FA +K + G
Sbjct:  324 PIFKIELTFDDDKMEFYPTFQDLEDNVLSLVERIAEALQNVQTI--PSWLSGTSTPVNLDTELPEHV----------------LHWAVDTLKAAVHRNLEGARKHYETYVEKYNWLLDGTAVENIETFQTEDHTFDEYTEFIEKFLSLASEIMLLPQWIHYTMVRLDCEDLKTGLTNKAKAFANILLNDIASKYRKENECICSEFEAIKEHALKVPETTEEMMDLISYVEKARTVGIEELILRIQESKRQMSYFLDVFLFPQ--EDLALNATVLMWPRKINPIFDENDELIENAKHKKE---NELMAKREKLILEIEKESRRMEEFTEFAELERMQQYVTDVRQLQKRIQESEEAVQ---FINKE-EELFKWELTKYPELDKLKVNIEPYQKFFNFVLKWQRSEKRWMDGGFLDLNGESMEADVEEFSREIFKTLKFFQTKLKKELQEKRKAARKRSLEEEKIEEEPKDNATITMCSTVMEQIKAFKEYIPTVSILCNPGMRARHWKQISEIVGYDLT-PDSGTTLRKVLKLNLTPYLEQFEVISAGASKEFSLEKAMNTMIGTWEDIAFHISLYRDT-GVCILSSVDEIQAILDDQIIKTQTMRGSPFIKPFEHEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQTVDRHWRDIMKFCAKDPKVLAATSLTGLLEKLQNCNELLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEF-------------LPNL----------DIKAMYSSEGERVELIALISTSAARGAVEKWLIQVEDLMLRSVHDVIAAARLAYPESARRDWVREWPGQVVLCISQMFWTSET----QEVISGGTEGLKKYYKELQNQLNEIVELVRGKLSKQTRTTLGALVTIDVHARDVVMDMIKMGVSHDTDFLWLAQLRYYWEN--ENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLVVFVFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNARPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKYPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADYHEF-LECAHEACNVHNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTKVLHVLADTLTLMNEHGYGEE----EKVIYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALSETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEPLVSSWLNSLKGPLCEPEYQALLRGLFAWLIPPSLNQRKKKCKELIPTSNSNVVVSLTRLFEVLLCNVVENDPTSKHIRV-------WIMACFIFSLIWSIGGSCDTDGRRVFDTFIRLIILGKDDENPVPDSVGKWECPFDEKGLVYDYMYELKNKGRWVHWNELIKNTNLGDKQIKIQDIIVPTMDTIRYTFLMDLSITYAKPLLFVGPTGTGKSVYVKDKLMNHLEKDQYFPFYINLSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCIIFIDDMNMPALEKYGAQPPIELLRQFFDCGHWYDLKDTSKITLVDIELIAAMGPPGGGRNPVTPRCIRHFNICSINSFSDETMVRIFSSIVAFYLRTHEFPPEYFVIGNQIVNGTMEIYKQSVENLLPTPTKSHYTFNLRDFSRVIRGCLLIERDAVANKHTMIRLFVHEVLRVFYDRLINDDDRRWLFQLTKTVIKDHFKESFH-SIFSHLRKQNAPVTEEDLRNLMFGDYMNPDLEGDDRVYIEIPNIHHFSDVVDQCLDEYNQTHKTRMNLVIFRYVLEHLSRICRVLKQSGGNALLVGLGGSGRQSLTRLATSMAKMHIFQPEISKSYGMNEWREDMKGLLRNVGMKGQKTVFLITDTQIKEEAFLEDIDSVLNTGEVPNIFAADEKQEVMEGVRPVAQAGNKHDELSPLALFAFFVNRCKDNLHVVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQSWPEDALERVAVKFLETLELTEVE-QQEIVPICKHFHTSIMDLSERFLHELGRHNYVTATSYLELIGSFRQLLTQKRQAVMEAKQRYMNGLDKLAFAESQVGEMQMELVELQPKLEEAKIENANMMQVIEIESVQVEAKRQFVKLDEEIASGKAEEAQALKNECESDLAEAIPALEAALSALDTLKPADITIVKSMKNPPSGVKLVMAAVCVMKDIKPEKISDPSGTGGKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVTVMQKIRSEYLMNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVAPKKARLSEAQKSLAETMELLNQKRAELAEVEHHLENLQMTFLEKTEEKAALEDQVELCAKKLERASQLIGGLGGEKSRWAQAADDLQITYENLTGDVLVSAGVIAYLGAFTSGFRQTCTKDWSMLCKKKKIPCSEEFLLSKTLGDPVKIRAWNIAGLPTDTFSIDNGVIVNNCRRWPLMIDPQGQANKWIKNSEKENQLSVIKLSDSDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLRQTFKQGGIDCIRLGEVIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKDIEKKILETLSSSEGNILEDESAIKVLDSAKMMSNEITKKQQIAEKTELKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLYINSIHDSNKSKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLARKEIEYQELMFLL--TGGVSLKSAEKNPDPTWLQDKSWEEICRASE-FPAFRGL----RQHFCEHIYEWREIYDSKEPHNAKFPAP------------------------MDKNLNELQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNCTIPLIFVLSPGADPMASLLKFANDKSMSG 3389          

HSP 2 Score: 488.804 bits (1257), Expect = 2.446e-137
Identity = 262/596 (43.96%), Postives = 363/596 (60.91%), Query Frame = -3
Query:   72 RVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNE---MSPQFFE-THVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVED--YKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYE-PESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1835
            + QAISLGQGQGP+A KM+ AA + G WV LQNCHLA SWM  LE+I +  +      + +FRL+L+S P+  FP+++LQN VK+TNEPP GLR N+ +++       P+FF+      L W KL+FG+CFFH+++ +RKKFGPLGWNI Y F++SD   +I  L +F  +   I ++A++Y+T E  YGGRVTD WD+R L  +L  F++   IVE+  YK+S SG Y+ P   T  +Y +F+  LP  + PEIFG+HEN ++S  +Q+T+ L  ++L  Q      G   +TD I+ E+   IL KL    + E A        E+    S+ TVL+QE++RFN L+  I+N+L  L+KAIKG VVM   LE++  +    +VP +W+  +YPSLKPL +++ D   R +    W   G P  FWL GFFF Q FLTG +QNYARKY  PID L +EF                      EVI +D   +SP DGV +HGLY+DG RWD E+G +       +  ++PI+ + P       +S  Y+ PLYKT ER G LSTTG STNFV+A+ L TDQ +  WI  G AL+C+
Sbjct: 3391 KFQAISLGQGQGPIAAKMIKAAIEEGTWVCLQNCHLAVSWMPMLEKICEDFTSET--CNSSFRLWLTSYPSSKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPVSDPEFFKGCRGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYN-LYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHPEIFGLHENVDISKDLQQTKTLFESLLLTQGGSKQTGASGSTDQILLEITKDILNKLPSDFDIEMALRKYPVRYEE----SMNTVLVQEMERFNNLIITIRNTLRDLEKAIKGVVVMDSALEALSGSLLVGKVPEIWAKRSYPSLKPLGSYITDFLARLNFLQDWYNSGKPCVFWLSGFFFTQAFLTGAMQNYARKYTTPIDLLGYEF----------------------EVIPSDTSDTSPEDGVYIHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTRHWIKRGVALLCQ 3957          
BLAST of SMED30008756 vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 893.264 bits (2307), Expect = 0.000e+0
Identity = 722/2683 (26.91%), Postives = 1261/2683 (47.00%), Query Frame = -2
Query: 1858 GLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIEL--NVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVV--LPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEW---VKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQK----VPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEA---YLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVR-GVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNP---GYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDN---FVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHV--KQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAV--LGAPTNK-RVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPG-GGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGD-------FMKPGLEKHERLYEP--LTDF----AKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLG-QKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPN--FTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQ--WNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIP-VFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFA 9768
            G   +  V ++KD VE  +E  S +       L   HW ++   +      + EKL    L+ +  N+ +  ++L++++ +A  E ++   ++++      TE+ +    H + +++ I+    E      DS   + ++ SS +      +   W   + +LD+F   + E    QR W+YLE IF     +  LPSEA  F  VD  Y+ I+  V K    V L  R +    L        Q++DQ+ +C +A   +LE KR  FPRFYF+ +D+LLEIL Q+ NP  +Q H++K F  I+++ F         SS G               I++M+S EGE V L K ++    VE WL ++ + M   L+ L  Q++ +      +  L  + +Q++   E++ +   I        E  L G  D      Q L KL       V  K+    L +LI   +H  D+V +++  +   IN + WQ+QLR+Y  +     V+R  +S + Y YEY G   +LV TPLTD+CYL L  A+ + LGG P GPAGTGKTE+ K LA  + +Q +VFNC +G+D   MGR F+G+ + GAW CFDEFNR+D  VLS ++ Q+ TI+ A  ++     F G+ +++    A F+T+NP   GY GR ++PDNLK LFR + M  PD  LI+  ILYSEGF  +  LA+K+  +++L  + LS+Q HYD+G+RALK VL   G L+R   +K E  ++++AL  + L K    D+E F +++ D+F  V      +      +    +  G+++   Q+ KV Q YE +  R GV++VG  G GK+T++ +L + L               +P+K+   NPK++   +L G ++  T EW DG++    R    DTS  H W++CDG +D  W+E +N+VLDDN++L + + ERI+    V+ LFE   L  ASPATVSR GM+Y+  E++     V +WL   T  L  ++  ++   F             +C++ +    I+ I +        ++  G  +L     K        F+     G    +   N   F     F      D  +     + D   SY D  S+          V K   E       V T DT R+  ++   L    ++S L TG TG GK  + +    N  E+       +  SAQ+SS+   ++I+    +       +  P ++  +I+F+  +N+P  D YG+   + LL+Q   + GF+D + L W++I+++    +  P G G    +S RL       S+       L  I+ + LT    +  ++    +E I    V+IYN++ ++  PT +   ++F+ RDL+  +  +L+ +     D+  +  + C EA+R+F DRL    DK+ F +I+          N+ P S     +IF +        + PG         P  ++DF    AK  N     + +FN   + +  L FF   ID      R++    G+  L G  G G++   RL A M+    F   +   +    F  +LK        NN+H V +  D Q+    FL+ IN++L SG VP LF   E + ++     AA +A  +      + +F  +R+R+ +H+VL +    + F+      P+++  C + +   +   +L+ + K   E   I   +              ++          L  H    P  Y + +  +  +L  K+  L  R +R+K G++K+ E  + +A M+ +       L +KQ + +  ++ +      A+  +  +++ +A  + +    +         L E  P ++ A +A+ ++    ++EIR    PP+ V+ ++++V L +G   T W + +  L        + ++  + I   + KK+   +   +  F   N ++ S A   L  WV+A   YSK ++ + P +       K L +   ++      L +V+  + EL++ ++  + E   ++ +L      ++ AG L  +L+ E ERW   +  F EE   +     + +A + Y G  +   R  LL      C+   +P     T   +   + E  Q  W ++GLP DQ+S EN  ++      PL+ID   Q + ++   + + + +  K ++ + +  +E  IR G   +++DI E  D AL PIL K    +  R +I  G   I+++ DFK+Y  T+       P   +++ I+NFT T   L  QLL     LE+PELEE+ ++L+      K +L+  E  +L+ L  S+GN+L++  L+++LN+SK ++   TK I E+E   +++T  +  Y+P++   S ++F  +N+   +PMY +S+     LF  TI++ +       R++ L  +  +  + +++RG+F +D+L+F+       M +  +    EWE F  G+   E          WIS +   ++  +   +P +F+N      Q+  + T  E + ++                       + ++ F K++    +L++  FQK++ ++    E++  C+ +FV   L    + PP  +L  +FQ+     P++F+L+ G+DP  +   FA
Sbjct: 1135 GSQTHMSVRLMKD-VEHFKEVSSALKFCRGDVLSADHWHEMFRFLGLPRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNE---IQRKWIYLEPIFG----RGALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSL-------EQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQF---------SSTG-------------ETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQAVAD-----AQPSLAKYPSQVLCLAEEVKFSASI--------ENNLNGSSDLNSFKSQLLEKLKAYTNMKVDDKVSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVN--GGIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTK-----------KPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTKDTSV-HHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKTTEDLHADMPSWIEEHF------------WRCLKWVRSHKISGITSFA------ILKNGLTHLKASKTKTQ------FLVLLFNGFLPTVTPENRQEFAKGVVFQGMSVPDPKNICYDERIDGIMSYTDDVSQN---------VTKEEVEREDLRPFVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLLKHCFQNDPESQ---LASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFDHN-LEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTYLTPILEEVGER---NSEIIANRMVDIYNKVQSNFRPTDSVV-FLFSPRDLTNWVVSLLRHE----LDQGKLEAVICFEARRIFADRLPTENDKLKFEEIL---------RNVIPISQANETVIFKEKVYVTTGTVVPGESNTGLPLTPINMSDFNQLLAKSINRFAFEIANFNCPLTSQ--LAFFCACID------RVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSEAANQASFT----GALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIPKIQMESQGITTTD--------------AILTGFNDVLVNLPEHLSIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGILDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLKS---MCKMFNMPP----TFKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFL--SKFLEKSETFKAAQPDLMTQIELAIRFGKTIIIDDIVE-FDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDKSS--TRVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPK--MFQPKEWELF-TGVLVDESTDLSALRVQWISPDRLQSLARIRTHLPSLFNNF-----QIQDDATWNEFSKTL-----------------------QCENAFPKNV----ELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFA 3626          

HSP 2 Score: 124.02 bits (310), Expect = 0.000e+0
Identity = 120/457 (26.26%), Postives = 207/457 (45.30%), Query Frame = -3
Query:  489 QAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRS-ENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETIN--EYKDFVD-SLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNV-AYPS-----LKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHL 1829
             +IS+GQGQ   A + +  +A  G+W+ L N HL    +  +  I K  S   P   HENFRL+L++     FP  +LQ S+K+T EPP G+R N+ R + ++     +     ++  + IF + + H+++ +R+ F P GW   YEF  SD   A   +    A+    W+ +  I   + YGGR+ + +D + L + L   F  + I  + +     +       T N  EY   +  S+P ++EP +FG+ EN   S+QI E  + I++I      +A G T     D   +++ QI+  L  K+   +  P    P      + ++ VL  E      L+  +  S+  + K++K   + S  ++    +    Q P+ W ++ A PS     L  +    +       S+    +  +P  F     F+P  FL    Q  +R+   P+D L
Sbjct: 3634 HSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLM---LQAVPSIFKHLSLTTP---HENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQI-----DRSTKNVITCQSIFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQLTANKA-DWEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKI--NGRAGSQLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSI----RTLALGDTKNALSDQSDKIS-QIV-SLWKKLCQSDDLPKRELPTAIRSADPISEVLCLETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSPIDF--SDLFYPNIFLNALRQTTSRQIKIPLDQL 4068          
BLAST of SMED30008756 vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 617.846 bits (1592), Expect = 4.049e-177
Identity = 372/1365 (27.25%), Postives = 691/1365 (50.62%), Query Frame = -2
Query: 2413 WEKIVPVFKF-NKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKR--KAVLGAPT--NKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGG-GRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQC-DPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDF--AKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGED--ELKVKLALMC-----------------TEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQK--TDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQ--DLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQN 6411
            W   VP  +  +  V   +++VPT+DT+R   LL   L   + ++  G  G GK++     L +  E      V +NFS+ T+        ++  E +R    V+ AP   ++ ++IF D++N+P  D YG+Q  I  LRQ  +  GFY     +W++++ +    AC PP   GR+P+++R LRH  +  +  P + SL+QI+ +         P  VRG  + +  A V++Y     +      + HYV++ R+L++ ++GI +   P        + +L+ HEA R+F DRL+  E++ +  ++V   A +YFG     +  +K P+++  ++        R  E L D+  A++K      LD         +KLV F   +DH+ RI R+ RQ +G+ LL+G  G GK +L+R  A++NG + FQ+++   Y    F  D++ +    G  N+   F+  ++ ++   FLE +N +L +GEVP LFE DE+  ++   +  A+  G+   + D ++++   +V  NLH+V  M+P GS  R R    P+L N C ++WF  W E AL  V       +D+     E  V+L   C                   +H +V K +E    +  R    TP  +L+ I  ++S+  EK+  L   +  +  GL KI ET E +  ++  L     +L++K++     ++++  DQ++A+  +   ++ +     + K+        + DL +  PA+  A  A+  + K+ + E++  ++PP  V+  +E++C+LLG+   TDW + + V+    F+ ++  +  + +   +LK++++YI +P++  + V + S AC  +V W RA  +YS  +  VEP +  L+   +E  +   + +     +  +E  I + ++ Y   + + + ++ +L     ++ R+ +L ++L  E++RW+   + F++++ ++VGD  + +A +AY G +    R E+   W        +     +  +  L    +  QW    LP D + TENAI++ R  R+PL+IDP  QA  +I  +     ++     + +F + LE+ +R G   L++D+ E  DP L P+L ++     GR LI +GD DI+ S  F++++ T+ S   + P+IC +VT +NFTVT   L  Q L +V R ERP+++++RN+L+        +L+  E  +L  L ES+G ILD   +I TL + K  +AE  ++ AE +    ++    ++Y  ++   S +Y  +  + EI  +Y +SL +   +F + ++  + S   D  +R++I+        +  V+RG+   DK++ + +L    +R N
Sbjct: 1558 WLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEME---VVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPA-VRGLADQLTNAMVDVY-LASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNYVPVTR--EELQDYVSARLKGFYEEELD---------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSN 2905          

HSP 2 Score: 556.984 bits (1434), Expect = 1.388e-158
Identity = 357/985 (36.24%), Postives = 538/985 (54.62%), Query Frame = -2
Query: 6856 VITNLLNPCLQERHWQQI--EDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFS-APDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARG-NVEEWLGKVEEAMFLNLRKLLRQSITEFDTLERE--------EWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWD----STLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNA-KAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKP-----EDV----VLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGL-------QINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNL-NAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVR--ITCVDTSQD-HQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPE 9699
            ++  L +  L+ERHW Q+  E  +N+  S+    LTLG++ + ++  ++  +++I   A  E +LE  L+++ E WQ  E V L +  +K   I G  D   +L +  N +++ +  S +    +     W + L+      + W++ QR W+YLE +FS + +I   LP E+  F ++      +M+KV   P  +      G     +    +L +IQK L  YLE +R  FPRFYF+ +++LLEI+  +++   +Q HL+K F  I+ +D  I E  +                     I A  S EGEKV L K +  +   + +WL  +E  M   L + L  S+T F  +  +        EWL     Q++    ++ WC E+   L D      +G  + E    + L  LA  V    P + R  + ALIT  VH RD   ++V  K+   N F W + +R+Y+D      +  CVV+M+NS + YG+EYLG   RLV TPLTDRCYL +  AL   LGG+P GPAGTGKTE+ K L   L +  +VFNC +  D++ MGR   GL Q GAW CFDEFNR++  +LS ++QQ+ TI+ A +A         G+ + +      FITMNPGY+GR+ LPDNLK LFR +AM  PD +LIA+V+L+S+GF +++TLA K+  ++ LC EQLS Q HYDFG+RALK VLV AG +KR+  DK      EDV    +LI+++ ++ +PK + +D  L  ++L D+FPG+    +     + ++  V +   L       ++    + KV+Q Y+   + HG+MLVG +G GKT  + VL K L    N  G+A           ++++ K+++   LYG ++  T EW DGL   ++R  I  V    D  QW+I DG VD  W+EN+N+VLDDNK+L L N ER+ + P V ++FEV DL  A+ ATVSRCGMV+   E
Sbjct:  434 LVAELKSEALKERHWHQMMKEMRVNWNLSD----LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYE-VELVNYQNKTRLIKGWDDLFNKLKEHQN-SLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAID--INEEDR--------------------SITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADG-----KGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVA-----------HVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEE 1374          

HSP 3 Score: 153.68 bits (387), Expect = 2.969e-36
Identity = 127/494 (25.71%), Postives = 216/494 (43.72%), Query Frame = -3
Query:  483 FKDLPKKKNYMERVQAISLGQGQG-PVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQ-----------WDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDY----KYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDV-QPRIAAGGTGRTTDDIVY-----ELADQILEKLIDKI-----NPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAP----KSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSF 1871
             +DL  + N   ++ +I++G  +G   A+  +  A K G WV L+N HLA SW+ +LE+  +  S  P   H  FRLFL++      P S+L+ S  V  EP  GL+AN+ R+ + + PQ            +L   +C+ H+++ +R ++ PLGW+  YEFSD+D   A   L     D V Q           W  L  + ++  YGG++ + +DQ  L  +L   F  K+  +D+    KY      + P     ++   +V+ L   + P   G+  NA      +  + ++  +L V    +A    G+      +     ELA Q L+ L  +I       E  K  LF   E+            EV+  ++LL  I+  L ++    +     + E  ++  +    +VP  W     P    +  W+ DL  R        + GA     ++FWL G F P+ ++T T Q  A+   + ++ L+ 
Sbjct: 3071 IEDLAVETN--RQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEK--RLHSMKP---HAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTER--SRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDA-AVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFER------------EVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQ--LIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNL 3540          
BLAST of SMED30008756 vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 617.846 bits (1592), Expect = 8.577e-177
Identity = 372/1365 (27.25%), Postives = 691/1365 (50.62%), Query Frame = -2
Query: 2413 WEKIVPVFKF-NKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKR--KAVLGAPT--NKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGG-GRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQC-DPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDF--AKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGED--ELKVKLALMC-----------------TEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQK--TDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQ--DLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQN 6411
            W   VP  +  +  V   +++VPT+DT+R   LL   L   + ++  G  G GK++     L +  E      V +NFS+ T+        ++  E +R    V+ AP   ++ ++IF D++N+P  D YG+Q  I  LRQ  +  GFY     +W++++ +    AC PP   GR+P+++R LRH  +  +  P + SL+QI+ +         P  VRG  + +  A V++Y     +      + HYV++ R+L++ ++GI +   P        + +L+ HEA R+F DRL+  E++ +  ++V   A +YFG     +  +K P+++  ++        R  E L D+  A++K      LD         +KLV F   +DH+ RI R+ RQ +G+ LL+G  G GK +L+R  A++NG + FQ+++   Y    F  D++ +    G  N+   F+  ++ ++   FLE +N +L +GEVP LFE DE+  ++   +  A+  G+   + D ++++   +V  NLH+V  M+P GS  R R    P+L N C ++WF  W E AL  V       +D+     E  V+L   C                   +H +V K +E    +  R    TP  +L+ I  ++S+  EK+  L   +  +  GL KI ET E +  ++  L     +L++K++     ++++  DQ++A+  +   ++ +     + K+        + DL +  PA+  A  A+  + K+ + E++  ++PP  V+  +E++C+LLG+   TDW + + V+    F+ ++  +  + +   +LK++++YI +P++  + V + S AC  +V W RA  +YS  +  VEP +  L+   +E  +   + +     +  +E  I + ++ Y   + + + ++ +L     ++ R+ +L ++L  E++RW+   + F++++ ++VGD  + +A +AY G +    R E+   W        +     +  +  L    +  QW    LP D + TENAI++ R  R+PL+IDP  QA  +I  +     ++     + +F + LE+ +R G   L++D+ E  DP L P+L ++     GR LI +GD DI+ S  F++++ T+ S   + P+IC +VT +NFTVT   L  Q L +V R ERP+++++RN+L+        +L+  E  +L  L ES+G ILD   +I TL + K  +AE  ++ AE +    ++    ++Y  ++   S +Y  +  + EI  +Y +SL +   +F + ++  + S   D  +R++I+        +  V+RG+   DK++ + +L    +R N
Sbjct: 2490 WLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEME---VVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPA-VRGLADQLTNAMVDVY-LASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNYVPVTR--EELQDYVSARLKGFYEEELD---------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSN 3837          

HSP 2 Score: 558.14 bits (1437), Expect = 1.198e-158
Identity = 357/985 (36.24%), Postives = 538/985 (54.62%), Query Frame = -2
Query: 6856 VITNLLNPCLQERHWQQI--EDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFS-APDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARG-NVEEWLGKVEEAMFLNLRKLLRQSITEFDTLERE--------EWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWD----STLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNA-KAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKP-----EDV----VLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGL-------QINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNL-NAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVR--ITCVDTSQD-HQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPE 9699
            ++  L +  L+ERHW Q+  E  +N+  S+    LTLG++ + ++  ++  +++I   A  E +LE  L+++ E WQ  E V L +  +K   I G  D   +L +  N +++ +  S +    +     W + L+      + W++ QR W+YLE +FS + +I   LP E+  F ++      +M+KV   P  +      G     +    +L +IQK L  YLE +R  FPRFYF+ +++LLEI+  +++   +Q HL+K F  I+ +D  I E  +                     I A  S EGEKV L K +  +   + +WL  +E  M   L + L  S+T F  +  +        EWL     Q++    ++ WC E+   L D      +G  + E    + L  LA  V    P + R  + ALIT  VH RD   ++V  K+   N F W + +R+Y+D      +  CVV+M+NS + YG+EYLG   RLV TPLTDRCYL +  AL   LGG+P GPAGTGKTE+ K L   L +  +VFNC +  D++ MGR   GL Q GAW CFDEFNR++  +LS ++QQ+ TI+ A +A         G+ + +      FITMNPGY+GR+ LPDNLK LFR +AM  PD +LIA+V+L+S+GF +++TLA K+  ++ LC EQLS Q HYDFG+RALK VLV AG +KR+  DK      EDV    +LI+++ ++ +PK + +D  L  ++L D+FPG+    +     + ++  V +   L       ++    + KV+Q Y+   + HG+MLVG +G GKT  + VL K L    N  G+A           ++++ K+++   LYG ++  T EW DGL   ++R  I  V    D  QW+I DG VD  W+EN+N+VLDDNK+L L N ER+ + P V ++FEV DL  A+ ATVSRCGMV+   E
Sbjct: 1366 LVAELKSEALKERHWHQMMKEMRVNWNLSD----LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYE-VELVNYQNKTRLIKGWDDLFNKLKEHQN-SLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAID--INEEDR--------------------SITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADG-----KGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVA-----------HVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEE 2306          

HSP 3 Score: 153.68 bits (387), Expect = 3.221e-36
Identity = 127/494 (25.71%), Postives = 216/494 (43.72%), Query Frame = -3
Query:  483 FKDLPKKKNYMERVQAISLGQGQG-PVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQ-----------WDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDY----KYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDV-QPRIAAGGTGRTTDDIVY-----ELADQILEKLIDKI-----NPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAP----KSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSF 1871
             +DL  + N   ++ +I++G  +G   A+  +  A K G WV L+N HLA SW+ +LE+  +  S  P   H  FRLFL++      P S+L+ S  V  EP  GL+AN+ R+ + + PQ            +L   +C+ H+++ +R ++ PLGW+  YEFSD+D   A   L     D V Q           W  L  + ++  YGG++ + +DQ  L  +L   F  K+  +D+    KY      + P     ++   +V+ L   + P   G+  NA      +  + ++  +L V    +A    G+      +     ELA Q L+ L  +I       E  K  LF   E+            EV+  ++LL  I+  L ++    +     + E  ++  +    +VP  W     P    +  W+ DL  R        + GA     ++FWL G F P+ ++T T Q  A+   + ++ L+ 
Sbjct: 4003 IEDLAVETN--RQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEK--RLHSMKP---HAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTER--SRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDA-AVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFER------------EVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQ--LIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNL 4472          
BLAST of SMED30008756 vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 617.846 bits (1592), Expect = 8.577e-177
Identity = 372/1365 (27.25%), Postives = 691/1365 (50.62%), Query Frame = -2
Query: 2413 WEKIVPVFKF-NKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKR--KAVLGAPT--NKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGG-GRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQC-DPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDF--AKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGED--ELKVKLALMC-----------------TEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQK--TDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQ--DLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQN 6411
            W   VP  +  +  V   +++VPT+DT+R   LL   L   + ++  G  G GK++     L +  E      V +NFS+ T+        ++  E +R    V+ AP   ++ ++IF D++N+P  D YG+Q  I  LRQ  +  GFY     +W++++ +    AC PP   GR+P+++R LRH  +  +  P + SL+QI+ +         P  VRG  + +  A V++Y     +      + HYV++ R+L++ ++GI +   P        + +L+ HEA R+F DRL+  E++ +  ++V   A +YFG     +  +K P+++  ++        R  E L D+  A++K      LD         +KLV F   +DH+ RI R+ RQ +G+ LL+G  G GK +L+R  A++NG + FQ+++   Y    F  D++ +    G  N+   F+  ++ ++   FLE +N +L +GEVP LFE DE+  ++   +  A+  G+   + D ++++   +V  NLH+V  M+P GS  R R    P+L N C ++WF  W E AL  V       +D+     E  V+L   C                   +H +V K +E    +  R    TP  +L+ I  ++S+  EK+  L   +  +  GL KI ET E +  ++  L     +L++K++     ++++  DQ++A+  +   ++ +     + K+        + DL +  PA+  A  A+  + K+ + E++  ++PP  V+  +E++C+LLG+   TDW + + V+    F+ ++  +  + +   +LK++++YI +P++  + V + S AC  +V W RA  +YS  +  VEP +  L+   +E  +   + +     +  +E  I + ++ Y   + + + ++ +L     ++ R+ +L ++L  E++RW+   + F++++ ++VGD  + +A +AY G +    R E+   W        +     +  +  L    +  QW    LP D + TENAI++ R  R+PL+IDP  QA  +I  +     ++     + +F + LE+ +R G   L++D+ E  DP L P+L ++     GR LI +GD DI+ S  F++++ T+ S   + P+IC +VT +NFTVT   L  Q L +V R ERP+++++RN+L+        +L+  E  +L  L ES+G ILD   +I TL + K  +AE  ++ AE +    ++    ++Y  ++   S +Y  +  + EI  +Y +SL +   +F + ++  + S   D  +R++I+        +  V+RG+   DK++ + +L    +R N
Sbjct: 2490 WLSKVPTMEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQEME---VVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPA-VRGLADQLTNAMVDVY-LASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNYVPVTR--EELQDYVSARLKGFYEEELD---------VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSN 3837          

HSP 2 Score: 558.14 bits (1437), Expect = 1.198e-158
Identity = 357/985 (36.24%), Postives = 538/985 (54.62%), Query Frame = -2
Query: 6856 VITNLLNPCLQERHWQQI--EDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFS-APDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARG-NVEEWLGKVEEAMFLNLRKLLRQSITEFDTLERE--------EWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWD----STLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNA-KAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKP-----EDV----VLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGL-------QINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNL-NAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVR--ITCVDTSQD-HQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPE 9699
            ++  L +  L+ERHW Q+  E  +N+  S+    LTLG++ + ++  ++  +++I   A  E +LE  L+++ E WQ  E V L +  +K   I G  D   +L +  N +++ +  S +    +     W + L+      + W++ QR W+YLE +FS + +I   LP E+  F ++      +M+KV   P  +      G     +    +L +IQK L  YLE +R  FPRFYF+ +++LLEI+  +++   +Q HL+K F  I+ +D  I E  +                     I A  S EGEKV L K +  +   + +WL  +E  M   L + L  S+T F  +  +        EWL     Q++    ++ WC E+   L D      +G  + E    + L  LA  V    P + R  + ALIT  VH RD   ++V  K+   N F W + +R+Y+D      +  CVV+M+NS + YG+EYLG   RLV TPLTDRCYL +  AL   LGG+P GPAGTGKTE+ K L   L +  +VFNC +  D++ MGR   GL Q GAW CFDEFNR++  +LS ++QQ+ TI+ A +A         G+ + +      FITMNPGY+GR+ LPDNLK LFR +AM  PD +LIA+V+L+S+GF +++TLA K+  ++ LC EQLS Q HYDFG+RALK VLV AG +KR+  DK      EDV    +LI+++ ++ +PK + +D  L  ++L D+FPG+    +     + ++  V +   L       ++    + KV+Q Y+   + HG+MLVG +G GKT  + VL K L    N  G+A           ++++ K+++   LYG ++  T EW DGL   ++R  I  V    D  QW+I DG VD  W+EN+N+VLDDNK+L L N ER+ + P V ++FEV DL  A+ ATVSRCGMV+   E
Sbjct: 1366 LVAELKSEALKERHWHQMMKEMRVNWNLSD----LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYE-VELVNYQNKTRLIKGWDDLFNKLKEHQN-SLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAID--INEEDR--------------------SITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADG-----KGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVA-----------HVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEE 2306          

HSP 3 Score: 153.68 bits (387), Expect = 3.221e-36
Identity = 127/494 (25.71%), Postives = 216/494 (43.72%), Query Frame = -3
Query:  483 FKDLPKKKNYMERVQAISLGQGQG-PVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQ-----------WDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDY----KYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDV-QPRIAAGGTGRTTDDIVY-----ELADQILEKLIDKI-----NPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAP----KSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSF 1871
             +DL  + N   ++ +I++G  +G   A+  +  A K G WV L+N HLA SW+ +LE+  +  S  P   H  FRLFL++      P S+L+ S  V  EP  GL+AN+ R+ + + PQ            +L   +C+ H+++ +R ++ PLGW+  YEFSD+D   A   L     D V Q           W  L  + ++  YGG++ + +DQ  L  +L   F  K+  +D+    KY      + P     ++   +V+ L   + P   G+  NA      +  + ++  +L V    +A    G+      +     ELA Q L+ L  +I       E  K  LF   E+            EV+  ++LL  I+  L ++    +     + E  ++  +    +VP  W     P    +  W+ DL  R        + GA     ++FWL G F P+ ++T T Q  A+   + ++ L+ 
Sbjct: 4003 IEDLAVETN--RQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEK--RLHSMKP---HAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTER--SRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDA-AVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFER------------EVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQ--LIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNL 4472          
BLAST of SMED30008756 vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 151.754 bits (382), Expect = 1.096e-35
Identity = 94/340 (27.65%), Postives = 181/340 (53.24%), Query Frame = -2
Query: 3595 TPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD-------------WASAKSVLGDPYFLKKLADYPKDNIPEALLKKLK-RYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEE 4572
            T    L++++    +  +K++++     + + G+ K+    E +A M+ EL+ L+PQL +   +T  LM  +  +    +  R+ V  +E  A   A + Q++  +++ +L  A+PALE+A++AL+ + ++D++ ++    PP  V+  ME+VC+LLG K               W S + +L D +FL K+  + +D + +  +K ++ +Y+    F  ENV++ S A   L  WV A+D+Y++  K VEPK++RL  A   + + + +L  K+  LL V  K+  L   +     +K+ LE  ++    R++RA +L  AL+ EK++W   ++    E
Sbjct: 2096 TRAEKLKMVSTITKLAKKKREEVRKTMTKYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKITYITHE 2435          

HSP 2 Score: 103.219 bits (256), Expect = 4.336e-21
Identity = 109/491 (22.20%), Postives = 211/491 (42.97%), Query Frame = -2
Query: 8245 CLQERHWQQIEDIINYKFSESEEKLT----LGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGG---TDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKV-QKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLK---ARGNVEEWLGKVEEAMFLNLRKLLRQSITEFD-TLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVK-CFQDLNKLAGLVRGVLPKLFR-ATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLG 9675
             +++RHW+ I      + SE+  K+     + +L+E+N  +  ++ E++  QA  E  LE  ++K++  W    +V   H+        GG   T E+            TI SS H   I   +  W+  L      +  +  C   W  +E +FS  DI  Q+P E ++F  +   +  I  ++ ++ P+  +      L         L  +++    AYL  KR +FPR + LS++ +L ++  +R P   + ++   F +++  D    +  K+E                    +  +S + E +SL K +    ++ +VE+W+ +++  +   LR  +R  I + +  L   E +     Q+     ++ +    T  +E+ +++    ++  E+K C +D          VL K  R   L  L  +   +  +V +++ E+V  I+ + W  QLRYYW   L+N  +R+      Y YE  G
Sbjct:  702 AMKDRHWKMI-----LQDSETSVKVEGNPLVSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTATFVT--HQ--------GGELLTTELNVQMQAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTTFD----QNTKME--------------------IISVSTKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILNEPIQVAAVYLKIAF----TWQMENSMKQNSLTILASELKICIRDCQ------HAVLHKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYWH--LENVFIRVGTVSTRYDYEVQG 1141          
BLAST of SMED30008756 vs. Ensembl Fly
Match: Dhc16F (gene:FBgn0283476 transcript:FBtr0074509)

HSP 1 Score: 2832.74 bits (7342), Expect = 0.000e+0
Identity = 1538/3465 (44.39%), Postives = 2143/3465 (61.85%), Query Frame = -2
Query: 1801 GETNIPK---IISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNV-IKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDR---ERFQEGITEVIKRFQN----TVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFD---YKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEER-----LQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLN-SMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENI----EPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFN-MASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEG-NRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRG-IGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPP-PTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 12111
            G + IP    II+ +R  P+  F+Y+ + L      +  Y+L+ V Y ++   E FY V+ +G T     +      LD+++ E++ +  + +I +F+ FR+WK F  W K IK+ K ++   +L N+LFI+   L  A+L +R    ++  +    V     +    F+   +    ++    T+FRE + + I  AC  ++   GF+PDD         NY         ++                 ++ ++A KR  C+ LTNF+   D ++   ++ +   S   L            T+ E+               ++++   E  +         IE  +P ++ ++    P F+         L  LPDR   E  ++ I  + +R       TVL +     D +F  +T+P I  + EE      P +  +   D             I  A+     Y   F ++R+ +E + STD   + T + D++  R    RY   +R    I E   +G++ +  T  K  + P   R  +V+   LP +A +E   L +E+QD    +C EP  T++ V  + FL +    ++ +    D + ++  +I  F +P   +    Y      ++R +  +++    R   I++   ++  DIA L+ ++ ++      P +LD  +N+  V  +L+ +   +N+ +  A  +  YQK F+++    +++     +++++Q L+ +  +W+    EW+  +F  LN  D+    +K +K   Q +K LP N +VPVL+   E  +EK+ VI  L NP L+ RHW +IED++N KF + E+ + +    +++ FD     E L +IS QA+ E  LE +LK +E  W+ TE  ++PH D+KDVFIL GT+E+Q + DDSN+N+ TIA+S+ VGPIK +VDEW+  +D F KT E W++CQ  W+YLE+IF++ DIQRQLP EAK F +VDKS+KE +R+ +KV LA+   ++  +      NN+LLD I + LEAYLE KRV+FPRFYFLSNDELLEILAQTR P AVQPHLRKCFDAI +L+F        E  DG        ++  TNDI+A +SPEGEK+  GKGLKARG VEEWL KVEEAMF++ ++ +R     +   ERE+W + H NQ+VLTV Q+ W  +I  I E   +ER     L+ M  FE+KC +DL  LA L R  +  L R  LCALIT++VHA+D V  +++++V   + F W K LR+YW    +    RM+ +   Y YEYLG    LV+TPLTDRCYLCLMGA Q+DLGGAPAGPAGTGKTETTKDLAK+LAKQCVVFNCSDGLDYKMMGRFFSGLAQ GAWCCFDEFNRIDIEVLSVIAQQLITIR AKA ++ RF+FEGREIK+  +C  FITMNPGYAGRTELPDNLKALFRPI+MMVPDY LI+EVILYSEGFE  K LA+KM QMY+LCS+QLSQQ+HYDFGMRA+KSVLVMAG LKR +P++ ED+ LI ALRDSN+PKFL  DA LFR IL DLFPGVELP+  +   +  +   +    LQ  P+ + K +Q YET+ VR GVMLVGPTGGGK+ V + L   LS+L    + +  P+++PV +  +NPK++TM ELYG V+  TLEW DGL+   VR       + HQW++CDGPVDA+WIEN+NTVLDDNKMLCLANSERIKLT ++HMLFEVQDL  ASPATVSRCGMVYVDP +LGW+P + TW    M  KL   + ++ Y +F  Y D  LK  + + + T+ QV  +K++  C L  +         ++ +  K    +   F +  LW I  NL ++   SF+         + +  +P+   LW+   DL       W  I+  F F+ E  +++M VPTVDT ++GY+ + L      V+ TG TGVGK+V+A   +  +S+    +PV +NFSAQTSSNRTQEMIE  LEK++K  LGAP  K VI+FIDD+NMPKLDTYG+ P IELLRQ+ DF GFYDR+KL W  I D+ L  AC PPGGGRNP++ R +RHFA+FS+P P+E +L QIF  IL GF   F   VR  +E +V A V++Y R+ T +LPTP KSHY+FNLRDLSKCIQGILQ        ++ + +LF HE  RVFHDRLIN EDK  F  ++ E+   +F   +    EP      PI+FGDFM  G  K+ER+Y+ + D  K++++L+ Y+ D+N +A  K+MKL+ F DA++H  R+AR++R DRGN LLVGV G GKQSLTRLA+ +N YNC+QIE+ R YD N FH DL+ +Y   GI+NQ   FL  D+QIV EEFLEDINNILNSGEVP+LFE DE+E++I+  R    E    +   RD I++F INRVRNNLH+V+ MSPVG +FR RCRMFPSLVNC TIDWFT+WP EAL +VA      +   + E ++ LA     +H +V   S +FY E+KRHYYTTP+SYLEL+ LY ++L  K  +++ +R R+ NGL K+LETNE+IA M  EL  + PQL++K    ++L+  L  + +QAD V+  V EDE  AK KA   QAI++DA +DL+ AMPAL  A +AL  L K DI E++ FT PP +VQ  ME+VC+LLG K  WASAK+++ D  F+K+L +Y K+++ E  LKK+K+YID  +F     EKVSK  +S+ +WV +MD +SK  K VEPK KR E A  EL EVM  LRQKQ EL AVE KI  L+   +    E + ++ N+ LT  R+ RAG+LT+AL+DE+ RW E+V     +L  V GDV + AACVAY GAF+  YR ++ + W+ +CRE +IP S    L+ VLGD +E+RQWN +GLP+D +S EN I  TR  RW LMIDPQEQANRWIRN E  N L++IK+++   +R LEN +R G P LLE+I ET+DP+L PIL ++T+   GRT + LGD  I+Y  +FKLY+TTKL NPHY+PE+CI VT++NF VT  GLEDQLL ++  +E P +E QRN+L+++IN+DK QL   E+++LKLLF SEGNILD E+L+ TLN++K TS     R+ + E TE+ IT +R +Y  +A RG+++YFVVA +AEIDPMYQ+SLKYF  +F N +      Q +E RI  L+ +   A ++N++RGLFE  K++FSF+L + + RQ G +++ E+ F  RG +G I  K   +P    +S   W++ + + D    F + + D       + + E     N+E  D  +   P P+++                  ++ RL  F KL+ +  F + + +L +  +++  +G  F E    T L  ++ D S V+PL+FVLSTGSDPM+ F +F  + +   K  S   G   G
Sbjct:  151 GASLIPDLNLIINRMRNMPDDSFVYMDYMLPHDSEYFTPYSLREVEYKDLNTYEPFYTVTRHGVTFWHCSENF-FTPLDQWQQEFKQFLSIIQIRSFSIFRLWKGFKVWEKTIKWRKLNEARDYLQNNLFIVIPQLAKAILRMRSDIVQLQRLNFVNVSNIENWHPFYFLETHMRIYEQLHKTFTDFREFIAKTIFRACTDAIQARGFYPDDEV-------NYYPSLKKMREAH-----------------SFMDRARKRAFCKTLTNFLTYCDMMVYQMLYRITKKSFEDL-----------ATSFEV---------------HDEVGPSEADINKHDRVDKRIEKQRPQDKPQS----PFFLA-------MLRLLPDRIDIEPSEDIIRIIFQRITGLILETVLEIHPFTTDPFFTQYTQPSIMGRQEEVLYEGAPDLHYLLRADIRFQYNRKNMFVLIRKAYERARLYTQRFHQIRENFEIDNSTDPTVLNTER-DLQILRAYCDRYCNNVRALDGILEYVFLGLLKLTQTNFKDTVTPVCSRLQNVLATYLPKLAEEETTRLYEEAQDFHGRICYEPHETLEIVAHIRFLDKCSTELDGIFDGIDYVHDLLLIIKDFGIPIDDDSKEDYMDTEDYLNRTRETLEEIREKRQDFINRLEDAMQDDIAALKEDIHEVAIEALQPWLLDANSNRLSVTNKLDSMLERLNKCRETADEFLGYQKEFQIDLTMYDEMASGFYDIRMRQNLYRTWSDWEESLAEWIVSDFNTLNVVDMVELNSKTIKNCMQFQKYLPENNIVPVLQKSAEAFKEKLPVIGYLRNPNLRARHWAEIEDLLNRKFFQ-EKDILIQTYEDVHAFDDVAIGEALMQISSQATGEVQLENMLKGIETTWKETELSIVPHHDAKDVFILAGTEELQAVLDDSNVNINTIAASKFVGPIKSKVDEWINAMDQFAKTFESWMDCQGAWIYLEAIFASADIQRQLPHEAKMFFTVDKSFKETVRQAKKVALALPTMSSVDVHKVLVENNRLLDLISRGLEAYLEVKRVVFPRFYFLSNDELLEILAQTRIPQAVQPHLRKCFDAIYRLEFG-----SKEGGDG--------KMVATNDIVAFLSPEGEKLQFGKGLKARGAVEEWLSKVEEAMFVSCKRYMRFGYQCYPAKEREDWFQDHPNQVVLTVSQVQWAADIHRIYEG--KERNPLNILEKMAKFEIKCLKDLGALAALTRKNISSLLRKILCALITIDVHAKDSVRMLIEKEVCKASDFNWLKMLRFYWADETETVYSRMAAANIPYYYEYLGAGGVLVLTPLTDRCYLCLMGAFQMDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKMMGRFFSGLAQCGAWCCFDEFNRIDIEVLSVIAQQLITIRTAKAMRVKRFIFEGREIKINRSCCVFITMNPGYAGRTELPDNLKALFRPISMMVPDYALISEVILYSEGFEDPKILARKMVQMYQLCSQQLSQQNHYDFGMRAVKSVLVMAGALKRASPNQREDITLIAALRDSNIPKFLADDAVLFRGILSDLFPGVELPDSQHPHLEASLRLGLRQKNLQAVPTTIRKCLQLYETMCVRWGVMLVGPTGGGKSVVLHALEFALSHLFENEVQD--PNFRPVVIQTMNPKAVTMNELYGYVDLKTLEWQDGLLGLAVRTATTVEDEIHQWIMCDGPVDAVWIENLNTVLDDNKMLCLANSERIKLTAWIHMLFEVQDLLQASPATVSRCGMVYVDPGDLGWIPLIDTWREVDMKHKLPAPLAEFCYQLFVGYFDKALKIERKRAVYTIHQVLGSKVRLCCELNSAQFEAVKWSAMSEEQGK--ELVTKIFAWAVLWAIASNLKDAEKVSFEEQWSKAIAQHPNMTLPN-FTLWNYRIDLEKMDWGSWIDIMAKFVFDPETSYYDMQVPTVDTTKYGYVSDLLFKRGMPVMVTGDTGVGKTVLAISCMKRLSQ-GNVIPVILNFSAQTSSNRTQEMIEGPLEKRKKTQLGAPVGKTVIVFIDDVNMPKLDTYGASPAIELLRQFLDFKGFYDREKLYWKEILDVVLGCACAPPGGGRNPLTPRFVRHFALFSLPKPNEETLTQIFNGILRGFLQTFSSAVRALSEPMVNACVDVYMRVATVMLPTPDKSHYIFNLRDLSKCIQGILQASNLHYNQENQILRLFYHETTRVFHDRLINIEDKNIFKALMKEVCMDHFNRPVINDNEP------PILFGDFMVFGKPKNERIYDEIRDHTKLESVLNDYIADYNSVAVGKQMKLILFQDAMEHTVRLARLLRSDRGNGLLVGVAGMGKQSLTRLASHVNEYNCWQIEMRRNYDLNAFHEDLRVLYRIAGIDNQPVTFLLIDSQIVEEEFLEDINNILNSGEVPNLFEGDEFEKIILDARDGCNENRKDDPCTRDDIYKFFINRVRNNLHVVMSMSPVGDAFRRRCRMFPSLVNCTTIDWFTSWPTEALYSVALGLLTKI-APKMEDRISLASTTVFMHKTVEDASVKFYKEMKRHYYTTPSSYLELLKLYQNLLKIKNMEIIAKRKRIANGLNKLLETNEVIAVMGKELEVMVPQLDEKSAMMKSLVDNLTKETKQADAVKQSVLEDEMNAKEKAAVAQAISEDAGKDLEIAMPALREAEEALKGLTKADINELKSFTTPPALVQFCMEAVCILLGVKPTWASAKAIMADINFIKRLFEYDKEHMKEDTLKKVKKYIDHKDFVPAKFEKVSKVAKSMSMWVISMDKFSKVYKVVEPKIKRKEAAEAELKEVMTVLRQKQKELAAVEAKIQGLRDSLEEKQREFQVIQDNVDLTYGRINRAGRLTSALSDEQVRWRETVKSLTGDLACVPGDVLVAAACVAYLGAFSHEYRRDMSALWVSKCREHKIPSSPEFNLLKVLGDPYEMRQWNVDGLPKDNISIENGIYATRALRWALMIDPQEQANRWIRNMERANNLQVIKMTDSTMMRVLENAVRQGYPVLLEEINETIDPSLRPILQRETYRFEGRTYLKLGDMVIDYDDNFKLYMTTKLPNPHYLPEVCINVTLVNFLVTESGLEDQLLADIVAIELPAMEIQRNDLVVKINSDKQQLLALEDKVLKLLFNSEGNILDDEELVETLNDAKETSLIIAARLIDTEETEKVITASRERYRILASRGAILYFVVAGLAEIDPMYQYSLKYFTQVFCNVLRLDHPPQSVEVRISTLMTDELRAIFDNISRGLFENHKIIFSFLLALSVERQEGRVTEEEFLFLSRGPVGNIRTKI--QPAKIKMSQIEWDSCIFLEDNFSSFFSGLTDELDKPFFIQMQE-----NKEVFDFAQTNQP-PTDK------------------WNKRLRVFHKLMFISAFRKPRFLLNVVCYLQSTVGKYFTEASGGTQLSSVYLDTSAVTPLIFVLSTGSDPMSGFLKFTTQMQFTDKYYSISLGQGQG 3497          

HSP 2 Score: 555.444 bits (1430), Expect = 8.213e-158
Identity = 278/605 (45.95%), Postives = 391/605 (64.63%), Query Frame = -3
Query:   78 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGV---IQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYY-PPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSP--PDGVL-VHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALI 1871
            F     +  + ++  +ISLGQGQGP+AE +++ + ++G WVFLQNCHLA S+M  LE IV+  +    + H +FRL+LSSMP +TFPISVLQNSVK+TNEPPKG++AN+  A  ++   FFE H+    WR ++FG+C FH+++L+R+KFGPLGWNI YEFS+SDREC +  L  F    V   I W+A+ YI  +IT+GGRVTD+WD RCLR ILT F   + I  DYKY +   YY  P  +T+ EY  +V   P+LE+PEIFGM++NAN+ FQ +ET   INT+L  QPR AA       ++I  +   +I + L  KI  E     L   D KG++ SLT VL+QE+DRFN  L +I +SLV L KAIKG VVMSEELE+V+ A  +NQVP  W+  ++ S+KPL +++ D   R      W   GAP+S+W+ GFFFPQ FLTG LQ YAR+   PID L  +F V++    +E V +   E+    + +   + + P   D ++ VHG++++  RWD   G +  +  GE+   +P++   P ++  P + +Y +PLYKT++R+GVLSTTG STNF++AV L +  +  FWI  G AL+
Sbjct: 3474 FLKFTTQMQFTDKYYSISLGQGQGPLAENLIEKSLRLGHWVFLQNCHLATSFMQTLETIVRNLTLGITKAHVDFRLYLSSMPIQTFPISVLQNSVKITNEPPKGIKANVFGALTDLKQDFFEQHIQNGNWRAIVFGLCMFHAVLLERRKFGPLGWNITYEFSESDRECGLKTLDFFIDREVLDEIPWEAILYINGDITWGGRVTDYWDLRCLRTILTIFSSKRIIQPDYKYCRGDSYYRDPRKKTLTEYSAYVQGFPVLEDPEIFGMNQNANIVFQTKETAFFINTLLLGQPRSAADEGQAMENEIAQQTIARIQKALATKIKREPIHDTLSVLDAKGQVPSLTIVLVQEIDRFNIALGIIHDSLVNLSKAIKGLVVMSEELENVFKALLSNQVPASWAKRSFLSIKPLPSYISDFQRRIDFIQQWAENGAPRSYWISGFFFPQSFLTGVLQTYARRRVLPIDSLKIDFDVFE----RELVQQDFFEMHTNNMSDQKLYGNLPECTDAIINVHGIFIEAARWDLSKGGLCDANFGELFSRMPVVRFKPCLEISP-TVRYEAPLYKTQQRSGVLSTTGHSTNFILAVLLRSHNDPEFWIMRGTALV 4073          
BLAST of SMED30008756 vs. Ensembl Fly
Match: Dhc36C (gene:FBgn0013810 transcript:FBtr0304742)

HSP 1 Score: 1905.18 bits (4934), Expect = 0.000e+0
Identity = 1097/2797 (39.22%), Postives = 1616/2797 (57.78%), Query Frame = -2
Query: 1759 ELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN----QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGL---KARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQ-TMCRLLESLL-------VGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRM-----------------------PSQGDLWS-SYADLHSRKMDLWEKIV-PVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFF--ADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMA--------SKYFGENIEPESFIK----LPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLF---EPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD--------------WASAKSVLGDPYFLKKLADYPKDNIPEALLKKL-KRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSS--SYIFGSRTGTCCRK--NDGRCCENW 9921
            +LK  + L+D+  ++  +++ W+  +    +P+++    + + +I+ +L+K +  +    Q++  +K ++E  RE M +I  L NP ++ RHW+ + +II +    S E LTL K+IE  + +Y  + E IS  A+ E +LE  + K+   W+  E+ + P++DS   F L   D+IQ L DD  I   T+ SS ++ P +  + +W   L L  + ++EWL  Q  W+YLE IFS+PDIQ+Q+P E + F +VDK +KE+M++V + P  M       + D  K    LL+ IQK L AYLE KR+ FPRF+FLSNDELLEIL++T++P  VQ HL+KCF+ I+ L+F                    +E+    D+ AM S E E+V+L   +   KARG VE+WL ++E  M  ++   + ++   +  + R  W+     Q V ++    W  EIT   E   EE  + +  +  KC   +NK+  LVRG L    R TL AL+ ++VHARD++ E+V  +V D+  F+W  QLRYYW+   +N   RM N    YGYEYLG +PRLV+TPLTDRCY  L  AL L LGGAP GPAGTGKTETTKDLAK++AKQCVVFNCSDGLDY  +G+FF GLA  GAW CFDEFNRID+EVLSV+AQQ++TI+    +     +FEG  + L  TCA FITMNPGYAGR+ELPDNLKALFR +AMMVPDY LI+E+ LYS GF ++K L+ K+   Y+LCSEQLS Q HYD+GMRA+KSVL  AG LK    D+ ED++++R+++D NLPKFL QD  LF+ I  DLFPG  LPE DY  F    +   E    Q  P  + KV Q YE + VRHG+MLVG   GGKTT Y VLA+ L  +     +E +  Y      ++NPK+ITMG+LYG+ + ++ EW DG++    RI  +  S D +W+I DGPVDA+WIENMNTVLDDNK LCL + E I+L+   +++FE  DL VASPATVSRCGM+Y++P  LGW P V +W N++       V   L  M        L F   K ++ +A  S A +  ++    E  +             +L+  AQ    T  I F+F  +W +GG+L   + + F+   R   E      +                       P QG ++   Y      K   W+  V       +++P  ++I+ T +++R G +L+ L    + ++  G TG GKSV     +    + + Y P+ I+FSAQTS+N+TQ++I +KL+K+RK V G P N R +IF+DD++MP  + YG+QPPIELLR   D   +YDR  +  + + D+ +  A GPP  G N V+ R  R F + SI   +   L  IF+ I+        F ++   C + IV A + IYN    +LLPTPAKSHY+FNLRD S+ IQG+L   P    D + + +L+ HE  RV+ DRL+   D+ +  + +            S+ FG  +E +  ++      +I+ DF  P  +     Y  + D  +++ ++ +YL ++N  S K M LV F  AI+H++RI R+I+Q R +ALL+GVGG+G+QSLTRLA+ +  Y  FQ+E+ R Y    +H D+K I    G +  H VFLFTD QI  E FLEDI+N+LNSGEVP+LF   E  E +  +        +A  ++G+   +F F +   ++ LHIVL MSP+G + R+R R FPS+VNCCTIDWF +WPE+ALL V+       D+   E +  +  MC E HTS  + S +F++ L R+ Y TPTSYLELI  + ++L++K+  +   R+R   G++++    + +A M+ +L+AL P+L++  +     + K+  D + A+  R+ VK DE+ AK +A   Q I D+    L EA+P LE+A+ AL+ L   DIA ++   +PP  V+ VME+VC+L   K D              W  +K VL D  FL  L ++ KDNIP  ++KKL +R + +  F  + ++  S AC  L  WV A+  Y    K V PKK  L  A    +  M  L +K A L  VE  +A +QKI D  + +   L       + +L+RA +L + L  E+ RW+E+         +V GDV + +  V+Y G FT  +R + +  W+ +C    +  +    L  VLG+  E+R WN  GLP D  S E+AI++   RRWPLMIDPQ QAN+WI+N E  N+L +I+L++ ++ R +EN I+ G+P LLE+IGE LDP LE +L K  F + G   I LGDS IEY+  F+ Y+TTKL NPHY+PE+ +KVT++NF +T QGL+DQLLG     ERP+LE ++NNLI++  ++K  L+ TE++IL++L  +E NIL+ E  +  L+ +K  + + +++    E TE++I +AR  Y+P+A   ++++F +  +A IDPMYQ+SL +F  L+ ++I+N++K  D+  R+  L    T + Y N+ R LFE+DKL+FS +L I +M+ +  I + EW F L G  G+E   P K    W+ +  W+ +  ++++   F  L  D                   E +  ++P           KS  D+   K +   +D R++ FQKL+L++ F  +K+V  +  FV   LG RFV+PP  DL   F D     PL+F+L+ GSDP     +FA+++  +G +   S   G   G    K  ++G    NW
Sbjct:  751 QLKPYKTLFDAGQDFMDKWDLWMHSQVGSFDPDEIDGDVSNFYRIIQKLDKQMGDHPITMQLIQDVKAQIEAFREHMPIINTLGNPGMKARHWELVSEIIGFPIKVSPE-LTLEKIIEYQLDEYVPKFEAISESATKENNLERAMAKMVNEWEGVEFSISPYRDS-GTFKLAAVDDIQILLDDQIIKTQTMKSSPYIKPFEADIIKWEAKLMLLQEILDEWLRVQATWMYLEPIFSSPDIQQQMPEEGRRFSAVDKIWKELMKQVSQDPKVMVVVQIDKMNDKLKKAYSLLEVIQKGLNAYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQIHLKKCFEGIATLNFT-------------------EEL----DVTAMRSSEREEVTLVDVISTSKARGQVEKWLLELEIDMKKSVHHKVSEAFYSYLKMLRHVWVLTWPGQCVQSISLTYWTLEITECFES--EEPKENLAKYLQKCVLQINKIVDLVRGDLNTQNRITLGALVVLDVHARDVLAEIVANQVEDLQDFQWLCQLRYYWED--NNLDTRMINCSLPYGYEYLGNTPRLVVTPLTDRCYRTLFAALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRGINSGSPTLVFEGTTLTLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALISEIELYSYGFLTAKPLSVKIVATYRLCSEQLSTQCHYDYGMRAVKSVLKAAGALKLRYRDENEDILVLRSIKDVNLPKFLNQDIPLFQGITSDLFPGTVLPEADYVLFNKCTQMACERQNKQCTPFVLEKVQQLYEMIVVRHGLMLVGYPFGGKTTTYRVLAEALECMEKTDGSENKAIYT-----VINPKAITMGQLYGQFDAVSHEWSDGILAVNYRIFAISDSPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSNTTNLVFEPMDLEVASPATVSRCGMIYLEPSSLGWEPLVASWKNTLPAAFHT-VSKQLISMLISRFCPILLFILRKSLKEIAPTSDANLMVSLMNFFECFIDDFRDEKYVANVSDLDFRAQ----TEGI-FLFSCIWSLGGSLDADSREKFNIIFRALMEKTFPQSLYDTYGVPEDLYVESLAKPFIFPIPKQGSVFDYRYIKEGKGKWKPWQDDVNSAPPIPRDIPVNQIIIQTNESVRIGAVLDLLNRHGKPIMLVGPTGTGKSVYVIDYMLKKMDLSFYKPLLISFSAQTSANQTQDIIMSKLDKRRKGVFGPPLNSRFVIFVDDVSMPLKENYGAQPPIELLRMMLDHMMWYDRKNIVPMKLIDLQMIVAMGPPSTG-NTVTPRFQRFFNVISIDDFNNDILNTIFSKIVLWHLDTRGFSKEFDPCIDEIVGATLTIYNDAKLNLLPTPAKSHYLFNLRDFSRVIQGVLLSVPEATEDVNSMRRLWVHEVLRVYGDRLVEDADRSWLFENICSTVKSCFNTDPSRLFGRLVEKDKSLQESDFRQLIYCDFTNPKADTKN--YVEVQDLEELRRVVEAYLVEYNNMSKKPMNLVLFRFAIEHLSRICRIIKQPRSHALLIGVGGSGRQSLTRLASHICDYELFQVEITRLYGPYEYHEDIKAILRKIGASEMHGVFLFTDVQIKDESFLEDISNLLNSGEVPNLFTNEEKIEVQEKMAQIDKQRDKAVQTDGSPVALFNFFVTTCKDQLHIVLAMSPIGDALRNRIRKFPSIVNCCTIDWFQSWPEDALLAVSTRFLASEDLTALERRTAID-MCMEFHTSTQELSAKFFSRLHRYNYVTPTSYLELIQTFKALLSQKRNNITNNRNRYLTGISQLDIAAQQVAVMQEQLIALEPKLKEASEIVAEQVAKVTADSKLAEEQREIVKLDESAAKEQAAVAQEIKDECDAKLGEALPILESALAALNTLTTADIAVVKTMKSPPIGVRIVMEAVCILKDVKPDKVPNPSGLGTVEDYWGPSKRVLSDMKFLDSLLNFDKDNIPVEVMKKLAQRILSNEAFDPDKIKSASTACEGLCRWVIALTKYDVVAKIVAPKKLALAEAEATYNAAMKTLNEKLAMLAKVEANLAAIQKILDEQLRQYGILLAEHEACTKKLQRAQELISGLGGERTRWSETAKMLQASFKSVTGDVLISSGVVSYLGPFTIDFRVDQIRKWVTKCLNFGVTCTADFQLAVVLGEPVEIRFWNICGLPTDAFSIESAIMMKNARRWPLMIDPQGQANKWIKNYEKNNKLCVIRLNQADYTRVMENAIQFGLPVLLENIGEELDPVLESVLQKTLFKQGGALCIKLGDSVIEYNHSFRFYMTTKLRNPHYLPEVAVKVTLLNFMITTQGLQDQLLGITVARERPDLEAEKNNLIVQGADNKRMLKETEDQILEVLSSAE-NILEDETAVQILSSAKALANDISEKQVITEATEKQIDIARLSYVPIAEHSTILFFTIVELANIDPMYQYSLVWFVNLYMSSIDNTEKVDDIAARLLDLRNHFTYSLYVNICRSLFERDKLLFSLILNINMMKHDNRIDNAEWMFLLTGGVGLEN--PYKNPTTWLGVQNWDELCRLTNLTN-FKGLREDFN-----------------ENSAQWKPF-------FDSKSPQDN---KDIPKSWDNRVSVFQKLLLLRVFRPDKLVPAVLNFVSGELGERFVDPPQFDLMASFADSHCCVPLIFILTPGSDPTATLLKFAEDQG-FGTNRLFSLSLGQGQGPIAMKMIDEGVKMGNW 3471          

HSP 2 Score: 462.611 bits (1189), Expect = 1.139e-129
Identity = 257/610 (42.13%), Postives = 368/610 (60.33%), Query Frame = -3
Query:   66 RVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSEN--PYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNE---MSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVED--YKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGT-----GRTTDDIVYELADQILEKLIDKINPEEA---KPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMP--KMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQES--NFWINMGAALICENS 1835
            R+ ++SLGQGQGP+A KM+D   K+G+WV LQNCHLAAS+M  LE+I     EN  P   H +FRL+L+S PA  FP+ VLQN +K+TNEPPKGLR+NI R+        P+++E+     ++++LI+ +CFFH++I +R+ FGP+GWNI YEF+++D   +++ L MF      + +DAL Y+T E  YGGRVTD WD+R L+ IL  F+ P  I  +  Y   ++G+YY P F+ ++ Y +F   LP +  P IFG H NA++    +ET  L++  L  Q   A+          T +++V  +A  IL+KL    + + A    P L+H        S+ TVL+QE+ RFN LL+ I+ SL+ L+K IKG VVMS  +E+VY +    ++P +W+  +YPSLKPL ++V D   R      W   GAP +FWL GFFF Q FLTG  QNYARKY   ID L+F++          EVL   +  + G        LS P DGV V+G++++G RWD     +  S   E+   +P++ + P  ++D  PE   Y+ P+YKT ER GVLSTTG STNFVVA+ L  +  +  + WI  G AL+C+ S
Sbjct: 3444 RLFSLSLGQGQGPIAMKMIDEGVKMGNWVVLQNCHLAASFMPLLEKIC----ENLLPDATHPDFRLWLTSYPADHFPVVVLQNGIKMTNEPPKGLRSNILRSMISDPISDPEWYESCTQPRIFKQLIYSLCFFHAVIQERRYFGPIGWNIPYEFNETDLRISLMQLRMFLNQYETVNYDALRYLTGECNYGGRVTDDWDRRTLKTILDKFYCPAVIDLETPYYLDETGLYYVPVFKEVDLYLNFTRDLPQISAPAIFGFHANADIMKDQKETDMLLSHTLLTQDTSASSDDSGGSKALTPEEVVTNVATDILDKLPKLFDRDAALLKYPTLYH-------QSMNTVLVQEMVRFNVLLNTIRTSLITLRKGIKGLVVMSPAVEAVYKSVLIAKIPAMWAGKSYPSLKPLGSYVTDFLRRLEFLQHWFDHGAPSTFWLSGFFFTQAFLTGAQQNYARKYVISIDLLAFDY----------EVLTVEEPQRQG--------LSGPEDGVFVYGIFLEGARWDRTGKYLAESRPRELFDTMPLIWLKPLKRVDL-PERHNYLCPMYKTAERRGVLSTTGHSTNFVVAMLLLCNPNTPVSHWIIRGTALLCQLS 4023          
BLAST of SMED30008756 vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 1815.43 bits (4701), Expect = 0.000e+0
Identity = 1036/2781 (37.25%), Postives = 1606/2781 (57.75%), Query Frame = -2
Query: 1759 FKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTT---PGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFA-IAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREIT-AILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLN-VDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWE-KIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPL-TDFAK--VKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIG----------EDE-------------LKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYD---NSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDP--WISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK--NDGRCCENW 9969
            F V Q    DL ++  E+++ + +W+ + EW + +  W +  F K+N  ++        K    L K       +++      V+  R  + +IT L NPC++ERHW ++ D+I+  F E+ +  TL  +I L+   + E++++IS  A+ E  +E  +K +   W+   + +  + D   ++ +   ++  QL ++  + ++ + ++R V P    VD W K L    +T+E+ L  QR WLYLE+IF   DI++QLP EAK F ++ + ++ I  K+ +   A++AT     P LL+ F   ++ L+ IQ+ LE YLE+KR +FPRFYF+SND+LLEIL  ++ P  VQ HL+K FD + KL+   + +T     + GM                   S +GE V     +   G  E WL +VEE M + ++++L+ +      L   RE+W+     Q+VLT  Q+ W  E T +++   + ++ + +   + K  + L+KL+ + R  L K  R  +  LIT+ +H RD++  M K    D   FEW  QLR+YW    + CV+R +N+ + YGYEY G S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK +G+ FSGLAQSG W CFDEFNRI+IEVLSV+AQQ+++I  A + K    MFEG+ IKL  T   FITMNPGYAGRTELPDNLK++FRPI+MMVPD  +IAE +L+S+GF +++ LA+K+  +Y+L  +QLS+Q HYDFG+R++ ++L  AG+ +R+ P+  E+ ++  A++D N+ +    D  LF  I+ D+FPGV LP  DY  F + I      +GLQ     V KVI+ +ET   RH VM++G TG  K+  +  L      +N+   +     ++ V +Y +NPK++ + ELYGE N  T EW DG++  I+RI C D     +W++ DGPVDA+WIENMN+V+DDNK+L L NSERI +   V +LFEV DL+VASPATVSRCGMVY D  + GW PFV +WL  +  K   E  D+L   F+  +   L F + +C + +    +  + ++C+LLE  + G     +N ++ + L     + F+FC +W I  ++ E +    D+F+R    +   C  P +  ++  + D + R    W+ K++  +K + E PF+++IVPT DT+R+ Y++ KLL  +  V+  G  G GK+  A   +    +N  +  + +N SAQT++   QE IEN+ EK+ K        KR+I F+DD NMP  D YGSQPP+EL+RQ+ D+  +++R     I +Q+  L AA GPPGGGR  +S+R    F + ++  PS+ ++ +IF ++L      +P +VR     I L  + +Y  M + +LPTP KSHY+FNLRD+SK  QG+L+ +      K+   +L+ HE  RVF DRL++  D+ +F   + ++  K+F          K+P  FGDF  P     +  YE L  DF +  +KN L  Y    N      M LVFF +AI+HI RI R+I Q RG+ L +G+GG+G+Q LT+LAAF+     FQIE+ + Y    F  DLK +Y+ TGI  + T+F+F+  QI    FLE  NN+L++GE+ +LF+ DE++ +       AK+ GV     + ++ + I  VR+ LH+ LC SP+G +FRS  R +P+L++  T +WF  WP+EALL VA     H  IG          EDE             L+  +A + + IH+SVAK SE  YAE+KR+ Y T  +YL+L++ +  +L +K+ ++ T  +R++NGL+KI ET E ++ M  EL A   Q++   ++ E  +  +   + +A   ++KV  +  + +        +A  A+ DL+  MP ++ A+KALDAL+K DI+E++ +  PP  ++ VME+V +LLG++  W +AK VL +  FL  L ++ +D+I +  LK++  Y  +P    + V  VS AC+SL+ W+ A++ Y K  + V PK+++L+ A K L+E    L   + +L  ++  I EL +  +   N + E +A E  L     +L+RA  L  +L+ E+ERW E+V++ +     + GD  +  A ++Y GAF + YR ELL  W    ++L IP +  + +   L DA  +R+WN +GLP D +STEN ++VT+G RWPL+IDPQ QAN WI+N E  NQL  +     ++LR LE  ++ G+P LL+++GE LD A+ PIL +   +++G  L+   D  I Y+  F+ YITTK+SNPHY PEI  K TI+NF +   GLE QLLG + R E+P LEEQ++ L++ I  +K  L   +N IL+LL ES G++LD ++L +TL +S+ TS    + ++ AE+TE +I  AR +Y P + R S+++FV+ +M++IDPMY FSL  +  LF  +IE S ++Q + ERI+ +    + A Y N  RGLFE+ KL+FS  +  +I+   G + + E++F L+G G +  K  + P+    WIS   W+N+ ++ D +  F  +I+   Q H +   G    +  E+++                           L G ++ +L  FQK+ ++++   ++I  C+T+F+   LG R+V+PP  DL   F +    +PL+FVLS G DP       ++  K+  +  S   G        K   DG    NW
Sbjct: 1228 FNVNQPESIDLRKLDFEVRIVKNIWELIFEWQTNWEGWKKGYFWKMNINEMEDTALNLYKEFTTLNKKFYDRHWEMLEATTKNVDSFRRTLPLITALKNPCMRERHWNRVRDVIHVNFDENSKNFTLELIINLDFQAFSEDIQDISNPATMELQIENSIKNIATIWKKQSFEMAFYHDG--IYRIKNVEDCFQLLEEHMVQISAMKATRFVEPFITIVDYWEKTLSYISETLEKGLTVQRQWLYLENIFQGDDIRKQLPEEAKRFATITEEFRTISSKMFQAKTAVKATNLRPPPFLLNRFSRMDERLELIQRALEIYLEAKRQLFPRFYFISNDDLLEILGNSKRPDLVQTHLKKLFDNLYKLELKRVGKTLSRWQASGMH------------------SDDGEYVEFMMVIYIDGPSERWLKQVEEYMLVVMKEMLKLTRGSLKKLVGNREKWISLWPGQMVLTTAQIQWTTECTRSLIHCSMVDQKKPLRKLKKKQIKVLSKLSEMSRKDLTKTMRLKVNTLITLEIHGRDVIERMYKSNCKDTGHFEWFSQLRFYWHRESELCVIRQTNTEHWYGYEYTGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIWVIVTNCSEGLDYKSIGKNFSGLAQSGCWGCFDEFNRINIEVLSVVAQQIMSIMAALSTKALELMFEGQMIKLKHTVGLFITMNPGYAGRTELPDNLKSMFRPISMMVPDNIIIAENLLFSDGFTNTRNLARKVYTLYELAKQQLSKQYHYDFGLRSMVALLRYAGRKRRQLPNTTEEEIVYLAMKDMNVARLTANDLPLFNGIMSDIFPGVSLPTIDYSEFNIAIYEEFREAGLQPITIAVKKVIELFETKNSRHSVMIIGDTGTAKSVTWRTLQNCFYRMNSQRFS----GWEAVTVYPVNPKALNLAELYGEYNLSTGEWLDGVLSSIMRIICGDEEPTQKWLLFDGPVDAVWIENMNSVMDDNKLLTLVNSERITMPVQVSLLFEVGDLAVASPATVSRCGMVYNDYNDWGWKPFVNSWLQRLRIK---EFADFLRIHFDYMVPKILDFKRMRCKEPVRTNELNGVVSLCKLLE--IFGTKVNGINPINLELLEEMTRLWFMFCLVWSICSSVDEDSRQRLDSFIR----ELESC-FPIKDTVFDYFVDPNERTFLPWDSKLLSSWKCDFESPFYKIIVPTGDTVRYEYVVSKLLAEEYPVMLVGNVGTGKTSTAISVMEACDKNK-FCILAVNMSAQTTAAGLQESIENRTEKRTKTQFVPIGGKRMICFMDDFNMPAKDIYGSQPPLELIRQWIDYKYWFNRKTQQKIYVQNTLLMAAMGPPGGGRQTISSRTQSRFVLLNLTFPSQETIIRIFGTMLCQKLESYPNEVREMWLPITLCTINLYVSMISKMLPTPNKSHYLFNLRDISKVFQGLLRSEKELQNKKNFFLRLWVHECFRVFSDRLVDDSDQFWFVNTINDILGKHFEVTFHSLCPSKVPPFFGDFAHP-----QGFYEDLQVDFLRTFMKNQLEEY---NNFPGMTRMNLVFFREAIEHIVRILRVISQPRGHILNMGIGGSGRQVLTKLAAFILEMAVFQIEVTKKYKTGDFREDLKNLYKVTGIKQRLTIFIFSSDQIAEVSFLEITNNMLSTGEI-NLFKSDEFDELKPELERPAKKNGVLLTT-EALYSYFILNVRDFLHVALCFSPIGENFRSYIRQYPALLSSTTPNWFRFWPQEALLEVAS----HFLIGFPLNVVVSGKEDEKHRESLVISTEAILQRDIAYVFSVIHSSVAKMSENMYAEVKRYNYVTSPNYLQLVSGFKKLLEKKRLEVSTASNRLRNGLSKISETQEKVSLMSEELKASSEQVKILARECEDFISMIEIQKSEATEQKEKVDAEAVLIRRDEIICLELAATARADLEVVMPMIDAAVKALDALNKKDISEVKSYGRPPMKIEKVMEAVLILLGKEPTWENAKKVLSESTFLNDLKNFDRDHISDKTLKRIAIYTKNPELEPDKVAVVSLACKSLMQWIMAIENYGKVYRIVAPKQEKLDSAMKSLEEKQAALAAAKKKLEELQVVIEELYRQLEEKTNLLNELRAKEERL---RKQLERAIILVESLSGERERWIETVNQLDLSFEKLPGDCLLSVAFMSYLGAFDTKYREELLVKWSLLIKDLLIPATLELKVTYFLVDAVSIREWNIQGLPADDLSTENGVIVTQGSRWPLIIDPQMQANNWIKNMEERNQLMTLDFGMADYLRQLERALKEGLPVLLQNVGEYLDQAINPILRQSFTIQSGERLLKFNDKYISYNNSFRFYITTKISNPHYPPEISSKTTIVNFALKQDGLEAQLLGIIVRKEKPALEEQKDELVMTIARNKRTLIDLDNEILRLLNESRGSLLDDDELFSTLQKSRQTSVLVKESLSIAEVTEVEIDAARQEYKPASERASILFFVLMDMSKIDPMYVFSLAAYILLFTQSIERSPRNQLVHERIQNINEYHSYAVYRNTCRGLFERHKLLFSIHMTAKILSNAGKLLEEEYDFILKG-GIVLDKLGQAPNPAPWWISEQNWDNITEL-DKVSGFHGIIDSFEQ-HYKAWNGWYATTFPEQED---------------------------LVGEWNDKLTDFQKICVLRSLRPDRISFCLTQFIITKLGPRYVDPPVLDLKATFDESISQTPLIFVLSPGVDPAQSLISLSESVKMAQRMYSLSLGQGQAPIATKLIMDGIKDGNW 3926          

HSP 2 Score: 345.895 bits (886), Expect = 2.508e-94
Identity = 204/592 (34.46%), Postives = 319/592 (53.89%), Query Frame = -3
Query:   78 ERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECA-ILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTI-VEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWM-VQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK-YISPLYKTEERAGVLSTTGMSTNFVVAVPLPT-DQESNFWINMGAALI 1838
            +R+ ++SLGQGQ P+A K++    K G+WVFL NCHL+ SWM  L++++   +    ++H+ FRL+LSS P   FPIS+LQ S+K+T EPP+G+++N+KR +N ++    E       ++KL+F +CFFH+++L+RKKF  LGWN+ Y F+DSD E + IL L          W AL Y+ A + YGG +TD WD+R L   +  FF  + +    ++ S    Y+ P+   +  Y D +   P  ++P+ FG H NA+++  I ET+ L   +L +Q +  +  +    +  V++LA +IL    D+IN E+    +           L  VL+QE++R+NKLL  +   L  L++ I+G VVMS +LE +Y A +  +VP  W   AY SLKPL+ W +DL  R      W      P  FWL  + FP GF+T  LQ  AR    PID LS++F V                  F E   A   +     GV +  L+++G  W  +N  +   +  E++  LP++H  P  + +      Y  P Y    R+G         +FV+AV L + ++++++WI  G AL+
Sbjct: 3898 QRMYSLSLGQGQAPIATKLIMDGIKDGNWVFLANCHLSLSWMPTLDKMIA--TMQSMKLHKKFRLWLSSSPHPDFPISILQTSIKMTTEPPRGIKSNMKRLYNNINEANMENCSEPSKYKKLLFALCFFHTVLLERKKFLELGWNVIYSFNDSDFEVSEILLLLYLNEYEDTPWGALKYLIAGVNYGGHITDDWDRRLLITYINQFFCDQALQTRKFRLSTLPNYFIPDDGDVQSYLDQIQMFPNFDKPDAFGQHSNADIASLIGETRMLFEALLSMQVQTNSTSSNENGETKVFDLAKEILMNTPDEINYEQTAKII-----GINRTPLEVVLLQEIERYNKLLVDMSTQLRDLRRGIQGLVVMSSDLEDIYLAVSEGRVPLQWLK-AYNSLKPLAAWARDLIHRVGHFNSWAKTLRPPILFWLAAYTFPTGFVTAVLQTSARATKTPIDELSWDFYV------------------FVEEDTAAARIIREGGGVYIRSLFLEGGGWLRKNQCLQDPLPMELICPLPVIHFKPVENLKKRCRGVYQCPAYYYPVRSG---------SFVIAVDLKSGNEKADYWIKRGTALL 4454          
BLAST of SMED30008756 vs. Ensembl Fly
Match: Dnah3 (gene:FBgn0035581 transcript:FBtr0289982)

HSP 1 Score: 1776.14 bits (4599), Expect = 0.000e+0
Identity = 1077/2845 (37.86%), Postives = 1565/2845 (55.01%), Query Frame = -2
Query: 1786 NTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREK-------MSVITNLLNPCLQERHWQQIEDIINYKFSESEEKL--TLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLK---ARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYW---DSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNA---AGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVI--DYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFD------------NFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEK----IVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA-DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMAS--------KYFGENIEPESFIK----LPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAG-VSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVA--------------------KSSFEHVDIGEDE--------------LKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD-------------WASAKSVLGDPYFLKKLADYPKDNIPEALLKKLK-RYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 10026
             T+  L   A    + +   +++ +    L E+  +++  + LW +  E++  Y  W+ E F  LN + +  Q     KI+ +L + L  N   PV K   EQMR K       + V+ ++    L++RHW QI  I+  K +    KL  TL  +I++++     +LEEI+  A  E  L   L+ ++  W+   + VL ++DS D  IL   D+IQ L DD  +    +  S  +  +  + D+W   L L    I+ W   Q  W+YLE IFS+ DI RQ+P E ++F +VDK +++IM+   K    M AT  P +L+ F    + L+ + K L  YLE KR+ F RF+FLSNDELLEIL++T++P+ VQPHLRKCF+ I  L F           D M             +I+ M+S E E+V+L + +    A G VE WL +VE  M  ++++ +R++  ++  +ER  W+ +   Q+V  +  M W  E+   +E    + L   ++   K    +  L  LVR  L    R  + ALI ++VH RD+V  +   ++++I  F+W  QLRYYW   +   D   V M  +   YG EYLG  PRLV+TPLTDRCY  LMGAL+L LGGAP GPAGTGKTET KDLAK++AK+CVVFNCSDGLDYK +G+FF GLAQSGAW CFDEFNRI++EVLSV+AQQ++TI+ A   K+ +F FE   +KL  TC+ FITMNPGYAGRTELPDNLK LFR +AMMVPDY +I E+ LYS GF+ ++ L+QK+ Q YKLCSEQLS Q HYD+GMRA+KSVL+ +  L+R   D PE  +++RA+ D NLPKFL+QD  LF  I  DLFPGVELP    G     +   + +  LQ  P  + K++Q YE L VRHG+M+VG + GGKTT Y VLA+ L N++    A L E      PV   I+NPK+ITMG+LYG  + ++ EW+DG++    R        +  WV+ DGPVDA+WIEN+NTVLDDNK LCL + E +++T  ++M+FE  DL  ASPATVSRCGM+Y++P +LGW    K+++N +  K+ +  I       M E  +   L+F   +C Q +    I + QT  R     L      N     Q         F+FC+ W     L      +FD            NF + K+      +M  +  L+  Y    +     W+K          F +     E+IVPT +T    Y  E  +    ++L  G TG GKS +    L  + + A  V V INFSA+TS+   Q+ I +KL+++RK V G    K+  +F DD+ MP  DTYGSQ P+ELLR + D G + D      I + DMTL  A G  GG  N +  RL RH  + ++ +  + ++ +IFT+I    F+  +P++V   +  +  A V +Y       LPTPAKSHY F+LRD+++  QGI+   P  + D   + +L+ HE  RVF+DRL++ +D+     +  +           + FGE IEP   +       + +G++M+P  E   + Y+    + K++ ++  YL ++N  SS  M LV F  AI+H++R++R+++  RGN L+VG+GG+G++S  RLAA++       +++ + Y    +  DLKKI      N  HTVFLF+D Q   E ++EDIN ILN+G++P+L++ ++   ++      AK+ G + +     ++ + I+R+R  LHI L  SP+G SF+ R R++PSL+NCCTIDW+  WPEEAL  V                       S +  D  E+E              L+  L       H SV   SE+ Y EL R  Y TP++YLEL+  + +  T K  ++   RDR   GL K+      +  M+  L  L+P+L+   ++T+ +M  +  +  +A+  ++ V  DEA A   A   QAI DD + DL EA+PA+E A++AL+ L   DI  ++   NPP  V+  ME+VC++ G K D             W  +  +L D  FL  L  + KDNIP  ++K+++ +YI D +F  E ++  S AC  +  WVRAMD+Y K  + V PKK  L  A  EL + M KL  K+AEL  + +K+ +L   +     EKK LE  +     +L RA KL   L  EK RW+E+    +E + N+VGDV +   C AY G FT+ YR  +L  W   C+   IP SE  +L   LG    +R W+  GLP D  S EN I+VT   R+ L+IDPQ QAN+WI+N E  N LK+IK S+ N+++ LE  I  G P L+E++GE LD  L PIL K      G   I  GD  IEY+ +F+LYITT L NP Y PE+ + VT++NF +T QGL +QLL  V   ERP+L+E++  LII    +++ L   E++IL++L  SEGN+L+ E+ IN L+ SK+ S +  ++   A  TE +I  AR +YIPV+   ++++F ++ +A +DPMYQ+SL +F  LF NTI  + KS  L ER+K L    T + Y NV R LFEKDKLV S ++C+ I+   G +      FFL G  G  K  P  P   W+    W +V   +D+       + ++ QM              E  +D +       + + +Q            + H  +    F  LI++K+   +K+V  +  F+  NL   FVEPPP DL   F D S   PLVF+LS GSDPM     FAK++ +Y K  +   G   G    K
Sbjct: 1054 TTIENLSREAKAINTEETLLQIDVSAFPLLAEIIEKMEPIEKLWKTSYEFEKDYLIWMFERFECLNADGVREQVENMHKIMYKLSRQLAYN---PVAKRAAEQMRMKIEKFRVYLPVLDSICRHGLEKRHWDQISKILGRKVNP---KLFPTLKDMIDVDIMSILPQLEEIANAAGKEYDLNNGLRIMQADWRDVMFEVLQYRDS-DTHILASLDDIQTLLDDHIMRTQAMKRSPFITALGSKADDWEARLLLIQNIIDAWTQVQITWMYLEPIFSSEDIMRQMPLEGRNFKAVDKLWRKIMKHTLKDRHVMAATEYPEMLEVFTKAIEDLETVTKGLNTYLEQKRLFFARFFFLSNDELLEILSETKDPMRVQPHLRKCFEGIGSLTF----------DDNM-------------EIVEMVSDEEERVALVRKINPQLANGLVEMWLKEVEMVMLDSVKEQMREAWEDYAMVERISWVVSWPGQVVQGISCMAWTYEVEEAIE---TKELPAYLE---KSNLQIADLVQLVRTDLQAGVRIAVEALIVLDVHDRDVVKYLTDCRITNIQDFDWISQLRYYWKVNEKNEDWVCVSMVVTDVEYGMEYLGNLPRLVVTPLTDRCYRTLMGALKLCLGGAPEGPAGTGKTETCKDLAKAVAKKCVVFNCSDGLDYKALGKFFKGLAQSGAWACFDEFNRIELEVLSVVAQQILTIQRAIGRKVVKFFFEDTMLKLDPTCSIFITMNPGYAGRTELPDNLKVLFRTVAMMVPDYAMIGEITLYSNGFDMARNLSQKIVQAYKLCSEQLSSQSHYDYGMRAVKSVLLASASLRRLYVDLPEPEIVLRAIVDVNLPKFLEQDISLFIGIYMDLFPGVELPMPQRGDILKWLHINLADRNLQATPWYLEKILQIYEMLLVRHGLMIVGGSMGGKTTAYQVLAQTLRNVSTDEEATLKE-----FPVTFRIINPKAITMGQLYGRFDPVSHEWYDGVLAKTFREQVQGPKGERAWVMFDGPVDAVWIENLNTVLDDNKKLCLMSGEIMQMTKLMNMMFEPADLEQASPATVSRCGMIYMEPSQLGWRALHKSFINVLVNKVGLGDIYMTLFEDMTEWLVPAALEFL-PQCKQMLELSPIYQYQTFSRFFLHFLEKHKQFNQAWFQQ--------MFLFCFAWAYCSALTGQGQKTFDALLRKVIYGSNENFPKPKYFSLNRGQMFPEKLLFLDYRFDEAENWWTWQKSDDSASTTSNFPENAQISELIVPTKETGYISYWQEFCISKSYAMLVVGPTGTGKSAIITSNLLAMPKFANLVNV-INFSARTSAQMVQDTIMSKLDRRRKGVFGPSLGKKCTVFCDDVAMPSKDTYGSQAPLELLRTWLDHGYWSDLVDTTKIELVDMTLMCAMGTLGGS-NFIFPRLYRHMFVVAVDSFEDSTIVRIFTTIGDWHFSKGYPEKVALLSRGLSEAMVSVYRDAIRSFLPTPAKSHYSFSLRDITRVFQGIVMVPPKRMPDPEKLGRLWAHETYRVFYDRLVDQQDRDRLLVMAVDACKSNLRFPLEQAFGERIEPGEKLTDNDLRNLFYGNYMEPDAEP--KFYDEGDTYEKLEKLMKYYLREYNSFSSTPMDLVMFRFAIEHVSRVSRVLQMPRGNILMVGMGGSGRRSSARLAAYIADCRLMTVQVSKSYTITDWRDDLKKILMSASFNLNHTVFLFSDAQATDEGYVEDINGILNTGDLPNLYQLEDKATIMENMANVAKQLGKILDTLPSEVYAYYIDRIREQLHIALAFSPIGDSFKERIRVYPSLINCCTIDWYMPWPEEALSRVGVYFVSSMNLNRPHGEETQEPVQSKDAADPDEEEVRRETVGVEREQTQLEADLVDCVMYFHQSVVDASEKCYLELNRRNYVTPSAYLELLKAFRTFYTRKLDEITRLRDRYTTGLEKLDFAAGQVGEMQTNLYDLQPKLKVLSEETDRIMVNIERETAEAEKKKEVVGADEAAANEAAAAAQAIKDDCETDLAEAIPAMEAALEALNTLKPADIFIVKSMKNPPYGVKLTMEAVCVIRGIKPDRKPDPSGHMVEDYWGPSMRMLSDMKFLDSLKTFDKDNIPPPIIKRIREKYIADRDFVPEKIKAASMACEGICRWVRAMDVYDKVARIVMPKKAALAEAEGELSQQMEKLNAKRAELQVILDKLQKLNDFFAEKSREKKRLEDEIDNCEKKLNRAEKLLGGLGGEKTRWSEAAKNLHESISNIVGDVLLAGGCTAYLGYFTTEYRVNILDDWNALCKRKHIPSSETFSLATTLGHPMTIRAWSLAGLPADNFSVENGIIVTNSSRYSLLIDPQVQANKWIKNMEKNNNLKVIKQSDANYMQVLELAITFGQPVLIENVGEKLDSNLTPILEKNVIKHKGGLFIKSGDQMIEYNPNFRLYITTCLRNPRYPPEVMVMVTVLNFMITEQGLREQLLAIVVAHERPDLQEKKEQLIIESARNRDALYTIESKILEVLSTSEGNVLEDENAINILSSSKILSEDIQEKQVIAVATEIEIDAARQQYIPVSKHSAILFFCISELANVDPMYQYSLSWFLNLFVNTILKAPKSDQLSERLKNLNDYFTKSIYTNVCRSLFEKDKLVISLVMCLGILVSQGRVEKAALLFFLTGGIGY-KTIPPNPLGAWLPDKSWASVCKAADL-----EGLKNLPQMM-------------ETYSDEWHNFYDASNPDQLQLP----------APHNTVNDMYF--LIVIKSLRPDKLVPAVRAFITRNLDRSFVEPPPFDLAASFADSSPKIPLVFLLSAGSDPMASLFMFAKQRNMYDKLKTISLGQGQGPRAEK 3813          

HSP 2 Score: 430.639 bits (1106), Expect = 5.328e-120
Identity = 241/624 (38.62%), Postives = 355/624 (56.89%), Query Frame = -3
Query:   72 KKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNE---MSPQFFETHVL-----GLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADG-VIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVED-YKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTIL----DVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAK---PDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPD-GVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDY-----------EPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1856
            K++N  ++++ ISLGQGQGP AEKM+  AA+ G WV LQNCH+A SWM  LE I    +      H ++RL+ +S P+  FP+SVLQNSVK+TNEPPKGLRAN+ R+F     M  +FF    L        W + +F + FFH+++ +R++FGPLGWNI YEF++SD + ++L L MF      I +    Y+T E  YGGRVTD  D+R + ++L   ++P TI ED Y  SQSG Y  P   T     ++V S PL   PE++G+HENA+++  ++ET  LI+ +L    D+   + A  +G   +D    +  Q+L++L ++ N +E     P ++        NS+ TVL QE+ RFN+LLS I+ SLV + KA+ G + M  ELE  + +    ++P  W   +YPSLKPL ++V DL  R +    W+  G P  +W+ GF+F Q F+TG LQNY+RK  + ID +  EF V K                       +  +   PD G  + G++++G RW+ +  ++  S    +   LP++++ P +             EPE T Y  P+YKT ER GVLSTTG STNFV+ + L   ++   WIN G A +C+
Sbjct: 3790 KQRNMYDKLKTISLGQGQGPRAEKMIMEAARHGQWVVLQNCHVAISWMGDLERICNDTTLTDGANH-DYRLWCTSYPSAVFPVSVLQNSVKMTNEPPKGLRANMHRSFTSDPLMRDKFFTNAFLFSDSANKCWLRGVFALVFFHAVVQERREFGPLGWNIPYEFNESDLKISLLQLKMFINQSQSIPFRGHVYLTGECNYGGRVTDDKDRRLILSLLNMIYNPNTIEEDNYALSQSGTYRVPLSPTRLNSIEYVSSFPLSPHPEVYGLHENADINRNVKETNALISGVLLTQTDLMASVKASSSGGAKEDPAIAICKQVLKQLPEEFNIDEVSKTYPVIY-------TNSMNTVLRQELIRFNRLLSYIRKSLVNVGKAVVGQIAMIPELERTHASMVIGKLPADWLKKSYPSLKPLGSYVSDLLARLAFFQEWIDNGEPMVYWISGFYFTQSFITGVLQNYSRKNRFQIDMILIEFAVTK----------------------FEVQVPGTPDIGAYIRGIFIEGARWNRKTKEVDESFSKVLFDTLPVIYLRPVLKALEDLPRSTAGGEPE-TIYDCPVYKTSERRGVLSTTGHSTNFVMYLQLRCSRKPMHWINRGTACLCQ 4382          
BLAST of SMED30008756 vs. Ensembl Fly
Match: Dhc62B (gene:FBgn0013811 transcript:FBtr0303106)

HSP 1 Score: 1722.98 bits (4461), Expect = 0.000e+0
Identity = 1005/2719 (36.96%), Postives = 1526/2719 (56.12%), Query Frame = -2
Query: 1852 KIVAQLEKGLPPNQVVPV-----LKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLK---ARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGV-LPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDY-QPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKI-EVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNG---------DCRMPSQGDL------------WSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSI-LTGF-FADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEP-----------ESFIKLP----IIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRD------GIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD--------------WASAKSVLGDPYFLKKLADYPKDNIPEALLKKL-KRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKR--PEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKE 9792
            K   Q E   P    VP+     +   ++     + ++  + NP L++RHW+++ +I  +  +  +   TL K++   +    ++ E IS  A+ E  L   L+ + + W+   +   P+K++  V IL   D+IQ L DD  +    +  S  + P +  V  W + +    +T+++W   Q N+LYL  IFS+ DI  Q+P E + F+ V+++Y   M  V + PL M      GLL++ +  N+LL+ I   +  YLE KR+ FPRF+FL+NDE+LEIL++T++PL V PHL KCF+ I+ L+F  A+                       ++LAMIS + E +   + +    A G+VE+WL  VE+ M   +R     S   +  ++R EW+       VL + Q+ W   +   L       +  M++F  +  ++LN +  LVR   +  L R T+ +LI ++VHA+D+  +++K KVS    F+W  Q+RYYW+   D   VR+ N+   +  EYLG S RLVITPLTDRCY  L+GA QL L GAP GPAGTGKTETTKDLAK+LA QC VFNCSDGLDYK MG+FF GLA  GAW CFDEFNRI++EVLSV+AQQ++ I  A  +  ++FMFEG E+ L   C   ITMNPGYAGR+ELPDNLK LFR +AMMVPDY +I E+ LYS GF  ++ LA K+   Y+LCSEQLS Q+HYD+GMRA+K+VL   G +K++ PD+ ED++L+R+L D NLPKFL  D  LF  I+ D+FPG++LP  DY   + E + V     L+  PS +LKVIQ YE + VRHG MLVG    GK+    VLAKVLS L     A ++ +Y Q V+M I+NPKSITM +LYG  + ++ EW DGL+  I R   +  + D +WVI DGPVDA+WIENMNTVLDDNK LCL + E I ++  + M+FEV DL+ ASPATVSRCGM+Y++P  LGW  F K+WL     +    E + Y+  + +  +     F +  C Q +       + T   L +  +      N     + L      A +F  +WG+GG L  ++ + FD F++  ++ +          +   P++G L            W  + DL +++MD+ E    V            IVPTVDT R+ +LL+  +  K+ +L  G TG GK+V  +  L N  +   +   FI F+   S+N+ Q+++ +KL+K ++ + G P   + ++F+DD+NMP  + YG+QPP+ELLRQ+ D+G  YD    + + I ++ + AACG PGG R  V AR L HF ++SI   S+ S+ +IF ++ L GF  A   Q V   T  IV A   IY  + +++  TP+KSHY+FNLRD+S+ + G        V DK    +++ HEA RVF+DRL++  D+ +    + E     F + +E            E+   +     I+FG +        ER YE +       N+  + LDD+N     +M +  F  A+ H+ RI R+I     +AL++G+GG+G+QSLT+LA  M   + FQ E+ + Y  N +H D+K I +  G  N+HT FL T+ QI +E FL+DI+ +LN GEVP++F  DE + ++   R AA+      GNR+       +F F ++R +  LH++L  SP+G + R+R R++PSLVNCCTIDW+ +WPEEAL  +AK S   V++  +++K+ +   C   HT+ A+ +  F     RH Y T  S++ELI  + +++  K+ + +  + R   GL  + +    I+ M+ +L AL+P+L    + +  +M ++  +   A    ++VK DE VA V+A+  Q +  D +RDL +A+P LE+A+ AL+ L   DI  ++   NPP +++ VM +VC++ G   +              W  +K +LG+  FL  L ++ KDNIP  ++K++ K +I + +F  + V K S A + L  W+ AM +Y +  K V PKK +L  A KE  + M  L QK+A  LA+E K+A L    D +  E +  E +      +L RA  L   L  EK RW ++     E   ++ GDV +    +AY  A    YR E +  W  +  +L+IP S H ++  VLG    ++ W  +GLP D+ S+ENAI+     R+ L IDPQ QAN W++N E  N+L  +K ++ N+++ +   +  G P ++E++ E L+  L+PIL++QTFV+ G   I LG+S +  + +F+LY+T  L NPH++PE   KVT+INF +T   L DQLL  V   ERP+L+E R  L      +K  L+  EN ILK L  + G+IL++E  I  L +SK  S +  ++   A+ T  KI   R  Y PVA   S++Y+ + ++  IDPMYQFSL ++  L+  +IE + KS+DL  RIK L+   T   YNNV R +FEKDKL++SF+L  +I+   G +   E   F   +   ++    P  P   WI+  VW NV+ + ++  +    I D  + H+         S  E+Q     PLPP P ++                     +  +F+K+I++K    + + L +  F+  ++G ++V PP  D+   + D + ++PLVF+LS G+DP+     FA++
Sbjct:  748 KFKGQTEDPDPAKHPVPLRLCTSMIQSIKDFTTGVFIVNTMCNPALRKRHWKEMSEIAGFDVT-PDAGTTLRKILNSGLDPILDQFEIISIGANKELQLWNALQAMIKEWETRVFPYGPYKET-GVQILSSLDDIQALLDDHILKTLVMRGSAFMKPCEEEVRAWYEKIMRVNETLDQWGKVQANYLYLLPIFSSKDIVAQMPEEGRLFVIVEQTYTRNMGLVLRQPLVMETAPVSGLLESLQKANELLEDIATGVSNYLEKKRLYFPRFFFLANDEMLEILSETKDPLRVLPHLSKCFEGINSLEFDAAK-----------------------NVLAMISSDKETIEFIEQVSTAAAGGSVEKWLIGVEDEMLKAVRYQNELSFAHYPKVKRHEWVLEWPQMTVLAISQVYWASRVHGCLRRTFGGNMTIMMNFFQELSKELNDIVTLVRSPKISNLNRITIKSLIVIDVHAKDVSEDLIKNKVSSEFDFQWLAQMRYYWED--DKTWVRIINATVPFANEYLGNSDRLVITPLTDRCYRTLVGAYQLHLNGAPEGPAGTGKTETTKDLAKALAVQCKVFNCSDGLDYKAMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILLIIQAVRSNATKFMFEGTELTLNPACYVCITMNPGYAGRSELPDNLKVLFRSVAMMVPDYAMIGEISLYSYGFVDARKLAVKIVTTYRLCSEQLSSQNHYDYGMRAVKTVLSACGNIKKQYPDEVEDILLLRSLIDVNLPKFLSFDVPLFEGIISDIFPGIKLPHIDYSLVESEFKRVCLEEVLEPAPSFLLKVIQTYEMIIVRHGFMLVGEPLAGKSKTLQVLAKVLSALKIK--APQKSNYFQHVQMGIMNPKSITMNQLYGSFDPISYEWTDGLVAKIFRDFAMTPTPDRKWVIFDGPVDAVWIENMNTVLDDNKKLCLTSGEVITMSNEMSMVFEVMDLAQASPATVSRCGMIYMEPSTLGWRAFAKSWLKKADPRWADEEGVPYVMALMQWLLPPCQTFVRRFCSQFIKPGEFNCMLTTFDLFDMQIAEAIEENPEDYQKYLQTYFQAAILFALIWGVGGVLDTASREKFDVFLKKLWDTDPPPPEPLGKMEITPPTEGLLVDYVFLYKQRGAWRYWPDL-AKRMDVEETKTGV------------IVPTVDTARYIHLLKMHVEHKKRMLLVGPTGTGKTVYVQNYLMNKLDKEVFETGFITFTVMISANQCQDLLISKLQKWKRGIYGPPKGMQSVLFVDDMNMPVKEVYGAQPPLELLRQFFDYGHVYDLKDSSKVYIHNVLIMAACGLPGGSRQDVYARFLNHFNVYSINTFSDDSMFRIFLNVALNGFRRAGHGQDVFVVTNQIVSATQSIYKSVQSEIRATPSKSHYIFNLRDISRVVTGCTLVRKESVSDKKIFVRVWYHEAMRVFYDRLVDDVDRKWMFDKLNECLKANFKDKVETVFERYCVQGPDEAVFTMEAASNILFGVYFDEDSVPDERRYEEVPSVEVFLNLALTSLDDYNSTRRNKMDITLFTFALQHLNRICRIISIQGASALIIGLGGSGRQSLTKLATNMVQTSFFQPEITKNYGANDWHDDIKAILKEAGGMNKHTTFLITENQIKMELFLQDIDCLLNQGEVPNIFPIDEKQEVLEMVRLAAQ-----GGNRNIDVSALQVFSFFVDRCKQKLHMILSFSPIGDALRTRVRLYPSLVNCCTIDWYDSWPEEALQMIAKMSLVDVNVPSEDIKLAIMDTCQYFHTTAARSTRAFCQMTGRHIYQTNASFIELIRSFQTLIERKQSETMLAKMRYIGGLDTLAQAAAAISIMQRDLNALQPKLVALAESSRKMMLEINKETLAASAAAEQVKRDEEVASVQAEAAQVLKQDCERDLAKAIPVLEDALAALNTLKPADITLVKSMKNPPPVIKLVMAAVCVIKGIPPERIPDPASGKMVQDYWGPSKRLLGEMNFLPGLKEFDKDNIPTEIVKRIHKEFIPNKDFDPKVVAKASSAAKGLCQWIIAMMMYDEVAKVVAPKKAKLAGAEKEYADTMEFLAQKRALALALEEKVALLNIELDKANAEMQKTEEHAESCRNKLLRAEALIGGLGGEKSRWNKAAEDLQELYDHLPGDVLISCGIIAYLSAVNLQYRSECVKDWFKKVTDLKIPCSSHYSITDVLGLEVTIQNWQLDGLPNDEFSSENAIISANSSRYSLFIDPQAQANNWLKNMERKNRLNCVKFNQSNYMKVIAEALEYGTPVIIENVQEELEVPLDPILMRQTFVQGGIKHISLGESVVPVNPNFRLYMTCNLRNPHFLPETFNKVTVINFALTQNALMDQLLSIVVAKERPDLQELRITLTTEAAANKGALRDAENMILKTL-SAGGDILENEAAIQILADSKGLSKDIVEKQEAAKETVAKIEAFRLNYKPVAVHSSILYYSITDLPNIDPMYQFSLNWYINLYMYSIETANKSKDLPRRIKFLVDGFTRNLYNNVCRSIFEKDKLLYSFILTARILLGTGQV---EMRHFAHLVTNAKESTNIPPNPDPTWITETVWLNVLRLEELKELRG--IVDHFKSHLHAWQAIYDHSSPEKQ-----PLPP-PWQD---------------------KTTAFEKIIVLKALRPDSVFLAVRLFIAESIGDQYVTPPEFDISKSYADSTALTPLVFILSPGADPLGSLLAFAEK 3386          

HSP 2 Score: 420.239 bits (1079), Expect = 8.604e-117
Identity = 221/601 (36.77%), Postives = 356/601 (59.23%), Query Frame = -3
Query:   66 ERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHV----LGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVED-YKYSQSGIYYPPEFETINEYKDFVD-SLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAG--GTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMP-KMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENS 1838
            E  Q+ISLGQGQGP+A  ++  A ++G WV LQNCHLAASWM  LE + +  + + +    NFR++L++ P   FP+++LQN VK+TNEPP GL+ N+ R++N      +E +         + +L++GICFFH+++ +R+K+GPLGWNI Y F++SD + ++L L M       + +DA++Y+T+E  YGGRVTD WD+R +  IL  F + + + ++ Y+++    Y  P      E   ++D +LP L  PE++G+H N+ ++  +Q T+ L+++++ +    AAG  G G + + ++ +   QI  ++   ++ E A     +P +     S+ TV++QE++RF KL   I+ +   L   IKG +VM+ +LE+V TA   N++P  W + +YP LKPL ++V+DL  R +  + W   G P +FWL GFFF Q FLTG +QN+ARKY  PID L+F++                      +V++ +   S P DGV  +GLY++G RW+     ++      ++  +P++   P  +    E ++Y  PLYKT ER G LSTTG STN+VV + L T  +++ W+    ALIC+ S
Sbjct: 3391 ETFQSISLGQGQGPIATALIKNAQEMGYWVCLQNCHLAASWMPYLEYLWE--NMDTFNTTPNFRIWLTAYPTPQFPVTILQNGVKMTNEPPTGLKENLMRSYNSEPINDYEFYTGCAKQDRAFTRLLYGICFFHAVVQERRKYGPLGWNIAYGFNESDLQISVLQLSMLLNQYDHVPYDAISYLTSECNYGGRVTDNWDRRLIVTILADFCNAQAVTDNRYRFASDDRYILPRKTEHREILRYLDENLPSLAPPEVYGLHANSGITRDLQTTKTLLDSMILLLGSEAAGSAGAGVSVEQVILDTIKQIEREMPADMDIEAAAEK--YPVDYNE--SMNTVVVQEMERFLKLQKEIRTTCRDLAMGIKGIIVMTPDLENVMTAMKFNRIPTKWMSKSYPCLKPLGSYVQDLYKRLNWLHDWHHHGKPPTFWLSGFFFTQAFLTGAMQNFARKYKIPIDTLTFDY----------------------DVLKVETKTSPPDDGVYCNGLYLEGARWEWRENTLVEQFPKVLIYAMPVIFFRPVGLVDVVEGSRYRCPLYKTAERKGTLSTTGHSTNYVVPLLLNTHVKASHWVKRSVALICQTS 3963          
BLAST of SMED30008756 vs. Ensembl Zebrafish
Match: AL807739.1 (dynein, axonemal, heavy chain 6 [Source:NCBI gene;Acc:100148193])

HSP 1 Score: 4293.42 bits (11134), Expect = 0.000e+0
Identity = 2089/3434 (60.83%), Postives = 2624/3434 (76.41%), Query Frame = -2
Query: 1801 PKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSY-RPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 12096
            P I+  +R  P + F YLT ++ K   N+  YNLK+ ++ N+ K D+Y VS +  TH   G E+D + L+R+E EY+ + K+ +IP F  FR WKAF  WR  ++Y K  +C + L  +LF++N SLRPAL+++REMC+ ISDM LC++EK  T+TL +F  AQ  QL EV+S+L +FRELV EV R+ACR +L E G            TP+YGE            ++ + V+ + P+K+TYT+QANK  HC+RLT FIRLADYLIVNT H+L VNSV  LL    + +  TP+   I ++     E+  + D               IK ++ ++I    +       P+FITE +L   +L + P  E FQE + E+I +F+ TVLS+  LV DTYFD+FT+P+IN K EEK CG+GPS+  +  EDA+L ++I     +I  AF   + YA TF   R FY++NE  DL+A++  +++V FF  +  +YH+E +    I +++P+G++LVD T++K  ++PSP RC++ IN++LP +A+K++D +I E QDA++ L   PT T +YV++LNFL EIQ R+E LE+E   + EMY LI+ ++VPTPPED AVY TL P I   +N IDKA+ +RD  +DKFC  L +DI +L   V++++    N  +LD+ A++  ++  L  ++ +++ELQ++AF YK+YQKNFKVE  + + LEE+ AE+KLKQ+LWDSL+EW+S  N WL+++F +L+PE L  Q  ++VK V+QLEKGLPPN VVP LK KVE MREK+ VIT+L NPCL+ RHW+ +E I++ K    EE  TL  L  +++F +  +++E+SGQAS EASLE +L+K+E++W+ TE++VLPH+D+KDVFILGGTD+IQ L DDS +NVAT+ASSR+ GPIK RVD+W + L LF +T++EWL CQR+WLYLESIFSAPDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T  G+LD F+NNN LL++IQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNP AVQPHLRKCFDAIS+L+FA       E  D +      ++++YTNDIL+M+SPEGEKV LGKGLKARGNVE+WLGKVEEAMF +LR+L + +I ++ +  R EW+ A H +Q+VLT+ Q+MWCR++   LE    +  Q + +FE+  F+ LN LA LVRG LP L R  + ALIT++VHARD+VT++VKE+V   + FEWQ+QLRYYWD  LD+CV RM+ S Y YGYEYLG  PRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMG FFSGLAQSGAWCCFDEFNRI+IEVLSVIAQQLITIRNAKAAK+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVP+Y LIAEVILYSEGFESSKTLA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENP+  EDVVLIRALRDSNLPKFLK DA LF  IL DLFPGV +PEHDYG  +  I   +    LQ  PS + KVIQ YET+ VRHGVMLVGPTG GKTTVY VLA  L  L+ AG     P ++PVK Y+LNPKS++MGELYGEVN LTLEW DGLM   VR    D S DH+WVI DGPVDALWIENMNTVLDDNKMLCLANSERIKLTP ++M+FEVQDL+VASPATVSRCGMVY+DPEEL WMP+V+TWL     K+   V  YL  +FE+Y++ GL+FA   C+Q +AQV I+K+ T+C LLE+LL   GAP+L +++ KLN  +   FVFCYLW +GGNL ES+WD+FD FVR +FEDN D ++PS GDLWS Y +   + ++ WE+I+PVF +N E+PFFEM+VPT DT+R+GYL+EKLL V  SVLFTG TGVGKSVVAR  LN++ E AGYVPV+INFSAQTSS RTQE+IE+KLEKKRK +LGAP NK++++F+DDLNMPKLD+YGSQPPIELLRQ+QDF GFYDR+K  W  I DMT++AAC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF +IL GF  +F   V+   ++IV AAVEIY+RM  DLLPTPAKSHYVFNLRDLSKC+QG+LQC+P+ VRD++ +F+LFCHE QRVFHDRLIN+EDK +F+ +++EMASKYF  NIEP  F+  PIIFGDF+K G +K +R+YE LTD  K++ +L  YLDD+N   +KE KLVFF DAI+H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA M GY CFQIEL RGY+Y+ FH DL+K+Y   G+  Q  VFLFTDTQIVVEEFLEDINN+LNSGEVP+LFE DE ++++      AKEAG+SEGNRD +F+F I+RVR  LHIVLCMSPVG SFRSRCRMFPSLVNCCTIDWF  WP EALL+V+++ F++V+ G +E+K   + MC EIH SV   +ERFY+EL+RHYYTTPTSYLELI LYL ML EK++QL   RDR+KNGLTK+LETNEL+  M+ +L AL P L QK  D  ALM+KL  DQE AD VR  VKEDEA+AKVKA+ETQAIADDAQRDLDEA+PAL++A KAL+ALDK DI+E+RVFT PP +V TVME+VC+LL  KTDWASAK +LGD  FLKKL DY KDNI   +L+KL +YI +P+F  E VEKVSKAC+S+ +WVRAMD+YS+ +K V PK+++L  A  ELD  M  L++KQ +L  VEN+I  LQ+ +++S+ EK+ L   +ALT ARL R+GKLT+AL DE+ RW ES++ F +E+ NV+G+VF+ AACVAYYGAFTS YR  L+  WI RC+ L IP+S++ +L+G+LGD +E+RQWN+EGLPRD VSTEN ILV RGRRWPLMIDPQ+QANRWIR+KET N LK+IKL++  FLRTLEN IRLGMP LLE++ ETLDPALEPILLKQTFV  GRTLI LGDSDI+Y K+F+ Y+TTK++NPHY+PE+CIKVTIINFTVT  GLEDQ+L +V RLERP+LEEQR+ LI+RIN D+NQL+  E+RILKLLF SEGNILD+E+L+ TL ESKVTS     R+ EAE TE+ I  AR KY PVA RGS+MYFV+A+++EIDPMYQFSLKYFK LFNNTIE+++K +DL  R++ILL +T ++ Y NV+RGLFE+ K ++SFMLC++IM Q G IS  EW +FLRG GGI K+ PEKP  PW+S   W    ++ D +P F+ +  +I    I V +G+L ++V+ E  D Y   LPP   E       + SE    + GH++ +L +FQKLIL+K+F EEK+V  +TEFV   LG +FVE PP DL  L+ DMS   PLVF+LSTGSDPM  FQRFA EK    +  S   G   G
Sbjct:  206 PHIVQAIRTNPHLGFFYLTSSVPKSSINFDTYNLKIATFGNINKSDYYTVSTHAVTH-YCGSEVDCLPLERWEQEYQFHRKLLRIPVFALFRKWKAFRVWRANVRYKKISKCRRSLQENLFVLNESLRPALIDIREMCYHISDMPLCRLEKDHTFTLKEFQRAQYTQLEEVSSRLEKFRELVMEVARNACRNALKEFG-----------HTPDYGEVETDGNEELASPAFKL-VFEDTPEKITYTQQANKSYHCKRLTCFIRLADYLIVNTTHMLVVNSVSKLLRVFQEHITHTPSPALIQSW--TGNEITHDTD---------------IKVTAEQNISAYHQ-------PMFITELMLDTHSLSYQPSNEDFQECVAEIIGQFEKTVLSLDTLVQDTYFDAFTQPIINQKVEEKICGDGPSVEEILEEDAYLQDIILNIKQSIQTAFVTANVYARTFEPFRLFYKENEDLDLEALKEQEHEVVFFENSLDKYHQEHKEALAIQQKRPLGILLVDTTELKHRLIPSPLRCIEAINDILPRLAKKKMDDIIAEVQDAQFKLDFVPTVTTEYVDSLNFLDEIQKRIEVLEKETVTVSEMYKLIECYSVPTPPEDIAVYATLPPCITAVRNTIDKAVGERDSYVDKFCQHLQQDIGQLNNTVQEVKAEAENHQLLDIDADRSHIRRLLGDIQISIDELQSQAFKYKTYQKNFKVEVTKYDTLEELTAEVKLKQLLWDSLEEWESLENGWLQDKFDELDPELLSKQVNRFVKYVSQLEKGLPPNNVVPFLKAKVESMREKLPVITDLRNPCLKARHWEMLEAIVDSKL--LEEAQTLATLQNIDIFRFGLQIQEVSGQASGEASLENILRKIEDSWKTTEFIVLPHRDTKDVFILGGTDDIQVLLDDSIVNVATVASSRYAGPIKARVDKWQRQLLLFNQTLDEWLLCQRSWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRMPNALRAATQTGILDVFQNNNALLERIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAISQLEFATLTPTTPEGDDTV------EKIQYTNDILSMVSPEGEKVVLGKGLKARGNVEDWLGKVEEAMFSSLRRLSKAAIADYQSKPRVEWVVAGHPSQVVLTISQLMWCRDMDNCLEG-EHDHFQALQEFEITNFERLNALAALVRGNLPSLHRNIITALITIDVHARDIVTDLVKEQVDSSDNFEWQRQLRYYWDVDLDDCVARMALSQYIYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGTFFSGLAQSGAWCCFDEFNRINIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSKTLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLSEDVVLIRALRDSNLPKFLKDDAALFSGILSDLFPGVTIPEHDYGVLQSTIHSSLCQRSLQPLPSIISKVIQLYETMLVRHGVMLVGPTGSGKTTVYRVLADTLDTLHHAG--HPNPFFRPVKTYVLNPKSVSMGELYGEVNPLTLEWRDGLMALCVRAAVQDFSDDHKWVISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPSIYMMFEVQDLAVASPATVSRCGMVYIDPEELKWMPYVQTWLTGFAEKISDPVRGYLMELFEQYVEKGLQFASKHCLQAVAQVDISKVTTLCCLLEALLFSDGAPSLKMESSKLNNVLCQTFVFCYLWAVGGNLIESHWDTFDTFVRQQFEDNTDAKLPSVGDLWSVYMNFDIKCLEPWERIIPVFSYNSEIPFFEMLVPTTDTVRYGYLMEKLLSVNHSVLFTGITGVGKSVVARALLNSVQEKAGYVPVYINFSAQTSSARTQEIIESKLEKKRKNILGAPANKKIVVFVDDLNMPKLDSYGSQPPIELLRQFQDFHGFYDREKFFWKEIHDMTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSESSLKQIFKAILGGFLTEFSTAVKQAADSIVDAAVEIYHRMSVDLLPTPAKSHYVFNLRDLSKCVQGMLQCEPTTVRDQTHIFRLFCHECQRVFHDRLINNEDKSYFNTMISEMASKYFSINIEPAYFVNQPIIFGDFIKVGADKADRVYEDLTDMDKIRQVLQDYLDDYNTTFAKETKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHMCGYRCFQIELSRGYNYDSFHEDLRKLYRMAGVEGQDMVFLFTDTQIVVEEFLEDINNMLNSGEVPNLFEKDELKQVLAAISPKAKEAGISEGNRDEVFQFFISRVREKLHIVLCMSPVGDSFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSQTFFQNVEFGSEEMKQCFSEMCVEIHVSVTDMAERFYSELRRHYYTTPTSYLELINLYLGMLGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSALEPVLAQKSIDVSALMEKLAVDQENADQVRRVVKEDEALAKVKAEETQAIADDAQRDLDEALPALDSANKALNALDKADISEMRVFTKPPDLVMTVMEAVCILLSNKTDWASAKQLLGDGNFLKKLMDYDKDNIKPQILQKLHKYISNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKREKLAAAQVELDATMSTLKEKQNKLQEVENQIKVLQEQFESSMAEKETLAKTMALTEARLGRSGKLTSALGDEQVRWQESITLFEQEIHNVIGNVFIAAACVAYYGAFTSHYRQLLIDHWITRCQSLGIPISDNFSLIGILGDPYEIRQWNAEGLPRDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETKNGLKVIKLTDAGFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDIDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRINADRNQLKAIEDRILKLLFTSEGNILDNEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREKYRPVATRGSIMYFVIASLSEIDPMYQFSLKYFKQLFNNTIESAEKHKDLSLRLQILLDQTLLSAYTNVSRGLFEQHKAIYSFMLCVEIMMQRGEISQQEWLYFLRGAGGIRKELPEKPEVPWLSDFAWETCCNLEDRLPCFNGIKKEIISTPISVKLGQLEVTVSPEHWDGYVTDLPPFSEE-------IPSEKQPQVRGHWNQQLGAFQKLILIKSFMEEKVVSAVTEFVITGLGQQFVENPPVDLTTLYADMSPSIPLVFILSTGSDPMGAFQRFANEKGYQDRVKSISLGQGQG 3584          

HSP 2 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 355/600 (59.17%), Postives = 459/600 (76.50%), Query Frame = -3
Query:   72 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1871
            F+    +K Y +RV++ISLGQGQGP+AE+M+  A K G W+FLQNCHLA SWM+ +EE++K  +E    +HE+FRLFLSSMP   FP++VLQNSVKVTNEPPKGLRAN++RAF E+S  FFE H+LG  WRK+IFG+CFFH+II +RKKFGPLGWNIRYEF+DSDRECA+LNL ++C  G I WDALTYIT EITYGGRVTD WDQRCLR IL +FF   T+ E Y YS+SGIY+ P+ +++ EYK +++ LPL+++PE+FGMHENANL+FQ QET  +INTIL+VQPR +A G G++ D++V+EL D IL K+ DK++ + A   LF  D KGR+NSLTTVL QEVDRFN LL V+K SL  L+KAI G VVMSEE+E +Y +F NNQVP+ WSN AYPSLKPL +WV+DL +R +    W+ +G PKSFW+ GFFFPQGFLTG LQN+ARKY+ PID L+F F +   YR+Q  V +  K L  G+ ++ D+ L +  DGVLVHG++MD  RWDD +  +  ++   M  +LP++H  P+ +Y PE + Y +PLYKT  RAG LSTTG STNFVV V LP++Q S++WI+  +AL+C+
Sbjct: 3561 FQRFANEKGYQDRVKSISLGQGQGPIAERMIKEALKNGIWIFLQNCHLAVSWMLAMEELIKSFNEPDTVIHEDFRLFLSSMPTNVFPVTVLQNSVKVTNEPPKGLRANVRRAFTEISSTFFEEHILGRKWRKIIFGVCFFHAIIQERKKFGPLGWNIRYEFNDSDRECALLNLNLYCQTGHIPWDALTYITGEITYGGRVTDAWDQRCLRTILKSFFSLATLEEGYTYSKSGIYFAPDSDSLTEYKQYIEDLPLIDDPEVFGMHENANLAFQRQETMTVINTILEVQPRSSAAGGGKSNDEVVHELVDSILAKIPDKLDMDAAVESLFLQDPKGRVNSLTTVLGQEVDRFNFLLRVLKTSLCTLQKAIAGLVVMSEEMEKIYNSFLNNQVPDHWSNAAYPSLKPLGSWVRDLNLRTAFIESWITRGQPKSFWISGFFFPQGFLTGALQNHARKYNLPIDELNFRFNMVPVYRDQILVTEAQKTLAPGKELDMDQELPNMEDGVLVHGMFMDACRWDDTSMVVEDALSRVMNPMLPVVHFEPQQNYVPEPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVMLPSNQPSDYWISKASALLCQ 4160          
BLAST of SMED30008756 vs. Ensembl Zebrafish
Match: dnah6 (dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:ZDB-GENE-030616-623])

HSP 1 Score: 4289.57 bits (11124), Expect = 0.000e+0
Identity = 2089/3434 (60.83%), Postives = 2620/3434 (76.30%), Query Frame = -2
Query: 1801 PKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSY-RPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 12096
            P I+  +R  P + F YLT ++ K   N+  YNLK+ ++ N+ K D+Y VS +  TH   G E+D + L+R+E EY+ + K+ +IP F  FR WKAF  W   ++Y K  +C + L  +LF++N SLRPAL+++REMC+ ISDM LC++EK  T+TL +F  AQ  QL EV+S+L +FRELV EV R+ACR +L E G            TP+YGE            ++ + V+ + P+K+TYT+QANK  HC+RLT FIRLADYLIVNT H+L VNSV  LL    + +  TP+   I ++     E+  + D               IK ++ ++I    +       P+FITE +L   +L + P  E FQE + E+I +F+ TVLS+  LV DTYFD+FT+P+IN K EEK CG+GPS+  +  EDA+L N+I     +I  AF   + YA TF   R FY++NE  DL+A++  +++V FF  +  +YH+E +    I +++P+G++LVD TK+K  ++PSP RC++ IN++LP +A+K++D +I E+QDA++ L   PT T +YV++LNFL EIQ R+E LE+E   + EMY LI+ ++VPTPPED AVY TL P I   +N IDKA+ +RD  +DKFC  L +DI +L   V++++    N  +LD+ A++  ++  L  ++ +++ELQ++AF YK+YQKNFKVE  + + LEE+ AE+KLKQ+LWDSL+EW+S  N WL+++F +L+PE L  Q  ++VK V+QLEKGLPPN VVP LK KVE MREK+ VIT+L NPCL+ RHW+ +E I++ K    EE  TL  L  +++F +  +++E+SGQAS EASLE +L+K+E++W+ TE++VLPH+D+KDVFILGGTD+IQ L DDS +NVAT+ASSR+ GPIK RVD+W + L LF +T++EWL CQR+WLYLESIFSAPDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T  G+LD F+NNN LL++IQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNP AVQPHLRKCFDAIS+L+FA       E  D +      ++++YTNDIL+M+SPEGEKV LGKGLKARGNVE+WLGKVEEAMF +LR+L + +I ++ +  R EW+ A H +Q+VLT+ Q+MWCR++   LE    +  Q + +FE+  F+ LN LA LVRG LP L R  + ALIT++VHARD+VT++VKE+V   + FEWQ+QLRYYWD  LD+CV RM+ S Y YGYEYLG  PRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMG FFSGLAQSGAWCCFDEFNRI+IEVLSVIAQQLITIRNAKAAK+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVP+Y LIAEVILYSEGFESSKTLA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENP+  EDVVLIRALRDSNLPKFLK DA LF  IL DLFPGV +PEHDYG  +  I   +    LQ  PS + KVIQ YET+ VRHGVMLVGPTG GKTTVY VLA  L  L+ AG     P ++PVK Y+LNPKS++MGELYGEVN LTLEW DGLM   VR    D S DH+WVI DGPVDALWIENMNTVLDDNKMLCLANSERIKLTP +HM+FEVQDL+VASPATVSRCGMVY+DPEEL WMP+V+TWL     K+   V  YL  +FE+Y++ GL+FA   C+Q +AQV I+K+ T+C LLE+LL   GAP+L +++ KLN  +   FVFCYLW +GGNL ES+WD+FD FVR +FEDN D ++ S GDLWS Y +   + ++ WE+I+PVF +N E+PFFEM+VPT DT+R+GYL+EKLL V  SVLFTG TGVGKSVVAR  LN++ E AGYVPV+INFSAQTSS RTQE+IE+KLEKKRK +LGAP NK++++F+DDLNMPKLD+YGSQPPIELLRQ+QDF GFYDR+K  W  I DMT++AAC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF +IL GF  +F   V+   ++IV AAVEIY+RM  DLLPTPAKSHYVFNLRDLSKC+QG+LQC+P+ VRD++ +F+LFCHE QRVFHDRLIN+EDK +F+ +++EMASKYF  NIEP  F+  PIIFGDF+K G +K +R+YE LTD  K++ +L  YLDD+N   +KE KLVFF DAI+H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA M GY CFQIEL RGY+Y+ FH DL+K+Y   G+  Q  VFLFTDTQIVVEEFLEDINN+LNSGEVP+LFE DE ++++      AKEAG+SEGNRD +++F I RVR  LHIVLCMSPVG SFRSRCRMFPSLVNCCTIDWF  WP EALL+V+++ F++V+ G +E+K   + MC EIH SV   +ERFY+EL+RHYYTTPTSYLELI LYL ML EK++QL   RDR+KNGLTK+LETNEL+  M+ +L AL P L QK  D  ALM+KL  DQE AD VR  VKEDEA+AKVKA+ETQAIADDAQRDLDEA+PAL++A KAL+ALDK DI+E+RVFT PP +V TVME+VC+LL  KTDWASAK +LGD  FLKKL DY KDNI   +L+KL +YI +P+F  E VEKVSKAC+S+ +WVRAMD+YS+ +K V PK+++L  A  ELD  M  L++KQ +L  VEN+I  LQ  +++S+ EK+ L   +ALT ARL R+GKLT+AL DE+ RW ES++ F +E+ NV+G+VF+ AACVAYYGAFTS YR  L+  WI RC+ L IP+S++ +L+G+LGD +E+RQWN+EGLPRD VSTEN ILV RGRRWPLMIDPQ+QANRWIR+KET N LK+IKL++  FLRTLEN IRLGMP LLE++ ETLDPALEPILLKQTFV  GRTLI LGDSDI+Y K+F+ Y+TTK++NPHY+PE+CIKVTIINFTVT  GLEDQ+L +V RLERP+LEEQR+ LI+RIN D+NQL+  E+RILKLLF SEGNILD+E+L+ TL ESKVTS     R+ EAE TE+ I  AR KY PVA RGS+MYFV+A+++EIDPMYQFSLKYFK LFNNTIE+++K +DL  R++ILL +T ++ Y NV+RGLFE+ K ++SFMLC++IM Q G IS  EW +FLRG GGI K+ PEKP  PW+S   W    ++ D +P F+ +  +I    I V +G+L ++VN E  D Y   LPP   E       + SE    + GH++ +L +FQKLIL+K+F EEK+V  +TEFV   LG +FVE P  DL  L+ DMS   PLVF+LSTGSDPM  FQRFA EK    +  S   G   G
Sbjct:  206 PHIVQAIRTNPHLGFFYLTSSVPKSSINFDTYNLKIATFGNINKSDYYTVSTHAVTH-YCGSEVDCLPLERWEQEYQFHRKLLRIPVFALFRKWKAFRVWCANVRYKKISKCRRSLQENLFVLNESLRPALIDIREMCYHISDMPLCRLEKDHTFTLKEFQRAQYTQLEEVSSRLEKFRELVMEVARNACRNALKEFG-----------HTPDYGEVETDGNEELASPAFKL-VFEDTPEKITYTQQANKSYHCKRLTCFIRLADYLIVNTTHMLVVNSVSKLLRVFQEHITHTPSPALIQSW--TGNEISHDTD---------------IKVTAEQNISAYHQ-------PMFITELMLDTHSLSYQPSNEDFQECVAEIIGQFEKTVLSLDTLVQDTYFDAFTQPIINQKVEEKICGDGPSVEEILEEDAYLQNIILNIKQSIQTAFVTANVYARTFEPFRLFYKENEDLDLEALKEQEHEVAFFENSLDKYHQEHKEALAIQQKRPLGILLVDTTKLKHRLIPSPLRCIEAINDILPRLAKKKMDDIIAEAQDAQFKLDFVPTVTTEYVDSLNFLDEIQKRIEVLEKETVTVSEMYKLIECYSVPTPPEDIAVYATLPPCITAVRNTIDKAVGERDSYVDKFCQHLQQDIGQLNNTVQEVKAEAENHQLLDIDADRSHIRRLLGDIQISIDELQSQAFKYKTYQKNFKVEVTKYDTLEELTAEVKLKQLLWDSLEEWESLENGWLQDKFDELDPELLSKQVNRFVKYVSQLEKGLPPNNVVPFLKAKVESMREKLPVITDLRNPCLKARHWEMLEAIVDSKL--LEEAQTLATLQNIDIFRFGLQIQEVSGQASGEASLENILRKIEDSWKTTEFIVLPHRDTKDVFILGGTDDIQVLLDDSIVNVATVASSRYAGPIKARVDKWQRQLLLFNQTLDEWLLCQRSWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRMPNALRAATQTGILDVFQNNNALLERIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAISQLEFATLTPTTPEGDDTV------EKIQYTNDILSMVSPEGEKVVLGKGLKARGNVEDWLGKVEEAMFSSLRRLSKAAIADYQSKPRVEWVVAGHPSQVVLTISQLMWCRDMDNCLEG-EHDHFQALQEFEITNFERLNALAALVRGNLPSLHRNIITALITIDVHARDIVTDLVKEQVDSSDNFEWQRQLRYYWDVDLDDCVARMALSQYIYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGTFFSGLAQSGAWCCFDEFNRINIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSKTLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLSEDVVLIRALRDSNLPKFLKDDAALFSGILSDLFPGVTIPEHDYGVLQSTIHSSLCQRSLQPLPSIISKVIQLYETMLVRHGVMLVGPTGSGKTTVYRVLADTLDTLHHAG--HPNPFFRPVKTYVLNPKSVSMGELYGEVNPLTLEWRDGLMALCVRAAVQDFSDDHKWVISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPSIHMMFEVQDLAVASPATVSRCGMVYIDPEELKWMPYVQTWLTGFAEKISDPVRGYLMELFEQYVEKGLQFASKHCVQAVAQVDISKVTTLCCLLEALLFSDGAPSLKMESSKLNNVLCQTFVFCYLWAVGGNLIESHWDTFDTFVRQQFEDNTDAKLSSVGDLWSVYMNFDIKCLEPWERIIPVFSYNSEIPFFEMLVPTTDTVRYGYLMEKLLSVNHSVLFTGITGVGKSVVARALLNSVQEKAGYVPVYINFSAQTSSARTQEIIESKLEKKRKNILGAPANKKIVVFVDDLNMPKLDSYGSQPPIELLRQFQDFHGFYDREKFFWKEIHDMTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSESSLKQIFKAILGGFLTEFSTAVKQAADSIVDAAVEIYHRMSVDLLPTPAKSHYVFNLRDLSKCVQGMLQCEPTTVRDQTHIFRLFCHECQRVFHDRLINNEDKSYFNTMISEMASKYFSINIEPAYFVNQPIIFGDFIKVGADKADRVYEDLTDMDKIRQVLQDYLDDYNTTFAKETKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHMCGYRCFQIELSRGYNYDSFHEDLRKLYRMAGVEGQDMVFLFTDTQIVVEEFLEDINNMLNSGEVPNLFEKDELKQVLAAISPKAKEAGISEGNRDEVYQFFITRVREKLHIVLCMSPVGDSFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSQTFFQNVEFGSEEMKQCFSEMCVEIHVSVTDMAERFYSELRRHYYTTPTSYLELINLYLGMLGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSALEPVLAQKSIDVSALMEKLAVDQENADQVRRVVKEDEALAKVKAEETQAIADDAQRDLDEALPALDSANKALNALDKADISEMRVFTKPPDLVMTVMEAVCILLSNKTDWASAKQLLGDGNFLKKLMDYDKDNIKPQILQKLHKYISNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKREKLAAAQVELDATMSTLKEKQNKLQEVENQIKVLQDQFESSMAEKETLAKTMALTEARLGRSGKLTSALGDEQVRWQESITLFEQEIHNVIGNVFIAAACVAYYGAFTSHYRQLLIDHWITRCQSLGIPISDNFSLIGILGDPYEIRQWNAEGLPRDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETKNGLKVIKLTDAGFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDIDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRINADRNQLKAIEDRILKLLFTSEGNILDNEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREKYRPVATRGSIMYFVIASLSEIDPMYQFSLKYFKQLFNNTIESAEKHKDLSLRLQILLDQTLLSAYTNVSRGLFEQHKAIYSFMLCVEIMMQRGEISQQEWLYFLRGAGGIRKELPEKPEVPWLSDFAWETCCNLEDRLPCFNGIKKEIISTPISVKLGQLEVTVNPEHWDGYVTDLPPFSEE-------IPSEKQPQVRGHWNQQLGAFQKLILIKSFMEEKVVSAVTEFVITGLGQQFVENPLVDLATLYADMSPSIPLVFILSTGSDPMGAFQRFANEKGYQDRVKSISLGQGQG 3584          

HSP 2 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 356/600 (59.33%), Postives = 460/600 (76.67%), Query Frame = -3
Query:   72 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1871
            F+    +K Y +RV++ISLGQGQGP+AE+M+  A K G W+FLQNCHLA SWM+ +EE++K  +E    +HE+FRLFLSSMP   FP++VLQNSVKVTNEPPKGLRAN++RAF E+S  FFE H+LG  WRK+IFG+CFFH+II +RKKFGPLGWNIRYEF+DSDRECA+LNL ++C  G I WDALTYIT EITYGGRVTD WDQRCLR IL +FF   T+ E Y YS+SGIY+ P+ +++ EYK +++ LPL+++PE+FGMHENANL+FQ QET  +INTIL+VQPR +A G G++ D++V+ELAD IL K+ DK++ + A   LF  D KGR+NSLTTVL QEVDRFN LL V+K SL  L+KAI G VVMSEE+E +Y +F NNQVP+ WSN AYPSLKPL +WV+DL +R +    W+ +G PKSFW+ GFFFPQGFLTG LQN+ARKY+ PID L+F F +   YR+Q  V +  K L  G+ ++ D+ L +  DGVLVHG++MD  RWDD +  +  ++   M  +LP++H  P+ +Y PE + Y +PLYKT  RAG LSTTG STNFVV V LP++Q S++WI+  +AL+C+
Sbjct: 3561 FQRFANEKGYQDRVKSISLGQGQGPIAERMIKEALKNGIWIFLQNCHLAVSWMLAMEELIKSFNEPDTVIHEDFRLFLSSMPTNVFPVTVLQNSVKVTNEPPKGLRANVRRAFTEISSTFFEEHILGRKWRKIIFGVCFFHAIIQERKKFGPLGWNIRYEFNDSDRECALLNLNLYCQTGHIPWDALTYITGEITYGGRVTDAWDQRCLRTILKSFFSLATLEEGYTYSKSGIYFAPDSDSLTEYKQYIEDLPLIDDPEVFGMHENANLAFQRQETMTVINTILEVQPRSSAAGGGKSNDEVVHELADSILAKIPDKLDMDAAVESLFLQDPKGRVNSLTTVLGQEVDRFNFLLRVLKTSLCTLQKAIAGLVVMSEEMEKIYNSFLNNQVPDHWSNAAYPSLKPLGSWVRDLNLRTAFIESWITRGQPKSFWISGFFFPQGFLTGALQNHARKYNLPIDELNFRFNMVPVYRDQILVTEAQKTLAPGKELDMDQELPNMEDGVLVHGMFMDACRWDDTSMVVEDALSRVMNPMLPVVHFEPQQNYVPEPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVMLPSNQPSDYWISKASALLCQ 4160          
BLAST of SMED30008756 vs. Ensembl Zebrafish
Match: dnah6 (dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:ZDB-GENE-030616-623])

HSP 1 Score: 4264.92 bits (11060), Expect = 0.000e+0
Identity = 2082/3446 (60.42%), Postives = 2614/3446 (75.86%), Query Frame = -2
Query: 1801 PKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLT------------DRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSY-RPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 12096
            P I+  +R  P + F YLT ++ K   N+  YNLK+ ++ N+ K D+Y VS +  TH   G E+D + L+R+E EY+ + K+ +IP F  FR WKAF  W   ++Y K  +C + L  +LF++N SLRPAL+++REMC+ ISDM LC++EK  T+TL +F  AQ  QL EV+S+L +FRELV EV R+ACR +L E G            TP+YGE            ++ + V+ + P+K+TYT+QANK  HC+RLT FIRLADYLIVNT H+L VNSV  LL    + +  TP+   I ++     E+  + D               IK ++ ++I    +       P+FITE +L   +L + P  E FQE + E+I +F+ TVLS+  LV DTYFD+FT+P+IN K EEK CG+GPS+  +  EDA+L N+I     +I  AF   + YA TF   R FY++NE  DL+A++  +++V FF  +  +YH+E +    I +++P+G++LVD TK+K  ++PSP RC++ IN++LP +A+K++D +I E+QDA++ L   PT T +YV++LNFL EIQ R+E LE+E   + EMY LI+ ++VPTPPED AVY TL P I   +N IDKA+ +RD  +DKFC  L +DI +L   V++++    N  +LD+ A++  ++  L  ++ +++ELQ++AF YK+YQKNFKVE  + + LEE+ AE+KLKQ+LWDSL+EW+S  N WL+++F +L+PE L  Q  ++VK V+QLEKGLPPN VVP LK KVE MREK+ VIT+L NPCL+ RHW+ +E I++ K    EE  TL  L  +++F +  +++E+SGQAS EASLE +L+K+E++W+ TE++VLPH+D+KDVFILGGTD+IQ L DDS +NVAT+ASSR+ GPIK RVD+W + L LF +T++EWL CQR+WLYLESIFSAPDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T  G+LD F+NNN LL++IQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNP AVQPHLRKCFDAIS+L+FA       E  D +      ++++YTNDIL+M+SPEGEKV LGKGLKARGNVE+WLGKVEEAMF +LR+L + +I ++ +  R EW+ A H +Q+VLT+ Q+MWCR++   LE    +  Q + +FE+  F+ LN LA LVRG LP L R  + ALIT++VHARD+VT++VKE+V   + FEWQ+QLRYYWD  LD+CV RM+ S Y YGYEYLG  PRLVITPLT            DRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMG FFSGLAQSGAWCCFDEFNRI+IEVLSVIAQQLITIRNAKAAK+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVP+Y LIAEVILYSEGFESSKTLA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENP+  EDVVLIRALRDSNLPKFLK DA LF  IL DLFPGV +PEHDYG  +  I   +    LQ  PS + KVIQ YET+ VRHGVMLVGPTG GKTTVY VLA  L  L+ AG     P ++PVK Y+LNPKS++MGELYGEVN LTLEW DGLM   VR    D S DH+WVI DGPVDALWIENMNTVLDDNKMLCLANSERIKLTP +HM+FEVQDL+VASPATVSRCGMVY+DPEEL WMP+V+TWL     K+   V  YL  +FE+Y++ GL+FA   C+Q +AQV I+K+ T+C LLE+LL   GAP+L +++ KLN  +   FVFCYLW +GGNL ES+WD+FD FVR +FEDN D ++ S GDLWS Y +   + ++ WE+I+PVF +N E+PFFEM+VPT DT+R+GYL+EKLL V  SVLFTG TGVGKSVVAR  LN++ E AGYVPV+INFSAQTSS RTQE+IE+KLEKKRK +LGAP NK++++F+DDLNMPKLD+YGSQPPIELLRQ+QDF GFYDR+K  W  I DMT++AAC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF +IL GF  +F   V+   ++IV AAVEIY+RM  DLLPTPAKSHYVFNLRDLSKC+QG+LQC+P+ VRD++ +F+LFCHE QRVFHDRLIN+EDK +F+ +++EMA        +P  F+  PIIFGDF+K G +K +R+YE LTD  K++ +L  YLDD+N   +KE KLVFF DAI+H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA M GY CFQIEL RGY+Y+ FH DL+K+Y   G+  Q  VFLFTDTQIVVEEFLEDINN+LNSGEVP+LFE DE ++++      AKEAG+SEGNRD +++F I RVR  LHIVLCMSPVG SFRSRCRMFPSLVNCCTIDWF  WP EALL+V+++ F++V+ G +E+K   + MC EIH SV   +ERFY+EL+RHYYTTPTSYLELI LYL ML EK++QL   RDR+KNGLTK+LETNEL+  M+ +L AL P L QK  D  ALM+KL  DQE AD VR  VKEDEA+AKVKA+ETQAIADDAQRDLDEA+PAL++A KAL+ALDK DI+E+RVFT PP +V TVME+VC+LL  KTDWASAK +LGD  FLKKL DY KDNI   +L+KL +YI +P+F  E VEKVSKAC+S+ +WVRAMD+YS+ +K V PK+++L  A  ELD  M  L++KQ +L  VEN+I  LQ  +++S+ EK+ L   +ALT ARL R+GKLT+AL DE+ RW ES++ F +E+ NV+G+VF+ AACVAYYGAFTS YR  L+  WI RC+ L IP+S++ +L+G+LGD +E+RQWN+EGLPRD VSTEN ILV RGRRWPLMIDPQ+QANRWIR+KET N LK+IKL++  FLRTLEN IRLGMP LLE++ ETLDPALEPILLKQTFV  GRTLI LGDSDI+Y K+F+ Y+TTK++NPHY+PE+CIKVTIINFTVT  GLEDQ+L +V RLERP+LEEQR+ LI+RIN D+NQL+  E+RILKLLF SEGNILD+E+L+ TL ESKVTS     R+ EAE TE+ I  AR KY PVA RGS+MYFV+A+++EIDPMYQFSLKYFK LFNNTIE+++K +DL  R++ILL +T ++ Y NV+RGLFE+ K ++SFMLC++IM Q G IS  EW +FLRG GGI K+ PEKP  PW+S   W    ++ D +P F+ +  +I    I V +G+L ++VN E  D Y   LPP   E       + SE    + GH++ +L +FQKLIL+K+F EEK+V  +TEFV   LG +FVE P  DL  L+ DMS   PLVF+LSTGSDPM  FQRFA EK    +  S   G   G
Sbjct:  206 PHIVQAIRTNPHLGFFYLTSSVPKSSINFDTYNLKIATFGNINKSDYYTVSTHAVTH-YCGSEVDCLPLERWEQEYQFHRKLLRIPVFALFRKWKAFRVWCANVRYKKISKCRRSLQENLFVLNESLRPALIDIREMCYHISDMPLCRLEKDHTFTLKEFQRAQYTQLEEVSSRLEKFRELVMEVARNACRNALKEFG-----------HTPDYGEVETDGNEELASPAFKL-VFEDTPEKITYTQQANKSYHCKRLTCFIRLADYLIVNTTHMLVVNSVSKLLRVFQEHITHTPSPALIQSW--TGNEISHDTD---------------IKVTAEQNISAYHQ-------PMFITELMLDTHSLSYQPSNEDFQECVAEIIGQFEKTVLSLDTLVQDTYFDAFTQPIINQKVEEKICGDGPSVEEILEEDAYLQNIILNIKQSIQTAFVTANVYARTFEPFRLFYKENEDLDLEALKEQEHEVAFFENSLDKYHQEHKEALAIQQKRPLGILLVDTTKLKHRLIPSPLRCIEAINDILPRLAKKKMDDIIAEAQDAQFKLDFVPTVTTEYVDSLNFLDEIQKRIEVLEKETVTVSEMYKLIECYSVPTPPEDIAVYATLPPCITAVRNTIDKAVGERDSYVDKFCQHLQQDIGQLNNTVQEVKAEAENHQLLDIDADRSHIRRLLGDIQISIDELQSQAFKYKTYQKNFKVEVTKYDTLEELTAEVKLKQLLWDSLEEWESLENGWLQDKFDELDPELLSKQVNRFVKYVSQLEKGLPPNNVVPFLKAKVESMREKLPVITDLRNPCLKARHWEMLEAIVDSKL--LEEAQTLATLQNIDIFRFGLQIQEVSGQASGEASLENILRKIEDSWKTTEFIVLPHRDTKDVFILGGTDDIQVLLDDSIVNVATVASSRYAGPIKARVDKWQRQLLLFNQTLDEWLLCQRSWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRMPNALRAATQTGILDVFQNNNALLERIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAISQLEFATLTPTTPEGDDTV------EKIQYTNDILSMVSPEGEKVVLGKGLKARGNVEDWLGKVEEAMFSSLRRLSKAAIADYQSKPRVEWVVAGHPSQVVLTISQLMWCRDMDNCLEG-EHDHFQALQEFEITNFERLNALAALVRGNLPSLHRNIITALITIDVHARDIVTDLVKEQVDSSDNFEWQRQLRYYWDVDLDDCVARMALSQYIYGYEYLGACPRLVITPLTVHIHLNFFFLMMDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGTFFSGLAQSGAWCCFDEFNRINIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSKTLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLSEDVVLIRALRDSNLPKFLKDDAALFSGILSDLFPGVTIPEHDYGVLQSTIHSSLCQRSLQPLPSIISKVIQLYETMLVRHGVMLVGPTGSGKTTVYRVLADTLDTLHHAG--HPNPFFRPVKTYVLNPKSVSMGELYGEVNPLTLEWRDGLMALCVRAAVQDFSDDHKWVISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPSIHMMFEVQDLAVASPATVSRCGMVYIDPEELKWMPYVQTWLTGFAEKISDPVRGYLMELFEQYVEKGLQFASKHCVQAVAQVDISKVTTLCCLLEALLFSDGAPSLKMESSKLNNVLCQTFVFCYLWAVGGNLIESHWDTFDTFVRQQFEDNTDAKLSSVGDLWSVYMNFDIKCLEPWERIIPVFSYNSEIPFFEMLVPTTDTVRYGYLMEKLLSVNHSVLFTGITGVGKSVVARALLNSVQEKAGYVPVYINFSAQTSSARTQEIIESKLEKKRKNILGAPANKKIVVFVDDLNMPKLDSYGSQPPIELLRQFQDFHGFYDREKFFWKEIHDMTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSESSLKQIFKAILGGFLTEFSTAVKQAADSIVDAAVEIYHRMSVDLLPTPAKSHYVFNLRDLSKCVQGMLQCEPTTVRDQTHIFRLFCHECQRVFHDRLINNEDKSYFNTMISEMA--------KPAYFVNQPIIFGDFIKVGADKADRVYEDLTDMDKIRQVLQDYLDDYNTTFAKETKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHMCGYRCFQIELSRGYNYDSFHEDLRKLYRMAGVEGQDMVFLFTDTQIVVEEFLEDINNMLNSGEVPNLFEKDELKQVLAAISPKAKEAGISEGNRDEVYQFFITRVREKLHIVLCMSPVGDSFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSQTFFQNVEFGSEEMKQCFSEMCVEIHVSVTDMAERFYSELRRHYYTTPTSYLELINLYLGMLGEKRQQLQAARDRIKNGLTKLLETNELVDKMKQDLSALEPVLAQKSIDVSALMEKLAVDQENADQVRRVVKEDEALAKVKAEETQAIADDAQRDLDEALPALDSANKALNALDKADISEMRVFTKPPDLVMTVMEAVCILLSNKTDWASAKQLLGDGNFLKKLMDYDKDNIKPQILQKLHKYISNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVLKEVGPKREKLAAAQVELDATMSTLKEKQNKLQEVENQIKVLQDQFESSMAEKETLAKTMALTEARLGRSGKLTSALGDEQVRWQESITLFEQEIHNVIGNVFIAAACVAYYGAFTSHYRQLLIDHWITRCQSLGIPISDNFSLIGILGDPYEIRQWNAEGLPRDNVSTENGILVMRGRRWPLMIDPQDQANRWIRSKETKNGLKVIKLTDAGFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRTLIRLGDSDIDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQILSDVVRLERPDLEEQRSQLIVRINADRNQLKAIEDRILKLLFTSEGNILDNEELVQTLQESKVTSQAIKSRLVEAETTEEMINRAREKYRPVATRGSIMYFVIASLSEIDPMYQFSLKYFKQLFNNTIESAEKHKDLSLRLQILLDQTLLSAYTNVSRGLFEQHKAIYSFMLCVEIMMQRGEISQQEWLYFLRGAGGIRKELPEKPEVPWLSDFAWETCCNLEDRLPCFNGIKKEIISTPISVKLGQLEVTVNPEHWDGYVTDLPPFSEE-------IPSEKQPQVRGHWNQQLGAFQKLILIKSFMEEKVVSAVTEFVITGLGQQFVENPLVDLATLYADMSPSIPLVFILSTGSDPMGAFQRFANEKGYQDRVKSISLGQGQG 3588          

HSP 2 Score: 565.074 bits (1455), Expect = 1.102e-160
Identity = 257/402 (63.93%), Postives = 322/402 (80.10%), Query Frame = -3
Query:  666 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSL 1871
            F+    +K Y +RV++ISLGQGQGP+AE+M+  A K G W+FLQNCHLA SWM+ +EE++K  +E    +HE+FRLFLSSMP   FP++VLQNSVKVTNEPPKGLRAN++RAF E+S  FFE H+LG  WRK+IFG+CFFH+II +RKKFGPLGWNIRYEF+DSDRECA+LNL ++C  G I WDALTYIT EITYGGRVTD WDQRCLR IL +FF   T+ E Y YS+SGIY+ P+ +++ EYK +++ LPL+++PE+FGMHENANL+FQ QET  +INTIL+VQPR +A G G++ D++V+ELAD IL K+ DK++ + A   LF  D KGR+NSLTTVL QEVDRFN LL V+K SL  L+KAI G VVMSEE+E +Y +F NNQVP+ WSN AYPSL
Sbjct: 3565 FQRFANEKGYQDRVKSISLGQGQGPIAERMIKEALKNGIWIFLQNCHLAVSWMLAMEELIKSFNEPDTVIHEDFRLFLSSMPTNVFPVTVLQNSVKVTNEPPKGLRANVRRAFTEISSTFFEEHILGRKWRKIIFGVCFFHAIIQERKKFGPLGWNIRYEFNDSDRECALLNLNLYCQTGHIPWDALTYITGEITYGGRVTDAWDQRCLRTILKSFFSLATLEEGYTYSKSGIYFAPDSDSLTEYKQYIEDLPLIDDPEVFGMHENANLAFQRQETMTVINTILEVQPRSSAAGGGKSNDEVVHELADSILAKIPDKLDMDAAVESLFLQDPKGRVNSLTTVLGQEVDRFNFLLRVLKTSLCTLQKAIAGLVVMSEEMEKIYNSFLNNQVPDHWSNAAYPSL 3966          
BLAST of SMED30008756 vs. Ensembl Zebrafish
Match: dnah1 (dynein, axonemal, heavy chain 1 [Source:ZFIN;Acc:ZDB-GENE-081015-3])

HSP 1 Score: 2154.02 bits (5580), Expect = 0.000e+0
Identity = 1186/2755 (43.05%), Postives = 1682/2755 (61.05%), Query Frame = -2
Query: 1801 LWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEK---GLPPNQ-VVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAIL-EDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVG-----PGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNK-----FEDNG---DCRMPSQGDLWSSYADLHSRKMDL----WEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSV-VARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLN-WITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTEN------------IVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKV--KLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLL------------LGQKTD--WASAKSVLGDP-YFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSE--FAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 9900
            LW +  +W   +  WL +    +NPE L        K + Q  K    LP  Q V   ++ K+E  R  + +I +L NP ++ RHW+ + + IN     S   LT    +EL + D+ EE+  ++ +A  E S+E  L K+EE W    + V+P+K++   +IL   DE  QL DD  +   ++A S +  P + R+ +W   L +  + +EEWL CQR+WLY+E IFS+ DI RQLP E K + +++++++ IM+        +       LL + K+ N LL+ +QK L  YLE+KR  FPRFYFLS+DELLEIL+QT++P +VQPHLRKCF+ I++L F          SD +              I  M S EGE+V L   +   GNVE WL +VE +M  ++R  + +S+  +    R EW+ +   Q+V+   Q  W +E++  L +  + +RL   +       + L  L  LVRG L K+ RA L ALI + VHA+D+  ++V+E+VS +N FEW  QLRYYW   L    +R  N+ + YGYEYLG S RLVITPLTDRCYL L GAL L  GGAPAGPAGTGKTETTKDL K+LA Q VVFNCSD LD+  MG+F  GLA SGAW CFDEFNRID+EVLSV+AQQ+ TI+ A+  ++  F+FEG EI LV +CA FITMNPGYAGRTELPDNLKALFRP+AMM+PDY +IAE+ LYS GF  +K L++K+T  +KL SEQLS QDHYDFGMRA+K+V+  AG LKRENPD  E+++ +RA+RD N+PKFL+ D +LF  I+ DLFP +     DYG     I  V  N  L+     + K IQ YET  VRHG+MLVGP+G GKT  Y VLA  ++ L     +    +Y+ V+ Y+LNPKSITMG+LYGE ++LT EW DG++  ++R       Q+ +W + DGPVDA+WIENMNTVLDDNK LCL++ E IKL+  + M+FEVQDL+VASPATVSRCGMVY++P  LG  PF + WL ++    +    D +  +F +++ D ++F +    + +  +      ++ +LL+             P+      +L   I   F+F  +W +G     ++   F  ++R K     F + G   D  +   G       D   ++  +    W K         E  + ++IVPTVDT+R  +L++ LL  K  VL  G TG GK++ ++   L N+   A Y+  F+ FSA+TS+N+TQ+ I++KL+++RK V G P  K  I FIDDLNMP L+TYG+QPPIELLRQ+ D GG+YDR ++  +  + D+  + A GPPGGGRNP++ R  RHF   S     + S  +IF++IL  +  +  Q + G +              +V A + +Y+ + + LLPTPAKSHY FNLRDLSK  QGIL  +   + +K  + +L+ HE+ RVF DRL++ ED+ +F Q++     K FG  IE E     PI++GDFM PG  K   +Y+ + D  K+  ++  YLDD+N  S+ +MKLV FMDAI H+ RI+R++RQ  GNALL+GVGG+G+QSLTRLA  +  Y CFQIEL + Y    +  D+K I    G+ N    FLF DTQI  E FLED+NNILNSG+VP+L+  +E ER++   +   ++ G  +  +  +    +NRVR+N+H VLCMSPVG  FR+R R FPSLVNCCTIDWF+AWP+EAL +VA S    +   E   K    LALMC EIH  V+++ E++ AEL RH   TP SYLEL++++ S++ +KK++L + R R+K GL K+L T E +A M+ EL  +RPQLE+  KDT   M+K+  D   A+  R  V+ +E  A  KA+  QAIADDAQ+DL+EA+PAL+ A+ +L +L KND+ E+R    PP  V+ V+E+VC+L            LG+K D  W + K +L DP  FL+ L  Y KDNIP++++K+++ Y+D+P F  +++ KVSKAC S+  WVRAM +Y    + VEPK++ L+ A ++L      L   + +L AVE  IA LQ  Y   + ++  L+    L   RL RA KL   LADEK RW+E+V +    + NV GDV + A  VAY G FT  YR  +   W+   ++L +P +E   L+  LGD  ++R W   GLP+D +S EN ++    +RWPL IDPQ QAN+WI+N E  N+L ++KLS+ +FLR+LEN IR G P LLE++GE LDPAL+P+LL+QT+   G T++ LGD+ I Y  DFK+YITTKL NPHY PEI  KVT+INFT++P GLEDQLLG +   ERP+LE  +N LI+     K +L+  E++IL  L  SEGN +D E+LI  L  SKV + E   ++  AE TE+ I   R +Y+PVA R  +++F V++++ +DPMYQ+SL++F  +F   I NS+++  + ERI  +    T + Y+NV R LFEK KL+F+F+LC +I+  +  I   EW + L G G  +++ P  P   W+S   W +++ +S  +P FSNL    ++                               E+  KS  DS     + L G ++ +L SFQKL++++    +++   + +FV   LG RF+EP  +DL ++F++ S  +PL+FVLS G+DP     +FA+  K   K ++   G   G
Sbjct:  942 LWKTTSDWLRWHESWLNDPLAAINPEQLERNVTDAYKTMHQCVKQFKDLPACQEVASEIRTKIEAFRPFIPLIRSLRNPGMRNRHWELLSERININM-RSRANLTFSLCLELGLQDHVEEITRVAQEAGKEYSIEQALNKMEEEWSTVMFEVMPYKET-GTYILKSPDEASQLLDDHIVMTQSMAFSPYKKPFEERISKWESKLKMTQEVLEEWLICQRSWLYMEPIFSSDDINRQLPVEGKRYQTMERTWRNIMKAAHDNNRVIEVCPEARLLASLKDCNNLLELVQKGLSDYLETKRSAFPRFYFLSDDELLEILSQTKDPTSVQPHLRKCFENIARLHF---------QSDLL--------------ITRMYSSEGEEVHLSVPVSPTGNVEHWLREVENSMKASVRDNISRSLQAYHP--RTEWVLSWPGQVVIAGCQTFWTQEVSESLNKGDLADRLYPQLQ------KQLGDLVKLVRGQLSKMQRAILSALIVIEVHAKDVAAKLVEEEVSSVNDFEWISQLRYYWRHDL---YIRAVNAEFLYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFIAMGKFLKGLASSGAWACFDEFNRIDVEVLSVVAQQITTIQKAQQQRVKTFVFEGMEIALVSSCAVFITMNPGYAGRTELPDNLKALFRPVAMMIPDYAMIAEISLYSFGFSDAKVLSKKITSTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPDMNEELICLRAIRDVNVPKFLQDDLKLFNGIVSDLFPKIREEPIDYGTLDESIRNVCANKCLKDVDGYITKCIQLYETTVVRHGLMLVGPSGSGKTRCYEVLAAAMTALKGQP-SVSGGEYEAVQTYVLNPKSITMGQLYGEFDQLTHEWTDGILSCLIRDGASSMEQEKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLSDAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRTIPDMFR-PYADQINSLFTRFLQDSIRFVRESIKEVITSMDSNLTCSLLKLLDCFFQPFIPREGKKPHSQEKLSRLQELIEPWFIFALIWSVGATGDANSCQRFSVWLRGKMIQLCFPEEGAVYDYNLDDAGISCFDDEDGEGKERKVQWVSWMKYAQEVVITPETRYSDIIVPTVDTVRMSFLIDMLLSNKNPVLCIGPTGTGKTLTISDKLLKNMP--AEYITHFLMFSARTSANQTQDYIDSKLDRRRKGVFGPPLGKYFIFFIDDLNMPMLETYGAQPPIELLRQWMDHGGWYDRKQIGTFKNLVDINFACAMGPPGGGRNPITQRFTRHFNFLSFTEMEDASKGKIFSTILGSWMRE--QLLSGLSHEEPCGSKRYMLCPLVDATIRVYSTITSALLPTPAKSHYTFNLRDLSKVFQGILMAEAGKIENKIQLLQLWYHESCRVFQDRLVSEEDRSWFDQLLHNHIKK-FGCEIE-EVVPYQPILYGDFMFPGAVK---VYQLIQDREKLARVMEEYLDDYNQTSTSKMKLVLFMDAIQHVCRISRILRQPLGNALLLGVGGSGRQSLTRLATHIAEYECFQIELSKNYGLLEWREDIKSIMLKAGMQNVQITFLFVDTQIKSESFLEDVNNILNSGDVPNLYTSEEQERILTAMKPVVQDMG-QQPTKANLMAAYVNRVRSNIHTVLCMSPVGEVFRARLRQFPSLVNCCTIDWFSAWPQEALESVATSFLNELPELESNPKTIQSLALMCVEIHQMVSRKCEQYLAELSRHNSVTPKSYLELLSIFSSLIGQKKQELHSARQRMKTGLDKLLSTAEDVAKMQEELEMMRPQLEEAAKDTVITMEKIKEDTVVAEETRVAVQAEETKATEKARVAQAIADDAQKDLNEALPALDAALASLQSLKKNDVVEVRAMQRPPPGVKLVIEAVCILKGIKPKKVAGEKLGEKVDDYWDAGKGLLQDPGKFLESLFKYDKDNIPDSVIKQVQPYMDNPEFHPDSIAKVSKACTSICQWVRAMHVYHFVARAVEPKRQALQEAQEDLAVTQRILDDAKGKLAAVEEGIATLQAKYHECLAKRDELDAKCQLCENRLIRADKLIGGLADEKVRWSETVQQLEYMVNNVAGDVLLAAGYVAYLGPFTGEYRSAMAEEWLRGFKDLAVPHTEQPNLISTLGDKVKIRSWQIAGLPKDSLSVENGVIAQYSQRWPLFIDPQGQANKWIKNMERDNRLDVMKLSDRDFLRSLENAIRFGKPCLLENVGEELDPALDPVLLRQTYTHEGNTVLKLGDTIIHYHDDFKMYITTKLPNPHYSPEISTKVTLINFTLSPSGLEDQLLGRLVAEERPDLEGAKNQLIVSNAQMKQELKEIEDQILFRLSSSEGNPVDDEELIKVLGASKVKAEEIQAKVTAAEATERDIDATRLEYVPVAVRAQILFFCVSDLSNVDPMYQYSLEWFLGIFMGGIVNSKQADAVIERILNINEFFTFSLYSNVCRSLFEKHKLMFAFLLCARILTNDSKIDMAEWRYMLSG-GQTQQQTP-NPAPNWLSTRAWQDILALS-ALPSFSNLPQSFSK------------------------------HESAFKSIFDSSQPHREPLPGEWESQLDSFQKLLILRCLRADRLTHGLQDFVSSQLGQRFIEPQTSDLSVVFKESSPSTPLIFVLSPGTDPAADLYKFAEIMKFSKKMNAISLGQGQG 3615          

HSP 2 Score: 476.863 bits (1226), Expect = 7.270e-134
Identity = 253/593 (42.66%), Postives = 358/593 (60.37%), Query Frame = -3
Query:   75 YMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPD-GVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYE-PESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALIC 1844
            + +++ AISLGQGQGP AE MM +A + G WVF QNCHLA SWM  LE +++  + +P +VH +FRL+L+S+P+  FP+S+LQN  K+T EPP+G++AN+ + +  ++  F  +      ++ L+  +C FH   ++R+KFGPLG+NI YEF+D D    I  L MF  +   I +  L Y   EI YGGRVTD WD+RC+ NIL  F+ P  +   + YS SG Y     +  N Y  +   LP+ + PEIFG+H+NAN+SF   ET  L+ T++ +QPR+AA G G++ ++ + E   + +  LI+        P ++         S+ TVL+QEV R+N+LLSVI  SL  L KA+KG VVMS ELE +  +   N VP +W   AYPSLKPL++WV DL  R      W+  G P  FW+ GFFFPQ FLTGTLQN+AR     ID ++F+F +    R+ E                    L+  PD G  +HGL+++G RWD + GQ+  S   E+   + ++ M+P  + + P+S  Y+ P+YKT  RAG LSTTG STN+V+AV LPTD+    WI  G ALIC
Sbjct: 3601 FSKKMNAISLGQGQGPSAEVMMHSAMEKGKWVFFQNCHLAPSWMPSLERLIE--NIDPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGIKANLLKTYASVTEDFITSCTKTAEFKSLLLSLCLFHGNAIERRKFGPLGFNIPYEFTDGDLNICISQLKMFLDEYQDIPYKVLKYTAGEINYGGRVTDNWDRRCILNILEDFYQPIVLSPHHIYSPSGDYRQIPTDN-NGYLTYFRGLPINDSPEIFGLHDNANISFAQNETFALLGTLVKLQPRVAASG-GKSREEEIVEGIVEKIPDLINVQQVMNKYPVMYE-------ESMNTVLVQEVIRYNRLLSVISQSLSDLVKALKGLVVMSSELELMSNSLFINAVPEIWKAKAYPSLKPLASWVSDLVQRIGFLQNWISDGIPAVFWISGFFFPQAFLTGTLQNFARGSVVSIDTIAFDFKLLTARRSSE--------------------LTERPDIGCFIHGLFLEGARWDADTGQLAESRPKELYTEMAVIWMVPVPNRKTPQSGVYLCPIYKTLTRAGTLSTTGHSTNYVIAVELPTDRTQGHWIKQGVALIC 4162          
BLAST of SMED30008756 vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2145.16 bits (5557), Expect = 0.000e+0
Identity = 1175/2933 (40.06%), Postives = 1743/2933 (59.43%), Query Frame = -2
Query: 1855 IGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNA----IDKALADRDGNIDKFCASLDKDI----AELRREVKDIRQAI--NNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKN-------FKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQD--LNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPV-FKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDE-LKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSG-WIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIE-KKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAK 10569
            +  +L+D + +K  +L           ++L ++A  ++  L    Q+    L   P    D   +L  L  +Q  +  +E +   I E Y ++  + V   P   AV + L      A NA      + + D D  + K   ++   +     E +++ +   Q+   N P    V  +              ++EL+ +    K  ++N       F +EQ   +D+  +  ++   Q +W+   +W+  + EW       L  E +        K + +L +       ++V   K ++EQ ++ + +IT+L N  L+ERHW QI   +   F  S    TL K++ L +  + E + +ISG AS E S+E  L+ + + W+     + PHKD K    L GTDE+ Q  +D+ + ++ I +SR V   +  VD W + L L  + IE  L  QR W+YLE+IF A DI++QL  E   F +V  S+K IM ++ K   A+R T  PGLL+     N  L++IQK L+ YLE+KR IFPRFYFLSND+LLEIL Q+RNP AVQPHL+KCFD I  L      T     + GM                   S +GE V     +   G VE WL  VE  M   L+  LR        +  +R +W++    Q+++T  Q+ W  ++T  L    +ER        +K  Q   LN+ +  +RG L K+ R  + AL+TV VHARD+++++ K    D+N F+W  QLR YW+  +D+C++R +N+ + YGYEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL KSL    +V NCS+GLD+K MGR +SGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A +A ++ F FEGR+I L+ +C  FITMNPGYAGRTELPDNLK++FRPI+M+VPD  LIAE+ L++EGF + K LA+K+  +Y L  +QLS+QDHYDFG+RAL S+L  AG+ +R  PD  ++ +L+ +++D N+ K    D  LF  I+QDLFP VE P  DYG+ K  +E  +  SGLQ+ P  V KVIQ YET   RH  M+VG TG GKT  +  L   LS L+  G     P +  ++   LNPK++++GELYGE N  T EW DG++  ++R+ C D   D +W++ DGPVD LWIE+MN+V+DDNK+L L N ERI +   V +LFEV+DLSVASPATVSRCGMVY D  +LGW P+V++W   M  + K+E  D L+ +FE+YID  L F +T C + +A   +  + ++CRL +SL           D++     + + F+F  +W +  ++ E      D F+R   E  G    P++  ++  Y D  ++    +E  +P  +++    PF++++VPTVDT+R+ YL++ L+  +  VL TG  G GK+ VA+  L ++ +N  +  + +N S+QTSSN  QE+IE+++EK+ K V      K++++F+DDLNMP +D +GSQPP+ELLR + D+G +YDR K     I+D+ L  + GPPGGGR  +S RL   F + ++  P+E  +++I+ ++++    +F ++V+     +  A +E+Y+ + +  LPTPAK HY+FNLRD+SK  QG+L+        K  + +L+ HE  RVF DRL++H D   F  +++E  + +F          K P +FGDF++       ++YE L DF  +K  + + L+D+N+      M LV F DAIDH+ R+ R+I Q RGN LLVG+GG+G+QSLTRLAA++  +  FQ+E+ + Y    F  D+KK+Y  TG+ N+ TVFLF DTQIV E FLEDINNIL+SGEVP+L++ DE + +      +A++  + E   D +F + I RVRNNLHIVLCMSPVG  FR+R R +P+LVNC TIDWF+ WP +ALL VA+   + + +G D+ ++ K+A +   +H SVA+ S R   ELKRH Y TPT+YLEL++ Y  +L+EK+ +L  +  +++NGL KI +T   +  M VEL   + ++ + QK  E  +  +   + +AD  +  V       + +  + +A+A++AQRDLDEA+PALE A+KAL++L+K D+ EI+ +  PP +V+TVM++V +L G +  WA AK  LG+  F+K+L ++ KDNI + +LK + +Y   P+F  E + +VS A +SL +WVRAM++Y +  + VEPK+ RL  A  +L E    L + Q +L  V  K+  L++ YD  + +K+ L         +L RAGKL + LA E+ RW E+V    + +  +VGD  + AA ++Y G F S++R EL++  W+ + RELE+P S   +    L     +R+WN +GLP D  STEN ++VTRG RWPLM+DPQ QA +WI+N E    LK+I L   +FLR LEN ++ G P LL+++ E LDP+L PIL K      GR L+ LGD +IEYS +F+ Y+TTKLSNPHY PEI  K TI+NF V  QGLE QLLG V R ERPELEEQ+++L+I I + K +LQ  E+ IL+LL E+ G++LD   L+NTL  SKVT+ E  +++  +ELTE +I  AR  Y P A R S+++FV+ ++  IDPMYQFSL  +  LF  +IE+S +S  LEERI  L    T A Y    RGLFE  KL+FSF +C +I+  +G ++  E+ FFLRG   ++ KK+ + P   W+S + W+N+ +           ++ +T  H      EL  S  +   D +        E+A             L G ++      QK+++V++  ++++ LC+T FV  NLG++FVEPP  D+  +  D +  +PL+FVLS G DP     + A+
Sbjct: 1088 VQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASSKLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDP---AVLELL-----EALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEEFQKKTQTFLQSFSSNGPFGSSVTPHSAL---------QQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSSKSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIVALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKD-KGHHKLRGTDEVFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGM------------------FSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKMPGKRGKWVRDWPGQMLITASQIQWTTDVTRALM-TSKERADKSALKSLKKKQVSMLNQYSEAIRGNLTKILRLKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSFEGRQINLIWSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRARPDIVDEEILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNG----EPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSW---MEKRQKVET-DLLWQLFERYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVK-PADSENYGRMVELWFIFSLIWSVCASVDEEGRKKIDTFLR---EIEGS--FPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFYKIMVPTVDTVRYHYLVKALVSTQHPVLLTGPVGTGKTSVAQSVLQSL-DNITWATLTVNMSSQTSSNNVQEIIESRVEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIYGTMISQKLQEFEEEVKPIGGILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLR-----ESQIYEDLLDFKALKVHMENQLEDYNLTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILE-TPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITE-----------LDKLTNFH------ELMASFEQYPRDWHHWYTNPEPEKA------------PLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAE 3933          

HSP 2 Score: 399.438 bits (1025), Expect = 2.466e-110
Identity = 228/595 (38.32%), Postives = 336/595 (56.47%), Query Frame = -3
Query:   78 ERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTI-VEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGT---GRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKS-FWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMP-KMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQ-ESNFWINMGAALI 1838
            +R  A+SLGQGQ P+A +++      G WVFL NCHL+ SWM  L+++V +      E H +FRL+LSS P   FPI++LQ  +K+T EPP+G++ N+KR +  +S   F      L++RKL+F +CFFHS+IL+R+KF  LGWNI Y F+DSD E +   L ++  +   I WDAL ++ A I YGG VTD WD+R L   +  +F P  I    +K S    YY P   + + Y D++  LP LE PE+FG + NA+++ QI E + L +T+L +QP++ +  T   G + +D V EL+  +L+K+  +I+ E  +  L     K  L+ L  VL+QE+ R+N LL  I+ SL++L+K IKG VVMS  LE  +    + +VP LW   AYPSLKPL++W +DL  R      W     P   FWL GF FP GFLT  LQ+ AR+ +  +D LS+EF V                      +E +  L  P DGVL+ GL+++G  WD +   ++ +   +++  +P +H  P +         Y  P Y    R+G   ++G  + FVVAV L +     + WI  G AL+
Sbjct: 3939 QRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQ--ECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYEEIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTPFFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAGASREDKVLELSADVLQKIPAEIDYEGTRKLL-----KDDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEK-AYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFWLSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSV--------------------TTVEDNNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYSCPCYYYPVRSG---SSGRQS-FVVAVDLKSGAVPYDHWIKRGTALL 4501          
BLAST of SMED30008756 vs. Ensembl Xenopus
Match: asxl2 (ASXL transcriptional regulator 2 [Source:Xenbase;Acc:XB-GENE-996283])

HSP 1 Score: 4145.5 bits (10750), Expect = 0.000e+0
Identity = 2025/3265 (62.02%), Postives = 2535/3265 (77.64%), Query Frame = -2
Query: 2317 KIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDY-----FIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWIS 12093
            ++I I++E   + FLYLT  + K   +Y  YNL++ ++ N+ K ++Y +S NG THI  G E+ ++ ++R++ EY  +  +K+IPTF  FR WKAF  WRK ++  + ++C K L  +LFI+N  LRPA+LN++EMC+RISDMGLC++EK  TY+L +F   Q+ QL EVA++L+EFR+L +EV+RSACRT+LLE GF PD+Y     +I+      +           +   + + ++                     L +FIRLADYLIVNTMH+LAVNSV TLL Y+ ++LK TP+   I  +         N   ++ S  E++V V P     IE      EE    + P+F+TE VL  Q L F P  + FQE I EV+ +FQ  VLS+ NLVPD+YFD+FTKP INNK EEKTCG+GP+++ MF +D HL  +I+Q  + I  AF+A   YA TF     F+++NE+ DL+A++  +  V+FF E   +Y++E      I++ + IG++L+DA K+K+ ++PSP+RCL+ IN+MLP++A+K+ DA+I E+ DA++ L + PT T+DYVN+L FL EIQ R+E LE E +++  MY LID + VPTPPEDFAVY TL PSI   +NAIDK++ +RDG+I+KFC SLDKDIAEL +EVK++RQ   +P ILD+ A++ +VK+ L  L   +NELQT AF YK+YQKNFKVE  + E LEEV AE+KLKQ+LWDSL EWD   +EW++  F  L+PE + +   KY K   QLEKGLPPN VVP+LK+KVE M+EK+ VIT+L NP L+ RHW  +E  IN    ++E  L+L KLIE++ FDY + +++ISGQAS EASLE ++KKVE++W+ TE+  +PH+DSKDVFILGGTD+IQ L DDS IN++TIASSR+VGPIK RVDEW + L LF +T++EWL CQRNWLYLESIFSAPDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T PGLL++F+NNN LLDQIQKCLEAYLESKR +FPRFYFLSNDELLEILAQTRNP AVQPHLRKCFD+I+KL+FA++        +G       QEV +TNDILAM+SPEGEKV+LGKGLKARGNVE+WLGKVEEAMF +LR+L + +I ++    R EW+ A H +Q+VLT+ Q+MWCR+++  LE   E+ L  + +FE   F+ LN LAGLVRG LP L R  + ALIT++VHARD+V+++VK+KV  I  FEWQ+QLRYYWD  LDNCV RM+ S YTY YEYLG  PRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKA+K+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRP +MMVP+Y LIAEVILYSEGFESSK LA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENP+  EDVVLIRALRDSNLPKFL  DAELF  I+ DLFPGV +PEHDYG  +  I   + N GLQ  PS V KVIQ +ET+ VRHGVMLVGPTGGGKTTVY +LA  L  L  AG  E  P YQ VK YILNPKSITMGELYGEVN LTLEW DGLM   VR    DTS+DH+W+ICDGPVDALWIENMNTVLDDNKMLCLANSERIK TP +HM+FEVQDL VASPATVSRCGMVY+D EEL WMP+V+TW++ ++ K+ + + +Y+  +F++Y++DGLKF   KC+Q ++QV I+K+ T+C LLESLL+G G P+L +D  +LN  +   FVFCYLW +GGNL E+ WD+FD FVR +FEDN + ++P+ GDLWS Y D  ++++D WE+I+P FK++  VPFFEM+VPT DT+R+GYL+EKLL V+ SVLFTG TGVGKSVVARG LN I E AGYVPV+INFSAQTSS+RTQE+IE+KLEKKRK +LGAP NKRVIIF+DDLNMPKLD YGSQPPIELLRQYQDFGGFYDR+K+ W  IQD+T++AAC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF SIL GF ADFP+ V+    NIV AAVEIY+RM  DLLPTPAKSHYVFNLRDLSKC+QGILQCDP  VRDK+ +F+LFCHE QR+FHDRLIN+EDK +FH++++EMASK+F   I+PE F+  PIIFGDF K G++K +++YE LTD  K+K++L  YLDD+N+ ++K++KLVFF DA++H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA + GY CFQIEL RGY+Y+ FH DL+K+Y+  G+ +++ VFLFTDTQ+ +         IL +          E  ++++   +    +  S      +F++ I+RVR  LHIVLCMSPVG +FR+RCRMFPSLVNCCTIDWF  WP+EALL+V++  F ++D+G + +K K + MC EIH SV   +E++Y+EL+R YYTTPTSYLELI LYLSML EK+ QLV+ RDRVKNGL+K+LETN L+  M+VEL AL P L+QK  D +ALM+KL  DQE AD VR  VKEDEAVAKVKA+ETQAIADDAQRDLDEAMPALE A KALD+LDK DI+EIRVFT PP +V TVME++C+LL  K DW++AK +LGD  FLK+L +Y K+NI   +L KL++Y+++P+F  E VEKVSKACRS+ +WVRAMD+YS+ +K VEPKK++L  A  ELD  M  LR KQ +L +VE +I  LQ  YD S++EK++L   +ALT ARL RAGKLT+AL DE+ RW ES++ F EE+ NV+G+VF+ AACVAY+GAFT+ YR  L+  WI +C+ELEIP+S + +L+ +LGDA+E+RQWN++GLPRD +STEN ILVTRGRRWPLMIDPQ+QANRWIRNKE  N LK+IKL++  FLRTLEN IRLG+P LLE++ ETLDPALEPIL KQTF   GRTLI LGDSDI+Y K+F+ Y+TTK+ NPHY+PE+CIKVTIINFTVT  GLEDQLL +V R+ERP+LEEQRN LIIRIN+DKNQL+  E+RILKLLF SEGNILD+EDLINTL ESK+TS     R+ EAE TE+ I  AR KY PVA +GSV+YFV+A+++EIDPMYQ+SLKYFK LFN TIE ++KS DL+ R+  LL++T  + Y NV+RGLFE+ KL++SFMLC++IMR  G IS+ EW FFLRG  G++K+RP KP  P +S
Sbjct:  175 QMIKIVQENKHLGFLYLTPAVPKSSIDYDTYNLRIATHQNINKNEYYTMSENGVTHISDG-EVLYLEIERWKQEYLYHKALKQIPTFALFRKWKAFTVWRKNVRAKRINECRKALQENLFIVNEYLRPAILNIQEMCYRISDMGLCRIEKEYTYSLHEFTGNQLKQLEEVANRLSEFRDLAKEVVRSACRTALLEAGFTPDEYIEIHLYINCLIWFTFHLTYVFKECKELFNVFSLSLFV-------------------YLKSFIRLADYLIVNTMHILAVNSVNTLLMYLVEKLKCTPSDTIIKTW---------NSQKQEAST-EKKVNVIPNAGGQIE------EE----VVPMFLTEIVLDTQALWFEPSLDDFQENIAEVVNQFQEIVLSLPNLVPDSYFDAFTKPTINNKLEEKTCGDGPTLSTMFDDDKHLQTIISQIKETIQYAFDAAQVYAGTFERFLIFFKENENLDLEAMKKEEPGVDFFAEKLEKYNKEHNDALAITQNRNIGLLLIDAKKLKEKLIPSPKRCLEAINDMLPILAKKKTDAVIAEALDAQFKLQSLPTTTIDYVNSLIFLDEIQERIEVLEEECNIVSHMYQLIDNYKVPTPPEDFAVYATLQPSITAVRNAIDKSVGERDGSIEKFCHSLDKDIAELNKEVKEVRQ--KDPQILDLAADQVKVKQILADLHTVLNELQTCAFQYKTYQKNFKVEVTKYEALEEVCAEVKLKQLLWDSLAEWDVLQDEWMQSNFEALDPEQVNSLVLKYAKFATQLEKGLPPNNVVPLLKEKVENMKEKVPVITDLRNPFLKPRHWAALEQTINAALIDTEHPLSLQKLIEIHAFDYAQAIQDISGQASGEASLETIIKKVEDSWKATEFTAIPHRDSKDVFILGGTDDIQVLLDDSIINISTIASSRYVGPIKSRVDEWQRQLSLFNETLDEWLTCQRNWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLESFQNNNALLDQIQKCLEAYLESKRAVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSIAKLEFAVS------PGEG------EQEVVFTNDILAMLSPEGEKVNLGKGLKARGNVEDWLGKVEEAMFASLRRLSKAAIADYQNKTRVEWVVAGHPSQVVLTISQLMWCRDLSHCLEGECEDNLHSLAEFEKVNFERLNALAGLVRGHLPTLHRNIITALITIDVHARDIVSDLVKDKVDSIESFEWQRQLRYYWDLDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKASKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFSMMVPNYALIAEVILYSEGFESSKVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLNEDVVLIRALRDSNLPKFLTDDAELFSGIISDLFPGVHIPEHDYGTLQSTIINAMINRGLQPVPSMVDKVIQLFETMIVRHGVMLVGPTGGGKTTVYQILADALGTLFKAG--ETHPFYQLVKTYILNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSKDHKWIICDGPVDALWIENMNTVLDDNKMLCLANSERIKFTPQIHMVFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWISGLSAKVSVCIAEYVLALFDRYVEDGLKFVNKKCVQAISQVDISKVTTLCCLLESLLLGKGGPDLQMDPSRLNSIVCQTFVFCYLWSVGGNLTENYWDAFDTFVRQQFEDNPEAKLPNSGDLWSVYMDYDTKRLDPWERIIPSFKYSNNVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVVARGLLNRIQEEAGYVPVYINFSAQTSSSRTQEIIESKLEKKRKTILGAPGNKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDVTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSEHSLKQIFQSILNGFLADFPEAVKQAATNIVDAAVEIYHRMSIDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGSVRDKTQIFRLFCHECQRIFHDRLINNEDKQYFHEMLSEMASKHFAVQIDPEYFVTKPIIFGDFTKVGVDKADKVYEDLTDMEKIKSVLQDYLDDYNLTNAKDVKLVFFQDAVEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCFQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQVSL---------ILQTSTC-------EQGKLLVSSFSLLPCSSSSY----YVFQYFISRVRQKLHIVLCMSPVGEAFRARCRMFPSLVNCCTIDWFVQWPKEALLSVSQKFFINIDLGSEGMKAKFSEMCVEIHMSVNTMAEKYYSELRRRYYTTPTSYLELINLYLSMLGEKRNQLVSARDRVKNGLSKLLETNVLVDKMKVELSALEPVLKQKSVDVDALMEKLSVDQENADQVRRIVKEDEAVAKVKAEETQAIADDAQRDLDEAMPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAICILLNAKPDWSAAKQLLGDSNFLKRLLEYDKENIKPQILLKLQKYVNNPDFVPEKVEKVSKACRSMCMWVRAMDLYSRVLKDVEPKKQKLAAAQAELDATMSTLRDKQQKLKSVEEQIKALQDQYDKSLSEKESLAKTMALTQARLNRAGKLTSALGDEQVRWKESIANFEEEISNVIGNVFIAAACVAYFGAFTAVYRQLLVDCWINKCQELEIPISPNFSLINILGDAYEIRQWNTDGLPRDHISTENGILVTRGRRWPLMIDPQDQANRWIRNKENKNGLKVIKLTDAGFLRTLENAIRLGLPVLLEELKETLDPALEPILSKQTFTSGGRTLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTRSGLEDQLLSDVVRIERPDLEEQRNQLIIRINSDKNQLKAIEDRILKLLFTSEGNILDNEDLINTLQESKITSGAIKTRLLEAEATEENINTAREKYRPVATQGSVIYFVIASLSEIDPMYQYSLKYFKQLFNMTIEAAEKSNDLDIRLATLLSQTLFSAYTNVSRGLFEQHKLIYSFMLCVEIMRHKGEISETEWNFFLRGAAGLDKERPTKPDVPGLS 3363          

HSP 2 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 368/600 (61.33%), Postives = 461/600 (76.83%), Query Frame = -3
Query:   72 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1871
            F+   K++ Y ERVQ+ISLGQGQGP+AEKM+  A K G W+FLQNCHLA SWM+ +EE++K  +E    ++ENFRLFLSSMP++TFP++VLQNSVKVTNEPPKGLRAN++RAF E++  FFE H+LG  WRK+IFGICFFH+I+ +RKKFGPLGWNI YEF+DSDRECA+LNL ++C +G I WDAL YIT EITYGGRVTD WDQRCLR IL  FF P+T+ ++Y YS SGIY+ P+ +++  +KD++++LPL ++PEIFGMHENANL+FQ +ET  LINTILDVQPR    G G++ D+IV ELA  IL KL DK++ E A   LF  D KGR+NSLTTVL QEVDRFNKLL V+KNSL  L KAI G VVMSEE+E +Y +F N+QVP LWS+ AYPSLKPL +WVKDL MR S    W+  G PKSFW+ G FFPQGFLTGTLQN+ARKY+  ID L+F + V   YR+Q  V + MK LKFGE +  D  L +P DGVLVHG+YMD  RWDDE   I  ++  +M  +LP++H  P  +Y P    Y +PLYKT  RAG LSTTG STNFVV V LP+++++++WI+ G+AL+C+
Sbjct: 3434 FQRFAKERGYSERVQSISLGQGQGPIAEKMIKDAMKTGHWIFLQNCHLAVSWMLPMEELIKSFTEPNVSINENFRLFLSSMPSRTFPVTVLQNSVKVTNEPPKGLRANVRRAFTEITTTFFEEHLLGRKWRKVIFGICFFHAIVQERKKFGPLGWNICYEFNDSDRECALLNLNLYCQEGKIPWDALLYITGEITYGGRVTDAWDQRCLRTILRRFFSPETLEDNYCYSTSGIYFSPDADSLQSFKDYIENLPLTDDPEIFGMHENANLAFQRKETNTLINTILDVQPRSTTQGGGKSNDEIVRELATSILSKLPDKLDMEVASEMLFVKDAKGRVNSLTTVLGQEVDRFNKLLKVLKNSLETLNKAIAGLVVMSEEMEKIYKSFLNSQVPTLWSDAAYPSLKPLGSWVKDLVMRISFIDAWIRIGQPKSFWISGLFFPQGFLTGTLQNHARKYNLAIDELNFHYNVLPQYRDQATVTEAMKTLKFGEELPMDAVLPAPEDGVLVHGMYMDACRWDDEAMVIEDALPRQMNPMLPVIHFEPHQNYNPSGDLYQAPLYKTSARAGTLSTTGHSTNFVVTVLLPSNRQNDYWISKGSALLCQ 4033          

HSP 3 Score: 86.2705 bits (212), Expect = 1.596e-15
Identity = 40/80 (50.00%), Postives = 50/80 (62.50%), Query Frame = -2
Query: 1786 IVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 2025
            +V  +TEFV   LG +F+E PP DL  L+QDMS  +PL+F+LSTGSDPM  FQRFAKE+    +  S   G   G    K
Sbjct: 3383 VVFAVTEFVINTLGKKFIENPPIDLATLYQDMSPSTPLIFILSTGSDPMGAFQRFAKERGYSERVQSISLGQGQGPIAEK 3462          
BLAST of SMED30008756 vs. Ensembl Xenopus
Match: asxl2 (ASXL transcriptional regulator 2 [Source:Xenbase;Acc:XB-GENE-996283])

HSP 1 Score: 4006.83 bits (10390), Expect = 0.000e+0
Identity = 1984/3260 (60.86%), Postives = 2470/3260 (75.77%), Query Frame = -2
Query: 2317 KIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWIS 12093
            ++I I++E   + FLYLT  + K   +Y  YNL++ ++ N+ K ++Y +S NG THI  G E+ ++ ++R++ EY  +  +K+IPTF  FR WKAF  WRK ++  + ++C K L  +LFI+N  LRPA+LN++EMC+RISDMGLC++EK  TY+L +F   Q+ QL EV  K          V+ + C    +   F     F+  T  P          S  ++   D +++ E+ DKMTYTEQANKR HC+RLT FIRLADYLIVNTMH+LAVNSV TLL Y+ ++LK TP+   I  +         N   ++ S  E++V V P     IE      EE    + P+F+TE VL  Q L F P  + FQE I EV+ +FQ  VLS+ NLVPD+YFD+FTKP INNK EEKTCG+GP+++ MF +D HL  +I+Q  + I  AF+A   YA TF     F+++NE+ DL+A++  +  V+FF E   +Y++E      I++ + IG++L+DA K+K+ ++PSP+RCL+ IN+MLP++A+K+ DA+I E+ DA++ L + PT T+DYVN+L FL EIQ R+E LE E +++  MY LID + VPTPPEDFAVY TL PSI   +NAIDK++ +RDG+I+KFC SLDKDIAEL +EVK++RQ   +P ILD+ A++ +VK+ L  L   +NELQT AF YK+YQKNFKVE  + E LEEV AE+KLKQ+LWDSL EWD   +EW++  F  L+PE + +   KY K   QLEKGLPPN VVP+LK+KVE M+EK+ VIT+L NP L+ RHW  +E  IN    ++E  L+L KLIE++ FDY + +++ISGQAS EASLE ++KKVE++W+ TE+  +PH+DSKDVFILGGTD+IQ L DDS IN++TIASSR+VGPIK RVDEW + L LF +T++EWL CQRNWLYLESIFSAPDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T PGLL++F+NNN LLDQIQKCLEAYLESKR +FPRFYFLSNDELLEILAQTRNP AVQPHLRKCFD+I+KL+FA++        +G       QEV +TNDILAM+SPEGEKV+LGKGLKARGNVE+WLGKVEEAMF +LR+L + +I ++    R EW+ A H +Q+VLT+ Q+MWCR+++  LE   E+ L  + +FE   F+ LN LAGLVRG LP L R  + ALIT++VHARD+V+++VK+KV  I  FEWQ+QLRYYWD  LDNCV RM+ S YTY YEYLG  PRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKA+K+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRP +MMVP+Y LIAEVILYSEGFESSK LA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENP+  EDVVLIRALRDSNLPKFL  DAELF  I+ DLFPGV +PEHDYG  +  I   + N GLQ  PS V KVIQ +ET+ VRHGVMLVGPTGGGKTTVY +LA  L  L  AG  E  P YQ VK YILNPKSITMGELYGEVN LTLEW DGLM   VR    DTS+DH+W+ICDGPVDALWIENMNTVLDDNKMLCLANSERIK TP +HM+FEV+ L                       MP +KT   S +                                ++   S  K+  +C  L+           +V   KLN  +   FVFCYLW +GGNL E+ WD+FD FVR +FEDN + ++P+ GDLWS Y D  ++++D WE+I+P FK++  VPFFEM+VPT DT+R+GYL+EKLL V+ SVLFTG TGVGKSVVARG LN I E AGYVPV+INFSAQTSS+RTQE+IE+KLEKKRK +LGAP NKRVIIF+DDLNMPKLD YGSQPPIELLRQYQDFGGFYDR+K+ W  IQD+T++AAC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF SIL GF ADFP+ V+    NIV AAVEIY+RM  DLLPTPAKSHYVFNLRDLSKC+QGILQCDP  VRDK+ +F+LFCHE QR+FHDRLIN+EDK +FH++++EMASK+F   I+PE F+  PIIFGDF K G++K +++YE LTD  K+K++L  YLDD+N+ ++K++KLVFF DA++H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA + GY CFQIEL RGY+Y+ FH DL+K+Y+  G+ +++ VFLFTDTQ+ +         IL +          E  ++++   +    +  S      +F++ I+RVR  LHIVLCMSPVG +FR+RCRMFPSLVNCCTIDWF  WP+EALL+V++  F ++D+G + +K K + MC EIH SV   +E++Y+EL+R YYTTPTSYLELI LYLSML EK+ QLV+ RDRVKNGL+K+LETN L+  M+VEL AL P L+QK  D +ALM+KL  DQE AD VR  VKEDEAVAKVKA+ETQAIADDAQRDLDEAMPALE A KALD+LDK DI+EIRVFT PP +V TVME++C+LL  K DW++AK +LGD  FLK+L +Y K+NI   +L KL++Y+++P+F  E VEKVSKACRS+ +WVRAMD+YS+ +K VEPKK++L  A  ELD  M  LR KQ +L +VE +I  LQ  YD S++EK++L   +ALT ARL RAGKLT+AL DE+ RW ES++ F EE+ NV+G+VF+ AACVAY+GAFT+ YR  L+  WI +C+ELEIP+S + +L+ +LGDA+E+RQWN++GLPRD +STEN ILVTRGRRWPLMIDPQ+QANRWIRNKE  N LK+IKL++  FLRTLEN IRLG+P LLE++ ETLDPALEPIL KQTF   GRTLI LGDSDI+Y K+F+ Y+TTK+ NPHY+PE+CIKVTIINFTVT  GLEDQLL +V R+ERP+LEEQRN LIIRIN+DKNQL+  E+RILKLLF SEGNILD+EDLINTL ESK+TS     R+ EAE TE+ I  AR KY PVA +GSV+YFV+A+++EIDPMYQ+SLKYFK LFN TIE ++KS DL+ R+  LL++T  + Y NV+RGLFE+ KL++SFMLC++IMR  G IS+ EW FFLRG  G++K+RP KP  P +S
Sbjct:  186 QMIKIVQENKHLGFLYLTPAVPKSSIDYDTYNLRIATHQNINKNEYYTMSENGVTHISDG-EVLYLEIERWKQEYLYHKALKQIPTFALFRKWKAFTVWRKNVRAKRINECRKALQENLFIVNEYLRPAILNIQEMCYRISDMGLCRIEKEYTYSLHEFTGNQLKQLEEVNYK---------SVLITLCVIKAV-TCFMCSVRFLSMTAGPAV--------SDMLLPHLDGELFGESSDKMTYTEQANKRAHCRRLTCFIRLADYLIVNTMHILAVNSVNTLLMYLVEKLKCTPSDTIIKTW---------NSQKQEAST-EKKVNVIPNAGGQIE------EE----VVPMFLTEIVLDTQALWFEPSLDDFQENIAEVVNQFQEIVLSLPNLVPDSYFDAFTKPTINNKLEEKTCGDGPTLSTMFDDDKHLQTIISQIKETIQYAFDAAQVYAGTFERFLIFFKENENLDLEAMKKEEPGVDFFAEKLEKYNKEHNDALAITQNRNIGLLLIDAKKLKEKLIPSPKRCLEAINDMLPILAKKKTDAVIAEALDAQFKLQSLPTTTIDYVNSLIFLDEIQERIEVLEEECNIVSHMYQLIDNYKVPTPPEDFAVYATLQPSITAVRNAIDKSVGERDGSIEKFCHSLDKDIAELNKEVKEVRQ--KDPQILDLAADQVKVKQILADLHTVLNELQTCAFQYKTYQKNFKVEVTKYEALEEVCAEVKLKQLLWDSLAEWDVLQDEWMQSNFEALDPEQVNSLVLKYAKFATQLEKGLPPNNVVPLLKEKVENMKEKVPVITDLRNPFLKPRHWAALEQTINAALIDTEHPLSLQKLIEIHAFDYAQAIQDISGQASGEASLETIIKKVEDSWKATEFTAIPHRDSKDVFILGGTDDIQVLLDDSIINISTIASSRYVGPIKSRVDEWQRQLSLFNETLDEWLTCQRNWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLESFQNNNALLDQIQKCLEAYLESKRAVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSIAKLEFAVS------PGEG------EQEVVFTNDILAMLSPEGEKVNLGKGLKARGNVEDWLGKVEEAMFASLRRLSKAAIADYQNKTRVEWVVAGHPSQVVLTISQLMWCRDLSHCLEGECEDNLHSLAEFEKVNFERLNALAGLVRGHLPTLHRNIITALITIDVHARDIVSDLVKDKVDSIESFEWQRQLRYYWDLDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKASKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFSMMVPNYALIAEVILYSEGFESSKVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLNEDVVLIRALRDSNLPKFLTDDAELFSGIISDLFPGVHIPEHDYGTLQSTIINAMINRGLQPVPSMVDKVIQLFETMIVRHGVMLVGPTGGGKTTVYQILADALGTLFKAG--ETHPFYQLVKTYILNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSKDHKWIICDGPVDALWIENMNTVLDDNKMLCLANSERIKFTPQIHMVFEVKFLKN---------------------MPCIKTSPRSQS--------------------------------SITCYSKTKMDAICSNLDI---------WSVCKSKLNSIVCQTFVFCYLWSVGGNLTENYWDAFDTFVRQQFEDNPEAKLPNSGDLWSVYMDYDTKRLDPWERIIPSFKYSNNVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVVARGLLNRIQEEAGYVPVYINFSAQTSSSRTQEIIESKLEKKRKTILGAPGNKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDVTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSEHSLKQIFQSILNGFLADFPEAVKQAATNIVDAAVEIYHRMSIDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGSVRDKTQIFRLFCHECQRIFHDRLINNEDKQYFHEMLSEMASKHFAVQIDPEYFVTKPIIFGDFTKVGVDKADKVYEDLTDMEKIKSVLQDYLDDYNLTNAKDVKLVFFQDAVEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCFQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQVSL---------ILQTSTC-------EQGKLLVSSFSLLPCSSSSY----YVFQYFISRVRQKLHIVLCMSPVGEAFRARCRMFPSLVNCCTIDWFVQWPKEALLSVSQKFFINIDLGSEGMKAKFSEMCVEIHMSVNTMAEKYYSELRRRYYTTPTSYLELINLYLSMLGEKRNQLVSARDRVKNGLSKLLETNVLVDKMKVELSALEPVLKQKSVDVDALMEKLSVDQENADQVRRIVKEDEAVAKVKAEETQAIADDAQRDLDEAMPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAICILLNAKPDWSAAKQLLGDSNFLKRLLEYDKENIKPQILLKLQKYVNNPDFVPEKVEKVSKACRSMCMWVRAMDLYSRVLKDVEPKKQKLAAAQAELDATMSTLRDKQQKLKSVEEQIKALQDQYDKSLSEKESLAKTMALTQARLNRAGKLTSALGDEQVRWKESIANFEEEISNVIGNVFIAAACVAYFGAFTAVYRQLLVDCWINKCQELEIPISPNFSLINILGDAYEIRQWNTDGLPRDHISTENGILVTRGRRWPLMIDPQDQANRWIRNKENKNGLKVIKLTDAGFLRTLENAIRLGLPVLLEELKETLDPALEPILSKQTFTSGGRTLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTRSGLEDQLLSDVVRIERPDLEEQRNQLIIRINSDKNQLKAIEDRILKLLFTSEGNILDNEDLINTLQESKITSGAIKTRLLEAEATEENINTAREKYRPVATQGSVIYFVIASLSEIDPMYQYSLKYFKQLFNMTIEAAEKSNDLDIRLATLLSQTLFSAYTNVSRGLFEQHKLIYSFMLCVEIMRHKGEISETEWNFFLRGAAGLDKERPTKPDVPGLS 3308          

HSP 2 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 368/600 (61.33%), Postives = 461/600 (76.83%), Query Frame = -3
Query:   72 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1871
            F+   K++ Y ERVQ+ISLGQGQGP+AEKM+  A K G W+FLQNCHLA SWM+ +EE++K  +E    ++ENFRLFLSSMP++TFP++VLQNSVKVTNEPPKGLRAN++RAF E++  FFE H+LG  WRK+IFGICFFH+I+ +RKKFGPLGWNI YEF+DSDRECA+LNL ++C +G I WDAL YIT EITYGGRVTD WDQRCLR IL  FF P+T+ ++Y YS SGIY+ P+ +++  +KD++++LPL ++PEIFGMHENANL+FQ +ET  LINTILDVQPR    G G++ D+IV ELA  IL KL DK++ E A   LF  D KGR+NSLTTVL QEVDRFNKLL V+KNSL  L KAI G VVMSEE+E +Y +F N+QVP LWS+ AYPSLKPL +WVKDL MR S    W+  G PKSFW+ G FFPQGFLTGTLQN+ARKY+  ID L+F + V   YR+Q  V + MK LKFGE +  D  L +P DGVLVHG+YMD  RWDDE   I  ++  +M  +LP++H  P  +Y P    Y +PLYKT  RAG LSTTG STNFVV V LP+++++++WI+ G+AL+C+
Sbjct: 3379 FQRFAKERGYSERVQSISLGQGQGPIAEKMIKDAMKTGHWIFLQNCHLAVSWMLPMEELIKSFTEPNVSINENFRLFLSSMPSRTFPVTVLQNSVKVTNEPPKGLRANVRRAFTEITTTFFEEHLLGRKWRKVIFGICFFHAIVQERKKFGPLGWNICYEFNDSDRECALLNLNLYCQEGKIPWDALLYITGEITYGGRVTDAWDQRCLRTILRRFFSPETLEDNYCYSTSGIYFSPDADSLQSFKDYIENLPLTDDPEIFGMHENANLAFQRKETNTLINTILDVQPRSTTQGGGKSNDEIVRELATSILSKLPDKLDMEVASEMLFVKDAKGRVNSLTTVLGQEVDRFNKLLKVLKNSLETLNKAIAGLVVMSEEMEKIYKSFLNSQVPTLWSDAAYPSLKPLGSWVKDLVMRISFIDAWIRIGQPKSFWISGLFFPQGFLTGTLQNHARKYNLAIDELNFHYNVLPQYRDQATVTEAMKTLKFGEELPMDAVLPAPEDGVLVHGMYMDACRWDDEAMVIEDALPRQMNPMLPVIHFEPHQNYNPSGDLYQAPLYKTSARAGTLSTTGHSTNFVVTVLLPSNRQNDYWISKGSALLCQ 3978          

HSP 3 Score: 86.2705 bits (212), Expect = 1.792e-15
Identity = 40/80 (50.00%), Postives = 50/80 (62.50%), Query Frame = -2
Query: 1786 IVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 2025
            +V  +TEFV   LG +F+E PP DL  L+QDMS  +PL+F+LSTGSDPM  FQRFAKE+    +  S   G   G    K
Sbjct: 3328 VVFAVTEFVINTLGKKFIENPPIDLATLYQDMSPSTPLIFILSTGSDPMGAFQRFAKERGYSERVQSISLGQGQGPIAEK 3407          
BLAST of SMED30008756 vs. Ensembl Xenopus
Match: asxl2 (ASXL transcriptional regulator 2 [Source:Xenbase;Acc:XB-GENE-996283])

HSP 1 Score: 3898.59 bits (10109), Expect = 0.000e+0
Identity = 1946/3260 (59.69%), Postives = 2430/3260 (74.54%), Query Frame = -2
Query: 2317 KIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWIS 12093
            ++I I++E   + FLYLT  + K   +Y  YNL++ ++ N+ K ++Y +S NG THI  G E+ ++ ++R++ EY  +  +K+IPTF  FR WKAF  WRK ++  + ++C K L  +LFI+N  LRPA+LN++EMC+RISDMGLC++EK  TY+L +F   Q+ QL EV  K          V+ + C    +   F     F+  T  P          S  ++   D +++ E+ DKMTYTEQANKR HC+RLT FIRLADYLIVNTMH+LAVNSV TLL Y+ ++LK TP+   I  +         N   ++ S  E++V V P     IE      EE    + P+F+TE VL  Q L F P  + FQE I EV+ +FQ  VLS+ NLVPD+YFD+FTKP INNK EEKTCG+GP+++ MF +D HL  +I+Q  + I  AF+A   YA TF     F+++NE+ DL+A++  +  V+FF E   +Y++E      I++ + IG++L+DA K+K+ ++PSP+RCL+ IN+MLP++A+K+ DA+I E+ DA++ L + PT T+DYVN+L FL EIQ R+E LE E +++  MY LID + VPTPPEDFAVY TL PSI   +NAIDK++ +RDG+I+KFC SLDKDIAEL +EVK++RQ   +P ILD+ A++ +VK+ L  L   +NELQT AF YK+YQKNFKVE  + E LEEV AE+KLKQ+LWDSL EWD   +EW++  F  L+PE + +   KY K   QLEKGLPPN VVP+LK+KVE M+EK+ VIT+L NP L+ RHW  +E  IN    ++E  L+L KLIE++ FDY + +++ISGQAS EASLE ++KKVE++W+ TE+  +PH+DSKDVFILGGTD+IQ L DDS IN++TIASSR+VGPIK RVDEW + L LF +T++EWL CQRNWLYLESIFSAPDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T PGLL++F+NNN LLDQIQKCLEAYLESKR +FPRFYFLSNDELLEILAQTRNP AVQPHLRKCFD+I+KL+FA++        +G       QEV +TNDILAM+SPEGEKV+LGKGLKARGNVE+WLGKVEEAMF +LR+L + +I ++    R EW+ A H +Q+VLT+ Q+MWCR+++  LE   E+ L  + +FE   F+ LN LAGLVRG LP L R  + ALIT++VHARD+V+++VK+K                                                    DRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKA+K+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRP +MMVP+Y LIAEVILYSEGFESSK LA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENP+  EDVVLIRALRDSNLPKFL  DAELF  I+ DLFPGV +PEHDYG  +  I   + N GLQ  PS V KVIQ +ET+ VRHGVMLVGPTGGGKTTVY +LA  L  L  AG  E  P YQ VK YILNPKSITMGELYGEVN LTLEW DGLM   VR    DTS+DH+W+ICDGPVDALWIENMNTVLDDNKMLCLANSERIK TP +HM+FEV+ L                       MP +KT   S +                                ++   S  K+  +C  L+           +V   KLN  +   FVFCYLW +GGNL E+ WD+FD FVR +FEDN + ++P+ GDLWS Y D  ++++D WE+I+P FK++  VPFFEM+VPT DT+R+GYL+EKLL V+ SVLFTG TGVGKSVVARG LN I E AGYVPV+INFSAQTSS+RTQE+IE+KLEKKRK +LGAP NKRVIIF+DDLNMPKLD YGSQPPIELLRQYQDFGGFYDR+K+ W  IQD+T++AAC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF SIL GF ADFP+ V+    NIV AAVEIY+RM  DLLPTPAKSHYVFNLRDLSKC+QGILQCDP  VRDK+ +F+LFCHE QR+FHDRLIN+EDK +FH++++EMASK+F   I+PE F+  PIIFGDF K G++K +++YE LTD  K+K++L  YLDD+N+ ++K++KLVFF DA++H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA + GY CFQIEL RGY+Y+ FH DL+K+Y+  G+ +++ VFLFTDTQ+ +         IL +          E  ++++   +    +  S      +F++ I+RVR  LHIVLCMSPVG +FR+RCRMFPSLVNCCTIDWF  WP+EALL+V++  F ++D+G + +K K + MC EIH SV   +E++Y+EL+R YYTTPTSYLELI LYLSML EK+ QLV+ RDRVKNGL+K+LETN L+  M+VEL AL P L+QK  D +ALM+KL  DQE AD VR  VKEDEAVAKVKA+ETQAIADDAQRDLDEAMPALE A KALD+LDK DI+EIRVFT PP +V TVME++C+LL  K DW++AK +LGD  FLK+L +Y K+NI   +L KL++Y+++P+F  E VEKVSKACRS+ +WVRAMD+YS+ +K VEPKK++L  A  ELD  M  LR KQ +L +VE +I  LQ  YD S++EK++L   +ALT ARL RAGKLT+AL DE+ RW ES++ F EE+ NV+G+VF+ AACVAY+GAFT+ YR  L+  WI +C+ELEIP+S + +L+ +LGDA+E+RQWN++GLPRD +STEN ILVTRGRRWPLMIDPQ+QANRWIRNKE  N LK+IKL++  FLRTLEN IRLG+P LLE++ ETLDPALEPIL KQTF   GRTLI LGDSDI+Y K+F+ Y+TTK+ NPHY+PE+CIKVTIINFTVT  GLEDQLL +V R+ERP+LEEQRN LIIRIN+DKNQL+  E+RILKLLF SEGNILD+EDLINTL ESK+TS     R+ EAE TE+ I  AR KY PVA +GSV+YFV+A+++EIDPMYQ+SLKYFK LFN TIE ++KS DL+ R+  LL++T  + Y NV+RGLFE+ KL++SFMLC++IMR  G IS+ EW FFLRG  G++K+RP KP  P +S
Sbjct:  186 QMIKIVQENKHLGFLYLTPAVPKSSIDYDTYNLRIATHQNINKNEYYTMSENGVTHISDG-EVLYLEIERWKQEYLYHKALKQIPTFALFRKWKAFTVWRKNVRAKRINECRKALQENLFIVNEYLRPAILNIQEMCYRISDMGLCRIEKEYTYSLHEFTGNQLKQLEEVNYK---------SVLITLCVIKAV-TCFMCSVRFLSMTAGPAV--------SDMLLPHLDGELFGESSDKMTYTEQANKRAHCRRLTCFIRLADYLIVNTMHILAVNSVNTLLMYLVEKLKCTPSDTIIKTW---------NSQKQEAST-EKKVNVIPNAGGQIE------EE----VVPMFLTEIVLDTQALWFEPSLDDFQENIAEVVNQFQEIVLSLPNLVPDSYFDAFTKPTINNKLEEKTCGDGPTLSTMFDDDKHLQTIISQIKETIQYAFDAAQVYAGTFERFLIFFKENENLDLEAMKKEEPGVDFFAEKLEKYNKEHNDALAITQNRNIGLLLIDAKKLKEKLIPSPKRCLEAINDMLPILAKKKTDAVIAEALDAQFKLQSLPTTTIDYVNSLIFLDEIQERIEVLEEECNIVSHMYQLIDNYKVPTPPEDFAVYATLQPSITAVRNAIDKSVGERDGSIEKFCHSLDKDIAELNKEVKEVRQ--KDPQILDLAADQVKVKQILADLHTVLNELQTCAFQYKTYQKNFKVEVTKYEALEEVCAEVKLKQLLWDSLAEWDVLQDEWMQSNFEALDPEQVNSLVLKYAKFATQLEKGLPPNNVVPLLKEKVENMKEKVPVITDLRNPFLKPRHWAALEQTINAALIDTEHPLSLQKLIEIHAFDYAQAIQDISGQASGEASLETIIKKVEDSWKATEFTAIPHRDSKDVFILGGTDDIQVLLDDSIINISTIASSRYVGPIKSRVDEWQRQLSLFNETLDEWLTCQRNWLYLESIFSAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLESFQNNNALLDQIQKCLEAYLESKRAVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSIAKLEFAVS------PGEG------EQEVVFTNDILAMLSPEGEKVNLGKGLKARGNVEDWLGKVEEAMFASLRRLSKAAIADYQNKTRVEWVVAGHPSQVVLTISQLMWCRDLSHCLEGECEDNLHSLAEFEKVNFERLNALAGLVRGHLPTLHRNIITALITIDVHARDIVSDLVKDK----------------------------------------------------DRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKASKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFSMMVPNYALIAEVILYSEGFESSKVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPNLNEDVVLIRALRDSNLPKFLTDDAELFSGIISDLFPGVHIPEHDYGTLQSTIINAMINRGLQPVPSMVDKVIQLFETMIVRHGVMLVGPTGGGKTTVYQILADALGTLFKAG--ETHPFYQLVKTYILNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSKDHKWIICDGPVDALWIENMNTVLDDNKMLCLANSERIKFTPQIHMVFEVKFLKN---------------------MPCIKTSPRSQS--------------------------------SITCYSKTKMDAICSNLDI---------WSVCKSKLNSIVCQTFVFCYLWSVGGNLTENYWDAFDTFVRQQFEDNPEAKLPNSGDLWSVYMDYDTKRLDPWERIIPSFKYSNNVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVVARGLLNRIQEEAGYVPVYINFSAQTSSSRTQEIIESKLEKKRKTILGAPGNKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDVTIAAACAPPGGGRNPVTPRFIRHFSMLCLPTPSEHSLKQIFQSILNGFLADFPEAVKQAATNIVDAAVEIYHRMSIDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGSVRDKTQIFRLFCHECQRIFHDRLINNEDKQYFHEMLSEMASKHFAVQIDPEYFVTKPIIFGDFTKVGVDKADKVYEDLTDMEKIKSVLQDYLDDYNLTNAKDVKLVFFQDAVEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCFQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQVSL---------ILQTSTC-------EQGKLLVSSFSLLPCSSSSY----YVFQYFISRVRQKLHIVLCMSPVGEAFRARCRMFPSLVNCCTIDWFVQWPKEALLSVSQKFFINIDLGSEGMKAKFSEMCVEIHMSVNTMAEKYYSELRRRYYTTPTSYLELINLYLSMLGEKRNQLVSARDRVKNGLSKLLETNVLVDKMKVELSALEPVLKQKSVDVDALMEKLSVDQENADQVRRIVKEDEAVAKVKAEETQAIADDAQRDLDEAMPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAICILLNAKPDWSAAKQLLGDSNFLKRLLEYDKENIKPQILLKLQKYVNNPDFVPEKVEKVSKACRSMCMWVRAMDLYSRVLKDVEPKKQKLAAAQAELDATMSTLRDKQQKLKSVEEQIKALQDQYDKSLSEKESLAKTMALTQARLNRAGKLTSALGDEQVRWKESIANFEEEISNVIGNVFIAAACVAYFGAFTAVYRQLLVDCWINKCQELEIPISPNFSLINILGDAYEIRQWNTDGLPRDHISTENGILVTRGRRWPLMIDPQDQANRWIRNKENKNGLKVIKLTDAGFLRTLENAIRLGLPVLLEELKETLDPALEPILSKQTFTSGGRTLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTRSGLEDQLLSDVVRIERPDLEEQRNQLIIRINSDKNQLKAIEDRILKLLFTSEGNILDNEDLINTLQESKITSGAIKTRLLEAEATEENINTAREKYRPVATQGSVIYFVIASLSEIDPMYQYSLKYFKQLFNMTIEAAEKSNDLDIRLATLLSQTLFSAYTNVSRGLFEQHKLIYSFMLCVEIMRHKGEISETEWNFFLRGAAGLDKERPTKPDVPGLS 3256          

HSP 2 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 368/600 (61.33%), Postives = 461/600 (76.83%), Query Frame = -3
Query:   72 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1871
            F+   K++ Y ERVQ+ISLGQGQGP+AEKM+  A K G W+FLQNCHLA SWM+ +EE++K  +E    ++ENFRLFLSSMP++TFP++VLQNSVKVTNEPPKGLRAN++RAF E++  FFE H+LG  WRK+IFGICFFH+I+ +RKKFGPLGWNI YEF+DSDRECA+LNL ++C +G I WDAL YIT EITYGGRVTD WDQRCLR IL  FF P+T+ ++Y YS SGIY+ P+ +++  +KD++++LPL ++PEIFGMHENANL+FQ +ET  LINTILDVQPR    G G++ D+IV ELA  IL KL DK++ E A   LF  D KGR+NSLTTVL QEVDRFNKLL V+KNSL  L KAI G VVMSEE+E +Y +F N+QVP LWS+ AYPSLKPL +WVKDL MR S    W+  G PKSFW+ G FFPQGFLTGTLQN+ARKY+  ID L+F + V   YR+Q  V + MK LKFGE +  D  L +P DGVLVHG+YMD  RWDDE   I  ++  +M  +LP++H  P  +Y P    Y +PLYKT  RAG LSTTG STNFVV V LP+++++++WI+ G+AL+C+
Sbjct: 3327 FQRFAKERGYSERVQSISLGQGQGPIAEKMIKDAMKTGHWIFLQNCHLAVSWMLPMEELIKSFTEPNVSINENFRLFLSSMPSRTFPVTVLQNSVKVTNEPPKGLRANVRRAFTEITTTFFEEHLLGRKWRKVIFGICFFHAIVQERKKFGPLGWNICYEFNDSDRECALLNLNLYCQEGKIPWDALLYITGEITYGGRVTDAWDQRCLRTILRRFFSPETLEDNYCYSTSGIYFSPDADSLQSFKDYIENLPLTDDPEIFGMHENANLAFQRKETNTLINTILDVQPRSTTQGGGKSNDEIVRELATSILSKLPDKLDMEVASEMLFVKDAKGRVNSLTTVLGQEVDRFNKLLKVLKNSLETLNKAIAGLVVMSEEMEKIYKSFLNSQVPTLWSDAAYPSLKPLGSWVKDLVMRISFIDAWIRIGQPKSFWISGLFFPQGFLTGTLQNHARKYNLAIDELNFHYNVLPQYRDQATVTEAMKTLKFGEELPMDAVLPAPEDGVLVHGMYMDACRWDDEAMVIEDALPRQMNPMLPVIHFEPHQNYNPSGDLYQAPLYKTSARAGTLSTTGHSTNFVVTVLLPSNRQNDYWISKGSALLCQ 3926          

HSP 3 Score: 86.2705 bits (212), Expect = 1.820e-15
Identity = 40/80 (50.00%), Postives = 50/80 (62.50%), Query Frame = -2
Query: 1786 IVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 2025
            +V  +TEFV   LG +F+E PP DL  L+QDMS  +PL+F+LSTGSDPM  FQRFAKE+    +  S   G   G    K
Sbjct: 3276 VVFAVTEFVINTLGKKFIENPPIDLATLYQDMSPSTPLIFILSTGSDPMGAFQRFAKERGYSERVQSISLGQGQGPIAEK 3355          
BLAST of SMED30008756 vs. Ensembl Xenopus
Match: plekhg3 (pleckstrin homology and RhoGEF domain containing G3 [Source:Xenbase;Acc:XB-GENE-6468932])

HSP 1 Score: 2154.41 bits (5581), Expect = 0.000e+0
Identity = 1221/2977 (41.01%), Postives = 1762/2977 (59.19%), Query Frame = -2
Query: 1801 IGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNE-WLREEFMKLNPEDLGTQTAKYVKIVAQLEK---GLPPNQ-VVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILE-DVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAE-ERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPT---------IAIAFVFCYLWGIGGNLHESNWDSFDNFVRNK---------FEDNG---DCRMPSQGDLWSSYADLHSRKMDL----WEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSV-VARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLN-WITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA-DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVD--IGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD--------------WASAKSVLGDP-YFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPL--PPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 10569
            +G   +    +KQ +    +   + + E+L    RKE+D +  + +    ++  +P +  +      ++  +  +++ LE +   +   YD+ID F      EDF+    +    ++    +D        + +KF      D       +  ++  +            HE+  E+ ++   + E Q  A  Y + ++ F +     + L  +    +  + LW +  +W  R+NE W+ +    ++ E L     +  K++ +  K    +P  Q V   +K+++E+ R  + +I  L NP ++ RHW+ + + I     + +  L   + +E+N+ D+ + + +++  A  E ++E  L K+E  W    + +LP+K++   FIL   +E  QL DD  +   +++ S    P + R+  W   L L    +EEWL CQR+WLYLE IFS+ DI RQLP E K + ++++++++IM+  ++    +     P LL++ +  N+LL+ +QK L  YLE+KR  FPRFYFLS+DELLEIL+QT++P AVQPHLRKCF+ +++L F                       ++   I  M S EGE+V L K +   GNVE+WL +VE+ M  ++R+ + +SI  +    R EW+     Q+ +   Q  W ++++  L+   +  RL   ++ +      L+ L  LVRG L ++ R+ L ALI + VHA+D+   +++E VS +N FEW  QLRYYW    D+  VR  N+ + YGYEYLG + RLVITPLTDRCYL L GAL L  GGAPAGPAGTGKTETTKDL K+LA Q VVFNCSD LD+  MG+FF GLA SGAW CFDEFNRIDIEVLSV+AQQ+ TI+ A+  ++ RFMFEG EI LV TCA FITMNPGYAGRTELPDNLKALFRP+AMMVPDY +IAE+ LYS GF ++K LA+K+T  +KL SEQLS QDHYDFGMRA+K+V+  AG LKRENP   E+++ +RA+RD N+PKFL+ D +LF  I+ DLFP +E    DYG  +  I        L+     V K IQ YET  VRHG+MLVGPTG GKT  Y VLA  L++L   GL       Y+ V  YILNPKSITMG+LYGE + LT EW DG++  ++R     T  D +W + DGPVDA+WIENMNTVLDDNK LCL++ E IKLT  + M+FEVQDL+VASPATVSRCGMVY++P  LG  PF + WL  M   +K    + L  +F  ++ D ++F +    + +A        ++ +LL+        P +  + QK  P          I   F F  +W +G          F  ++R+K         F + G   D ++   G   +S  D    +  +    W      F    +  + ++IVPT+DT+R  +LL  LL  K+ VL  G TG GK++ +    L N      Y+  F+ FSA+TS+N+TQ++I++KL+K+RK V G P  +  I FIDDLNMP L+TYG+QPPIELLRQ+ D GG+YDR ++  +  + D+    A GPPGGGRNPVS RL RHF   S     + S  +IF+SIL  +        V+  TE +V A +++YN + + LLPTPAKSHY FNLRDLSK  QG+L  D S + DK  + KL+ HE+ RVF DRL+N ED+ +F ++      + FG +   E   + P++FGDFM PG +   + Y+ + D  K+  ++  Y++D+N  ++ +MKLV F+DAI HI RI+R++RQ  GNALL+GVGG+G+QSLTRLA+ M  Y CFQIEL + Y  + +  D+K I    G+ N    FLFTDTQI  E FLEDINNILNSG+VP+L+ PDE ++++   +   ++ G  +  +  +      RVR N+H VLCMSP+G  FRSR R FPSLV CCTIDWF  WP EAL +VA S    +      +++   +  MC +IH SVA +S+++ AEL RH Y TP SYLEL+ ++  ++ +K  ++ T +DR+K+GL K+L T E +A M+ EL  +RP LE+  +DT   MQK+  D   A+  R  V+ +EA A  KA+  QAIADDAQ+DLDEA+PAL+ A+ +L +L+KND+ E+R    PP  V+ V+E+VC++ G K                W   K +L DP  FL+ L  + KDNIP+A++K ++ YID+  F    + +VSKAC S+  WVRAM  Y    + VEPK++ L  A ++L      L   +A L  VE+ IA LQ  Y + V++K+ LEH       +L RA KL T L+DE++RW ++V      L NV GD+ + A  +AY G FT  YR  L + W  + +EL++P SE  +L+G LGD  ++R W   GLP D +S EN ++    +RW   IDPQ QANRWI+N E  N L++ KLS+ +FLR+LEN IR G P +LE++GE LDPALEP+LLKQT+ + G T++ LGD+ I Y  DF++YITTKL NPHY PEIC KVT+INFT++P GLEDQLLG+V   ERP+LEE +N LI+     + +L+  E++IL  L  S+GN +D  DLI  L  SK  + E   ++  AE TE+ I   R +Y+PVA R  +++F V++++ +DPMYQ+SL++F ++F   I NS++++ +E+RI  +    T + ++NV R LFEK KL+FSF+LC++I+   GLI   EW F L   GG      E P   W++   W ++  +S  +  FS +   +T    E                 YR L   P P  E              L G++   L SFQK+++++    +K+   + ++V  +LG RF+EP   DL  ++++ S V+PL+F+LS G+DP     +FA+E K   K S+   G   G
Sbjct:  685 VGPFQISIEGVKQNLSRKRRNLSNALLELLAKSLRKEMDDISDQFRAISRSVYEKPNSIEELTELREWMKGVPEKLKTLEEQITKVTSDYDVIDEFLYSLSQEDFSAKWNVIAWPNKVMVLMDSICEQHTEDEEKFRKIQVMDQTNFLERLDSLQMVVAGFSTHVDITRAHEIANEVRRVHKQLKESQQMALLYNNRERLFGLPVTNYDKLVRMVKAFQPFRDLWTTASDW-MRWNESWMNDPLTTIDAEQLEKNVTESYKVMHKCIKQFRDIPACQEVAQDIKERIEEFRPYIPLIQGLRNPGMRNRHWELLSEQIQINI-KPKANLNFTRCLEMNLQDHIDSIAKVAEIAGKEFAIEQALDKMENEWASVLFTILPYKET-GTFILKSPEEASQLLDDHIVMTQSMSFSPFKKPFEERISTWEGKLRLTQDVLEEWLICQRSWLYLEPIFSSEDINRQLPVEGKRYQTMERTWRKIMKNAEENKQVISLCPEPRLLESLRECNKLLELVQKGLSEYLETKRAAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENVARLLF-----------------------QHDLQITHMYSAEGEEVKLSKAIYPTGNVEDWLFEVEKVMKASVREYIERSIKVYPETPRTEWVLNWPGQVTIAGCQTFWTKDVSEALDAGDLSNRLFPQLESQ------LSGLVALVRGKLSRMQRSILSALIVIEVHAKDVAARLIEENVSSVNDFEWISQLRYYW--ARDDLYVRAVNAEFLYGYEYLGNTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVDRFMFEGVEIPLVTTCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNNAKILAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQDDLKLFSGIVSDLFPRIEEEHIDYGTLEEAIRKTCVQKNLKDVDGFVTKCIQLYETTVVRHGLMLVGPTGSGKTQCYKVLAAALTSLK--GLPSVSGGTYETVHYYILNPKSITMGQLYGEFDLLTHEWTDGILSSLIRGGATSTDPDRRWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRCMPDVIK-PFTEKLESLFSHFLLDSIRFVRRSVKEMIASTDNNLTMSLLKLLDCFF----QPFIPQEGQKKFPEEKLRRIEELIESWFFFSLIWSVGITGDSQGRVLFSTWLRDKMKSEKIAMLFPEQGLVHDYKLDDAGISNASEEDEEDVQKPICWVNWMDSAGSFSIVPDTSYADIIVPTLDTVRMSHLLGMLLTNKKPVLCVGPTGTGKTLTITDKLLKNFPME--YISHFLMFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRYYIFFIDDLNMPSLETYGAQPPIELLRQWMDHGGWYDRKQIGVFKQLVDINFLCAMGPPGGGRNPVSPRLTRHFNYLSFTELEDSSKSRIFSSILGSWLGKSGASAVQNLTEQLVSATIKVYNTITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADASKMGDKYQLLKLWYHESCRVFQDRLVNEEDRSWFDELFKGKMQE-FGASFH-EVVPQQPVLFGDFMSPGSDA--KAYQLIEDREKLHRVIEEYMEDYNQINTAKMKLVLFLDAIQHICRISRVLRQPLGNALLLGVGGSGRQSLTRLASNMAQYECFQIELSKNYGRSEWREDIKGILLKAGLQNTPITFLFTDTQIKDESFLEDINNILNSGDVPNLYGPDELDQIVTVMKPVVQDMG-QQPTKANLMAAYTRRVRGNIHTVLCMSPIGEVFRSRLRQFPSLVTCCTIDWFDEWPAEALQSVASSFLSEIPELQSREDIIPGMIQMCVDIHQSVAVKSKQYLAELSRHNYITPKSYLELLGIFSKLIGKKLMEIKTAKDRMKSGLDKLLTTAEDVAKMQEELEVMRPLLEEAAQDTVTTMQKIQEDTVVAEATRGSVQVEEAKATEKAQTAQAIADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQRPPVGVKLVIEAVCIMKGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIPDAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVTQKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKLGRADKLITGLSDERQRWQDTVLNLENLLVNVAGDLLLCAGFLAYLGPFTGPYRTTLFNQWTKKLQELKVPCSEEPSLIGTLGDPVKIRSWQIAGLPNDTLSVENGVITQYSQRWSHCIDPQGQANRWIKNMEKDNGLEVAKLSDRDFLRSLENAIRFGKPFMLENVGEELDPALEPVLLKQTYKQQGSTVLRLGDAVIPYHDDFRMYITTKLPNPHYPPEICTKVTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLILSNAKMRQELKDIEDQILLRLSTSQGNPVDDVDLIKVLEASKQKAGEIKVKVQVAEQTERDIDSTRRQYVPVAVRTQILFFCVSDLSNVDPMYQYSLEWFLSIFIAAIANSERAETVEKRIININTYFTFSLFSNVCRSLFEKHKLMFSFLLCVRILMNQGLIHMEEWRFLLS--GGTASSLAENPFPEWLTERAWRDIQALS-ALSNFSKITEQLTHYAKE-----------------YRGLCDSPEPHRE-------------QLPGNWGQSLDSFQKILILRCLRGDKVTNAMQDYVCQHLGQRFIEPQTADLGAVYKESSPVTPLIFILSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQG 3580          

HSP 2 Score: 473.011 bits (1216), Expect = 1.437e-132
Identity = 250/596 (41.95%), Postives = 368/596 (61.74%), Query Frame = -3
Query:   75 YMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIY--YPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEE--AKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK-YISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALIC 1844
            + +++ AISLGQGQGP AE MM ++ + G WVF QNCHLA SWM  LE +++  + +P +VH +FR++L+SMP+  FP+S+LQN  K+T EPP+G++AN+ R +  +S    +       ++ L+  +  FH   L+R+KFGPLG+NI YEF+D D    I  L MF  +   I +  L Y   EI YGGRVTD WD+RCL +IL  F+ P  + E + +S SGIY    P ++ +N Y  ++ SLPL +  E+FG+HENAN++F   E+  L+ +++ +QPR  + G  R  D++V E+++ IL+K+   I  +E  AK  + + +      S+ TVL+QEV R+N+LLSV+  +L  L KA+KG VVMS +LE +  +  NN VP +W + AYPSLKPL++WV DL  R      W+  G P +FW+ G FFPQ FLTGTLQNYARK+   ID +SF+F V ++          + EL              P +G  ++GL+++G RWD  +  +  S   E+   + ++ ++P  + +P ++  Y  P+YKT  RAG LSTTG STN+V+AV LP++Q    WI  G ALIC
Sbjct: 3566 FSKKLSAISLGQGQGPRAEAMMRSSMERGKWVFFQNCHLAPSWMPSLERLIE--TIDPDKVHRDFRVWLTSMPSNQFPVSILQNGSKLTIEPPRGVKANLLRTYLSLSDAELQDCSKASQFKALLLSLSLFHGSTLERRKFGPLGFNIPYEFTDGDLRICISQLRMFLEEYSDIPYKVLRYTAGEINYGGRVTDDWDRRCLLSILQDFYQPPVLTEGHNFSVSGIYQQISPAYD-LNGYLQYIRSLPLNDLTELFGLHENANITFAQNESFALLGSLVTLQPRAESSGGSR--DEMVEEISENILKKVPPLIPVQEVMAKYPVMYQE------SMNTVLVQEVIRYNRLLSVLTQTLHDLLKAMKGQVVMSSQLELMANSLYNNSVPEMWRSKAYPSLKPLASWVLDLLQRIQFLQKWISDGIPAAFWISGLFFPQAFLTGTLQNYARKHVISIDTISFDFKVLRE---------SVSELT-----------QRPSEGCYIYGLFLEGARWDKTSSVLAESRPKELYTEMAVIWLIPVPERKPATSGIYFCPIYKTLTRAGTLSTTGHSTNYVIAVELPSNQPQTHWIKRGVALIC 4130          
BLAST of SMED30008756 vs. Ensembl Xenopus
Match: plekhg3 (pleckstrin homology and RhoGEF domain containing G3 [Source:Xenbase;Acc:XB-GENE-6468932])

HSP 1 Score: 2152.87 bits (5577), Expect = 0.000e+0
Identity = 1220/2977 (40.98%), Postives = 1762/2977 (59.19%), Query Frame = -2
Query: 1801 IGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNE-WLREEFMKLNPEDLGTQTAKYVKIVAQLEK---GLPPNQ-VVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILE-DVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAE-ERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPT---------IAIAFVFCYLWGIGGNLHESNWDSFDNFVRNK---------FEDNG---DCRMPSQGDLWSSYADLHSRKMDL----WEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSV-VARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLN-WITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFF-ADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVD--IGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD--------------WASAKSVLGDP-YFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPL--PPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 10569
            +G   +    +KQ +    +   + + E+L    RKE+D +  + +    ++  +P +  +      ++  +  +++ LE +   +   YD+ID F      EDF+    +    ++    +D        + +KF      D       +  ++  +            HE+  E+ ++   + E Q  A  Y + ++ F +     + L  +    +  + LW +  +W  R+NE W+ +    ++ E L     +  K++ +  K    +P  Q V   +K+++E+ R  + +I  L NP ++ RHW+ + + I     + +  L   + +E+N+ D+ + + +++  A  E ++E  L K+E  W    + +LP+K++   FIL   +E  QL DD  +   +++ S    P + R+  W   L L    +EEWL CQR+WLYLE IFS+ DI RQLP E K + ++++++++IM+  ++    +     P LL++ +  N+LL+ +QK L  YLE+KR  FPRFYFLS+DELLEIL+QT++P AVQPHLRKCF+ +++L F                       ++   I  M S EGE+V L K +   GNVE+WL +VE+ M  ++R+ + +SI  +    R EW+     Q+ +   Q  W ++++  L+   +  RL   ++ +      L+ L  LVRG L ++ R+ L ALI + VHA+D+   +++E VS +N FEW  QLRYYW    D+  VR  N+ + YGYEYLG + RLVITPLTDRCYL L GAL L  GGAPAGPAGTGKTETTKDL K+LA Q VVFNCSD LD+  MG+FF GLA SGAW CFDEFNRIDIEVLSV+AQQ+ TI+ A+  ++ RFMFEG EI LV TCA FITMNPGYAGRTELPDNLKALFRP+AMMVPDY +IAE+ LYS GF ++K LA+K+T  +KL SEQLS QDHYDFGMRA+K+V+  AG LKRENP   E+++ +RA+RD N+PKFL+ D +LF  I+ DLFP +E    DYG  +  I        L+     V K IQ YET  VRHG+MLVGPTG GKT  Y VLA  L++L   GL       Y+ V  YILNPKSITMG+LYGE + LT EW DG++  ++R     T  D +W + DGPVDA+WIENMNTVLDDNK LCL++ E IKLT  + M+FEVQDL+VASPATVSRCGMVY++P  LG  PF + WL  M   +K    + L  +F  ++ D ++F +    + +A        ++ +LL+        P +  + QK  P          I   F F  +W +G          F  ++R+K         F + G   D ++   G   +S  D    +  +    W      F    +  + ++IVPT+DT+R  +LL  LL  K+ VL  G TG GK++ +    L N      Y+  F+ FSA+TS+N+TQ++I++KL+K+RK V G P  +  I FIDDLNMP L+TYG+QPPIELLRQ+ D GG+YDR ++  +  + D+    A GPPGGGRNPVS RL RHF   S     + S  +IF+SIL  +      + +   TE +V A +++YN + + LLPTPAKSHY FNLRDLSK  QG+L  D S + DK  + KL+ HE+ RVF DRL+N ED+ +F ++      + FG +   E   + P++FGDFM PG +   + Y+ + D  K+  ++  Y++D+N  ++ +MKLV F+DAI HI RI+R++RQ  GNALL+GVGG+G+QSLTRLA+ M  Y CFQIEL + Y  + +  D+K I    G+ N    FLFTDTQI  E FLEDINNILNSG+VP+L+ PDE ++++   +   ++ G  +  +  +      RVR N+H VLCMSP+G  FRSR R FPSLV CCTIDWF  WP EAL +VA S    +      +++   +  MC +IH SVA +S+++ AEL RH Y TP SYLEL+ ++  ++ +K  ++ T +DR+K+GL K+L T E +A M+ EL  +RP LE+  +DT   MQK+  D   A+  R  V+ +EA A  KA+  QAIADDAQ+DLDEA+PAL+ A+ +L +L+KND+ E+R    PP  V+ V+E+VC++ G K                W   K +L DP  FL+ L  + KDNIP+A++K ++ YID+  F    + +VSKAC S+  WVRAM  Y    + VEPK++ L  A ++L      L   +A L  VE+ IA LQ  Y + V++K+ LEH       +L RA KL T L+DE++RW ++V      L NV GD+ + A  +AY G FT  YR  L + W  + +EL++P SE  +L+G LGD  ++R W   GLP D +S EN ++    +RW   IDPQ QANRWI+N E  N L++ KLS+ +FLR+LEN IR G P +LE++GE LDPALEP+LLKQT+ + G T++ LGD+ I Y  DF++YITTKL NPHY PEIC KVT+INFT++P GLEDQLLG+V   ERP+LEE +N LI+     + +L+  E++IL  L  S+GN +D  DLI  L  SK  + E   ++  AE TE+ I   R +Y+PVA R  +++F V++++ +DPMYQ+SL++F ++F   I NS++++ +E+RI  +    T + ++NV R LFEK KL+FSF+LC++I+   GLI   EW F L   GG      E P   W++   W ++  +S  +  FS +   +T    E                 YR L   P P  E              L G++   L SFQK+++++    +K+   + ++V  +LG RF+EP   DL  ++++ S V+PL+F+LS G+DP     +FA+E K   K S+   G   G
Sbjct:  690 VGPFQISIEGVKQNLSRKRRNLSNALLELLAKSLRKEMDDISDQFRAISRSVYEKPNSIEELTELREWMKGVPEKLKTLEEQITKVTSDYDVIDEFLYSLSQEDFSAKWNVIAWPNKVMVLMDSICEQHTEDEEKFRKIQVMDQTNFLERLDSLQMVVAGFSTHVDITRAHEIANEVRRVHKQLKESQQMALLYNNRERLFGLPVTNYDKLVRMVKAFQPFRDLWTTASDW-MRWNESWMNDPLTTIDAEQLEKNVTESYKVMHKCIKQFRDIPACQEVAQDIKERIEEFRPYIPLIQGLRNPGMRNRHWELLSEQIQINI-KPKANLNFTRCLEMNLQDHIDSIAKVAEIAGKEFAIEQALDKMENEWASVLFTILPYKET-GTFILKSPEEASQLLDDHIVMTQSMSFSPFKKPFEERISTWEGKLRLTQDVLEEWLICQRSWLYLEPIFSSEDINRQLPVEGKRYQTMERTWRKIMKNAEENKQVISLCPEPRLLESLRECNKLLELVQKGLSEYLETKRAAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENVARLLF-----------------------QHDLQITHMYSAEGEEVKLSKAIYPTGNVEDWLFEVEKVMKASVREYIERSIKVYPETPRTEWVLNWPGQVTIAGCQTFWTKDVSEALDAGDLSNRLFPQLESQ------LSGLVALVRGKLSRMQRSILSALIVIEVHAKDVAARLIEENVSSVNDFEWISQLRYYW--ARDDLYVRAVNAEFLYGYEYLGNTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVDRFMFEGVEIPLVTTCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNNAKILAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQDDLKLFSGIVSDLFPRIEEEHIDYGTLEEAIRKTCVQKNLKDVDGFVTKCIQLYETTVVRHGLMLVGPTGSGKTQCYKVLAAALTSLK--GLPSVSGGTYETVHYYILNPKSITMGQLYGEFDLLTHEWTDGILSSLIRGGATSTDPDRRWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLTPFTECWLRCMPDVIK-PFTEKLESLFSHFLLDSIRFVRRSVKEMIASTDNNLTMSLLKLLDCFF----QPFIPQEGQKKFPEEKLRRIEELIESWFFFSLIWSVGITGDSQGRVLFSTWLRDKMKSEKIAMLFPEQGLVHDYKLDDAGISNASEEDEEDVQKPICWVNWMDSAGSFSIVPDTSYADIIVPTLDTVRMSHLLGMLLTNKKPVLCVGPTGTGKTLTITDKLLKNFPME--YISHFLMFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRYYIFFIDDLNMPSLETYGAQPPIELLRQWMDHGGWYDRKQIGVFKQLVDINFLCAMGPPGGGRNPVSPRLTRHFNYLSFTELEDSSKSRIFSSILGSWLEKGLWEIIENLTEQLVSATIKVYNTITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADASKMGDKYQLLKLWYHESCRVFQDRLVNEEDRSWFDELFKGKMQE-FGASFH-EVVPQQPVLFGDFMSPGSDA--KAYQLIEDREKLHRVIEEYMEDYNQINTAKMKLVLFLDAIQHICRISRVLRQPLGNALLLGVGGSGRQSLTRLASNMAQYECFQIELSKNYGRSEWREDIKGILLKAGLQNTPITFLFTDTQIKDESFLEDINNILNSGDVPNLYGPDELDQIVTVMKPVVQDMG-QQPTKANLMAAYTRRVRGNIHTVLCMSPIGEVFRSRLRQFPSLVTCCTIDWFDEWPAEALQSVASSFLSEIPELQSREDIIPGMIQMCVDIHQSVAVKSKQYLAELSRHNYITPKSYLELLGIFSKLIGKKLMEIKTAKDRMKSGLDKLLTTAEDVAKMQEELEVMRPLLEEAAQDTVTTMQKIQEDTVVAEATRGSVQVEEAKATEKAQTAQAIADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQRPPVGVKLVIEAVCIMKGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIPDAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVTQKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKLGRADKLITGLSDERQRWQDTVLNLENLLVNVAGDLLLCAGFLAYLGPFTGPYRTTLFNQWTKKLQELKVPCSEEPSLIGTLGDPVKIRSWQIAGLPNDTLSVENGVITQYSQRWSHCIDPQGQANRWIKNMEKDNGLEVAKLSDRDFLRSLENAIRFGKPFMLENVGEELDPALEPVLLKQTYKQQGSTVLRLGDAVIPYHDDFRMYITTKLPNPHYPPEICTKVTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLILSNAKMRQELKDIEDQILLRLSTSQGNPVDDVDLIKVLEASKQKAGEIKVKVQVAEQTERDIDSTRRQYVPVAVRTQILFFCVSDLSNVDPMYQYSLEWFLSIFIAAIANSERAETVEKRIININTYFTFSLFSNVCRSLFEKHKLMFSFLLCVRILMNQGLIHMEEWRFLLS--GGTASSLAENPFPEWLTERAWRDIQALS-ALSNFSKITEQLTHYAKE-----------------YRGLCDSPEPHRE-------------QLPGNWGQSLDSFQKILILRCLRGDKVTNAMQDYVCQHLGQRFIEPQTADLGAVYKESSPVTPLIFILSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQG 3585          

HSP 2 Score: 473.011 bits (1216), Expect = 1.439e-132
Identity = 250/596 (41.95%), Postives = 368/596 (61.74%), Query Frame = -3
Query:   75 YMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIY--YPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEE--AKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK-YISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALIC 1844
            + +++ AISLGQGQGP AE MM ++ + G WVF QNCHLA SWM  LE +++  + +P +VH +FR++L+SMP+  FP+S+LQN  K+T EPP+G++AN+ R +  +S    +       ++ L+  +  FH   L+R+KFGPLG+NI YEF+D D    I  L MF  +   I +  L Y   EI YGGRVTD WD+RCL +IL  F+ P  + E + +S SGIY    P ++ +N Y  ++ SLPL +  E+FG+HENAN++F   E+  L+ +++ +QPR  + G  R  D++V E+++ IL+K+   I  +E  AK  + + +      S+ TVL+QEV R+N+LLSV+  +L  L KA+KG VVMS +LE +  +  NN VP +W + AYPSLKPL++WV DL  R      W+  G P +FW+ G FFPQ FLTGTLQNYARK+   ID +SF+F V ++          + EL              P +G  ++GL+++G RWD  +  +  S   E+   + ++ ++P  + +P ++  Y  P+YKT  RAG LSTTG STN+V+AV LP++Q    WI  G ALIC
Sbjct: 3571 FSKKLSAISLGQGQGPRAEAMMRSSMERGKWVFFQNCHLAPSWMPSLERLIE--TIDPDKVHRDFRVWLTSMPSNQFPVSILQNGSKLTIEPPRGVKANLLRTYLSLSDAELQDCSKASQFKALLLSLSLFHGSTLERRKFGPLGFNIPYEFTDGDLRICISQLRMFLEEYSDIPYKVLRYTAGEINYGGRVTDDWDRRCLLSILQDFYQPPVLTEGHNFSVSGIYQQISPAYD-LNGYLQYIRSLPLNDLTELFGLHENANITFAQNESFALLGSLVTLQPRAESSGGSR--DEMVEEISENILKKVPPLIPVQEVMAKYPVMYQE------SMNTVLVQEVIRYNRLLSVLTQTLHDLLKAMKGQVVMSSQLELMANSLYNNSVPEMWRSKAYPSLKPLASWVLDLLQRIQFLQKWISDGIPAAFWISGLFFPQAFLTGTLQNYARKHVISIDTISFDFKVLRE---------SVSELT-----------QRPSEGCYIYGLFLEGARWDKTSSVLAESRPKELYTEMAVIWLIPVPERKPATSGIYFCPIYKTLTRAGTLSTTGHSTNYVIAVELPSNQPQTHWIKRGVALIC 4135          
BLAST of SMED30008756 vs. Ensembl Mouse
Match: Dnah6 (dynein, axonemal, heavy chain 6 [Source:MGI Symbol;Acc:MGI:107744])

HSP 1 Score: 4279.94 bits (11099), Expect = 0.000e+0
Identity = 2118/3450 (61.39%), Postives = 2645/3450 (76.67%), Query Frame = -2
Query: 1759 KIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESS-DGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGH-YDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK--NDGRCCENW 12093
            +II I+ E   + FLY+   + K    Y  YNLKVVSY N+ K D+Y +S +  TH V  D+I++I ++R+E EY  + ++ KIP F  FR WKAF  WRK ++  K   C K L  +LFI+N  LRPALL + EMC+ +S MGLC +EK  TYTL +F  AQI +L EV  +L  FR   ++V+R +CR +L   GF PDD      +   Y +      +S +   +D+  Y E+ +KMTYTEQA+KR+HC RLT FIRL DYLI NT+HVL VN+  +LLN+ SD+LK+TP+A+ I  +                   EE+ +V   K + +  ++  EE++++V  P+F+TE +L+VQ+LLF P  E F +GI+  I  F+NTVLSV NLVPD+YFD+FT P IN K EEKTCG GP+++A+F +D +   +I Q  + I AAF++   YA+TF + + F+++NES DL+A++  + DV+FF     +YH++ +    +   + +G++L+D  ++K+ ++PSP RCL+V+N MLP +++K+VDA+I E+QDAEY L   PT T++YVN+L FL EIQ R+E LE EA+V+ +MY LI+ + VPTPPEDFAV+ T+ PSI   +NAIDK++ DR+ +I +FC  L +D+ +L  EV +++    +P ILD+ A++ ++K  L  L++ +++LQ RAF YKSYQKNFKVE ++ + LEEV+AEL+LKQ+LWDSL EWD+   EWL+ +F  L+PE L +Q  KY K V QLEKGLPPN VVP LK KVE+M+EK+ VI +L NP L+ RHW  IE  ++    ++E  LTL +L EL+VF++ +E+++ISGQAS EA+LE +LKKVE++W+ TE+V+LPH+DSKDVFILGGTD+IQ L DDS IN+ATIASSR+VGP+K RVD+W K L LF +T+EEWLNCQRNWLYLESIF+APDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T PGLL+TF+NNN LLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNP AVQPHLRKCFD+ISKL+FA+   P  E    GM   P   E  +TNDILAM+SPEGE+V LGKGLKARGNVEEWLGKVEEAMF +LR+L + +I ++    R EW+ A H +Q++LT+ Q+MWCR++T  LE    + +  + DFE   F+ LN LA +VRG LPKL R  + ALIT++VHARD+V+E+V+ KV   + F+WQ+QLRYYWD  LDNCV RM+ S YTY YEYLG  PRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAK+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRP+AMMVP+Y LIAEVILYSEGFESSK LA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENPD  EDVVLIRALRDSNLPKFL  DA LF  I+ DLFPGV++PEHDYG  +  I  V+ N  LQ     V KVIQ YET+ VRHGVMLVGPTGGGKTTVY VLA+ L NL    L  + P YQPVK Y+LNPKSITMGELYGEVN +TLEW DGLM   VR    DTS+DH+W+I DGPVDALWIENMNTVLDDNKMLCLANSERIKLTP +HMLFEVQDL VASPATVSRCGMV+VDPEEL WMP+VKTW+ +M+ KL  EV +YL  +F +Y+DDGL F   KC Q + QV I+K+ T+C LLESLL+      L+++  KLN  +   FVFCYLW +GGNL E+ WDSFD F+R +F+DN D R+PS GDLWS + D  ++++D WE+I+P FK++++VPFFEM+VPT DT+R+GYL+EKLL V+ SVLFTG TGVGKSV+A+G LN I E+AGYVPV++NFSAQTSS+RTQE+IE+KLE+KRK +LGAP NK+V+IF+DDLNMP+LD YGSQPPIELLRQYQDFGGFYDR+KL W  IQD+T+ +AC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF +IL GF ADFP+ V+  + NIV AAVEIYNRM  DLLPTPAKSHYVFNLRDLSKC+QGILQCDP  +R++  +F+LFCHE QRVFHDRLIN+EDK +FH I+ EMA+K+FG  I+ E F+  PIIFGDF+K G EK +R+Y+ L D  K++N+L  YLDD+N+ + KE+KLVFF DAI+H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA + GY C QIEL RGY+Y+ FH DL+K+Y+  G+ ++  VFLFTDTQIVVEEFLEDINNILNSGEVP+LFE DE E ++   R  AKE G+SEGNRD +F++ I+RVR  LHIVLCMSPVG +FRSRCRMFPSLVNCCTIDWF  WP EALL+V+KS F  VD G D+L+ KL+LMC  +H SV+  +ER+Y EL+R YYTTPTSYLELI LYL+MLTEK+KQLV+ RDRVKNGLTK+LETN L+  M+++L AL P L QK +D EALM+KL  DQE AD VR+ V+EDEA+AKVKA+ETQAIADDAQRDL+EA+PALE A KALD+LDK DI+EIRVFT PP +V TVME++ +LL  K DW +AK +LGD  FL++L +Y K+NI   +L KL++YI++P+F  E VEKVSKAC+S+ +WVRAMD+YS+ VK VEPK+++L  A  ELD  M  L++KQA L  VE++I  LQ  Y+  V EK++L  N+ALT ARL RAGKLT AL DE+ RW ES+ KF EEL N+VG+VF+ AACVAYYGAFT+ YR  L+  WI  C  LEIP+    +L+ +LGD +E+RQWN++GLPRD +STEN ILVT+GRRWPLMIDPQ+QANRWIRNKE+ + LK+IKL++ NFLR LEN IRLG+P LLE++ E LDPALEPILLKQTF+  GR LIHLGDSDI+Y K F+ Y+T+K+ NPHY+PE+CIKVTIINFTVT  GLEDQLL +V RLE+PELEEQR  LI+RIN+DKNQL+  E++ILKLLF SEGNILD+E+LI+TL +SK+TS     R+ EAE TE  I +AR +Y PVA +GSVMYFV+A+++EIDPMYQ+SLKYFK LFN TIE S+KS +L ER+KILL +T +  Y NV+RGLFE+ KL++SFMLC+ IMR++  +++ EW FFLRG  G+EK+RP KP  PW+ + +W +  D+ +  P+F  L   I    I + +G     +N          PPV   E   K R + E       H + L  +SF KLILVK   EEK+V  +T+FV  NLG +F+E PP DL  L+QDMS  +PLVF+LSTGSDPM  FQRFA+E     +  S   G   G    K   D     NW
Sbjct:  185 QIIKIVHENEHLGFLYMISAVPKSSIEYDTYNLKVVSYENINKNDYYTISKDAVTH-VYNDDIEYIEIERWEQEYLYHRELTKIPIFALFRKWKAFSVWRKNVRSKKITGCRKALRKNLFIVNPYLRPALLKINEMCYLLSFMGLCYIEKFHTYTLQEFKAAQIVRLQEVTERLEVFRCAAKDVVRKSCRFALRAAGFIPDD-----CEVETYEDYFKANIASLVDGPFDLPTYGES-EKMTYTEQASKRHHCMRLTCFIRLNDYLIQNTLHVLTVNTASSLLNFFSDKLKRTPSADVIQKWIT-----------------EEKPEVTEKKGAPL--MEKQEEDESLV--PMFLTELILTVQSLLFEPSLEDFLDGISGAINHFENTVLSVPNLVPDSYFDAFTSPFINKKVEEKTCGPGPNLSAVFEDDRNFLTIIMQIKETIHAAFDSARLYAATFEKFQLFFKENESLDLEALKQEEPDVQFFSSQLEKYHKQHKDSVALRPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMPTTTIEYVNSLVFLDEIQERIETLEEEANVVVQMYKLIEQYQVPTPPEDFAVFATMKPSITAVRNAIDKSVGDRETSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQILDISADQEKIKTMLSDLQSVLDDLQKRAFQYKSYQKNFKVEVSKFDALEEVSAELRLKQLLWDSLSEWDNLQQEWLKSKFDCLDPEVLNSQVTKYAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDALLVDTEIPLTLERLSELHVFNFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINIATIASSRYVGPLKSRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFAL--MPPTEGKIPGMDTEP---EKVFTNDILAMLSPEGERVGLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKPRTEWVIAGHPSQVILTISQIMWCRDLTESLE-CEGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHRNIITALITIDVHARDIVSELVQAKVDSADSFDWQRQLRYYWDMDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDVVLIRALRDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVEVMINQNLQPELCMVKKVIQLYETMLVRHGVMLVGPTGGGKTTVYQVLAETLGNLEK--LNTDNPFYQPVKTYVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMRTMSKKLNDEVQEYLLNLFNRYVDDGLHFVNKKCTQAIPQVDISKVTTLCCLLESLLLSKDGNILSMEQMKLNTVLCQTFVFCYLWSLGGNLTENYWDSFDTFIRTQFDDNPDARLPSSGDLWSIHIDFDTKRLDPWERIIPTFKYSRDVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVIAKGLLNRIQESAGYVPVYLNFSAQTSSSRTQEIIESKLERKRKNILGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLADFPEAVKQTSSNIVEAAVEIYNRMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREELQIFRLFCHECQRVFHDRLINNEDKHYFHLILTEMANKHFGIAIDLEYFLSKPIIFGDFIKFGAEKSDRIYDDLPDMEKIENVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCMQIELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEHVLAATRPKAKEVGISEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKSFFSSVDTGNDDLREKLSLMCVNVHLSVSHMAERYYNELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVLVDKMKLDLSALEPVLLQKSQDVEALMEKLVVDQESADQVRNVVQEDEAIAKVKAEETQAIADDAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPTAKQLLGDSNFLRRLLEYDKENIKPQILLKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATMATLKEKQALLKQVEDQIKTLQDKYEKGVNEKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIEKFQEELANIVGNVFIAAACVAYYGAFTAQYRQLLIEWWIESCLALEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMTSKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSEKSDNLHERLKILLQQTLLTAYTNVSRGLFEQHKLIYSFMLCVDIMREHEQLTEAEWNFFLRGSAGMEKERPPKPEAPWLPIQMWFSCCDLEESFPIFEGLTKHILLRPISIKLGSFETYIN----------PPV--WEGYPKQRHEEE-----KDHVWGLDFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTGSDPMGAFQRFARESGYAERVQSISLGQGQGPIAEKMIKDAMKTGNW 3581          

HSP 2 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 364/603 (60.36%), Postives = 463/603 (76.78%), Query Frame = -3
Query:   63 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSK 1871
            F+   ++  Y ERVQ+ISLGQGQGP+AEKM+  A K G+WVFLQNCHLA SWM+ +EE++K  ++    + + FRLFLSSMP  TFP++VLQNSVKVTNEPPKGLRANI+RAF EM+P FFE ++LG+ WRKLIFGICFFH+II +RKKFGPLGWNI YEF+DSDRECA+LNL ++C +G I WDAL YIT EITYGGRVTD WDQRCLR +L  FF P+T+ +DY YS SGIY+ P  +++ ++K++++ LPL+++PEIFGMHENANL FQ +ET  LI TIL+VQPR ++GG G++ D+IV EL   I  ++ + +  E A   LF  D +GRLNSLTTVL QEVDRFN LL +I  SL  L KAI G VVMSEE+E VY +F NNQVP+LWSN AYPSLKPL +WVKDL +R      W+ +G PKSFW+ GFFFPQGFLTGTLQN+ARKY+ PID LSF++ +   YR+Q  V++  K+++FG  +  DK L SP DGVLVHG++MD  RWDD++  I  ++ G+M  +LP++H  PK +YEP  T Y SPLYKT  RAG LSTTG STNFVV V LP+ + S++WI+ G+AL+C+ S+
Sbjct: 3542 FQRFARESGYAERVQSISLGQGQGPIAEKMIKDAMKTGNWVFLQNCHLAVSWMLAMEELIKTFTDPNQTIKDTFRLFLSSMPCSTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGMKWRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLNLYCHEGKIPWDALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLDDDYTYSDSGIYFAPLADSLQDFKEYIEDLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQPRSSSGGQGKSNDEIVQELVASIQTRVPESLQMEGASESLFVKDPQGRLNSLTTVLGQEVDRFNNLLKLIHISLETLNKAIAGLVVMSEEMEKVYQSFLNNQVPSLWSNTAYPSLKPLGSWVKDLILRTEFVDLWLKRGQPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYNMIPVYRDQAAVIESAKDIQFGTELPMDKELPSPEDGVLVHGMFMDASRWDDKDMVIEDALPGQMNPMLPVVHFEPKQNYEPVHTLYHSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRISDYWISKGSALLCQLSE 4144          
BLAST of SMED30008756 vs. Ensembl Mouse
Match: Dnah6 (dynein, axonemal, heavy chain 6 [Source:MGI Symbol;Acc:MGI:107744])

HSP 1 Score: 4279.94 bits (11099), Expect = 0.000e+0
Identity = 2118/3450 (61.39%), Postives = 2645/3450 (76.67%), Query Frame = -2
Query: 1759 KIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESS-DGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGH-YDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK--NDGRCCENW 12093
            +II I+ E   + FLY+   + K    Y  YNLKVVSY N+ K D+Y +S +  TH V  D+I++I ++R+E EY  + ++ KIP F  FR WKAF  WRK ++  K   C K L  +LFI+N  LRPALL + EMC+ +S MGLC +EK  TYTL +F  AQI +L EV  +L  FR   ++V+R +CR +L   GF PDD      +   Y +      +S +   +D+  Y E+ +KMTYTEQA+KR+HC RLT FIRL DYLI NT+HVL VN+  +LLN+ SD+LK+TP+A+ I  +                   EE+ +V   K + +  ++  EE++++V  P+F+TE +L+VQ+LLF P  E F +GI+  I  F+NTVLSV NLVPD+YFD+FT P IN K EEKTCG GP+++A+F +D +   +I Q  + I AAF++   YA+TF + + F+++NES DL+A++  + DV+FF     +YH++ +    +   + +G++L+D  ++K+ ++PSP RCL+V+N MLP +++K+VDA+I E+QDAEY L   PT T++YVN+L FL EIQ R+E LE EA+V+ +MY LI+ + VPTPPEDFAV+ T+ PSI   +NAIDK++ DR+ +I +FC  L +D+ +L  EV +++    +P ILD+ A++ ++K  L  L++ +++LQ RAF YKSYQKNFKVE ++ + LEEV+AEL+LKQ+LWDSL EWD+   EWL+ +F  L+PE L +Q  KY K V QLEKGLPPN VVP LK KVE+M+EK+ VI +L NP L+ RHW  IE  ++    ++E  LTL +L EL+VF++ +E+++ISGQAS EA+LE +LKKVE++W+ TE+V+LPH+DSKDVFILGGTD+IQ L DDS IN+ATIASSR+VGP+K RVD+W K L LF +T+EEWLNCQRNWLYLESIF+APDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T PGLL+TF+NNN LLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNP AVQPHLRKCFD+ISKL+FA+   P  E    GM   P   E  +TNDILAM+SPEGE+V LGKGLKARGNVEEWLGKVEEAMF +LR+L + +I ++    R EW+ A H +Q++LT+ Q+MWCR++T  LE    + +  + DFE   F+ LN LA +VRG LPKL R  + ALIT++VHARD+V+E+V+ KV   + F+WQ+QLRYYWD  LDNCV RM+ S YTY YEYLG  PRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAK+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRP+AMMVP+Y LIAEVILYSEGFESSK LA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENPD  EDVVLIRALRDSNLPKFL  DA LF  I+ DLFPGV++PEHDYG  +  I  V+ N  LQ     V KVIQ YET+ VRHGVMLVGPTGGGKTTVY VLA+ L NL    L  + P YQPVK Y+LNPKSITMGELYGEVN +TLEW DGLM   VR    DTS+DH+W+I DGPVDALWIENMNTVLDDNKMLCLANSERIKLTP +HMLFEVQDL VASPATVSRCGMV+VDPEEL WMP+VKTW+ +M+ KL  EV +YL  +F +Y+DDGL F   KC Q + QV I+K+ T+C LLESLL+      L+++  KLN  +   FVFCYLW +GGNL E+ WDSFD F+R +F+DN D R+PS GDLWS + D  ++++D WE+I+P FK++++VPFFEM+VPT DT+R+GYL+EKLL V+ SVLFTG TGVGKSV+A+G LN I E+AGYVPV++NFSAQTSS+RTQE+IE+KLE+KRK +LGAP NK+V+IF+DDLNMP+LD YGSQPPIELLRQYQDFGGFYDR+KL W  IQD+T+ +AC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF +IL GF ADFP+ V+  + NIV AAVEIYNRM  DLLPTPAKSHYVFNLRDLSKC+QGILQCDP  +R++  +F+LFCHE QRVFHDRLIN+EDK +FH I+ EMA+K+FG  I+ E F+  PIIFGDF+K G EK +R+Y+ L D  K++N+L  YLDD+N+ + KE+KLVFF DAI+H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA + GY C QIEL RGY+Y+ FH DL+K+Y+  G+ ++  VFLFTDTQIVVEEFLEDINNILNSGEVP+LFE DE E ++   R  AKE G+SEGNRD +F++ I+RVR  LHIVLCMSPVG +FRSRCRMFPSLVNCCTIDWF  WP EALL+V+KS F  VD G D+L+ KL+LMC  +H SV+  +ER+Y EL+R YYTTPTSYLELI LYL+MLTEK+KQLV+ RDRVKNGLTK+LETN L+  M+++L AL P L QK +D EALM+KL  DQE AD VR+ V+EDEA+AKVKA+ETQAIADDAQRDL+EA+PALE A KALD+LDK DI+EIRVFT PP +V TVME++ +LL  K DW +AK +LGD  FL++L +Y K+NI   +L KL++YI++P+F  E VEKVSKAC+S+ +WVRAMD+YS+ VK VEPK+++L  A  ELD  M  L++KQA L  VE++I  LQ  Y+  V EK++L  N+ALT ARL RAGKLT AL DE+ RW ES+ KF EEL N+VG+VF+ AACVAYYGAFT+ YR  L+  WI  C  LEIP+    +L+ +LGD +E+RQWN++GLPRD +STEN ILVT+GRRWPLMIDPQ+QANRWIRNKE+ + LK+IKL++ NFLR LEN IRLG+P LLE++ E LDPALEPILLKQTF+  GR LIHLGDSDI+Y K F+ Y+T+K+ NPHY+PE+CIKVTIINFTVT  GLEDQLL +V RLE+PELEEQR  LI+RIN+DKNQL+  E++ILKLLF SEGNILD+E+LI+TL +SK+TS     R+ EAE TE  I +AR +Y PVA +GSVMYFV+A+++EIDPMYQ+SLKYFK LFN TIE S+KS +L ER+KILL +T +  Y NV+RGLFE+ KL++SFMLC+ IMR++  +++ EW FFLRG  G+EK+RP KP  PW+ + +W +  D+ +  P+F  L   I    I + +G     +N          PPV   E   K R + E       H + L  +SF KLILVK   EEK+V  +T+FV  NLG +F+E PP DL  L+QDMS  +PLVF+LSTGSDPM  FQRFA+E     +  S   G   G    K   D     NW
Sbjct:  185 QIIKIVHENEHLGFLYMISAVPKSSIEYDTYNLKVVSYENINKNDYYTISKDAVTH-VYNDDIEYIEIERWEQEYLYHRELTKIPIFALFRKWKAFSVWRKNVRSKKITGCRKALRKNLFIVNPYLRPALLKINEMCYLLSFMGLCYIEKFHTYTLQEFKAAQIVRLQEVTERLEVFRCAAKDVVRKSCRFALRAAGFIPDD-----CEVETYEDYFKANIASLVDGPFDLPTYGES-EKMTYTEQASKRHHCMRLTCFIRLNDYLIQNTLHVLTVNTASSLLNFFSDKLKRTPSADVIQKWIT-----------------EEKPEVTEKKGAPL--MEKQEEDESLV--PMFLTELILTVQSLLFEPSLEDFLDGISGAINHFENTVLSVPNLVPDSYFDAFTSPFINKKVEEKTCGPGPNLSAVFEDDRNFLTIIMQIKETIHAAFDSARLYAATFEKFQLFFKENESLDLEALKQEEPDVQFFSSQLEKYHKQHKDSVALRPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMPTTTIEYVNSLVFLDEIQERIETLEEEANVVVQMYKLIEQYQVPTPPEDFAVFATMKPSITAVRNAIDKSVGDRETSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQILDISADQEKIKTMLSDLQSVLDDLQKRAFQYKSYQKNFKVEVSKFDALEEVSAELRLKQLLWDSLSEWDNLQQEWLKSKFDCLDPEVLNSQVTKYAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDALLVDTEIPLTLERLSELHVFNFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINIATIASSRYVGPLKSRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFAL--MPPTEGKIPGMDTEP---EKVFTNDILAMLSPEGERVGLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKPRTEWVIAGHPSQVILTISQIMWCRDLTESLE-CEGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHRNIITALITIDVHARDIVSELVQAKVDSADSFDWQRQLRYYWDMDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDVVLIRALRDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVEVMINQNLQPELCMVKKVIQLYETMLVRHGVMLVGPTGGGKTTVYQVLAETLGNLEK--LNTDNPFYQPVKTYVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMRTMSKKLNDEVQEYLLNLFNRYVDDGLHFVNKKCTQAIPQVDISKVTTLCCLLESLLLSKDGNILSMEQMKLNTVLCQTFVFCYLWSLGGNLTENYWDSFDTFIRTQFDDNPDARLPSSGDLWSIHIDFDTKRLDPWERIIPTFKYSRDVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVIAKGLLNRIQESAGYVPVYLNFSAQTSSSRTQEIIESKLERKRKNILGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLADFPEAVKQTSSNIVEAAVEIYNRMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREELQIFRLFCHECQRVFHDRLINNEDKHYFHLILTEMANKHFGIAIDLEYFLSKPIIFGDFIKFGAEKSDRIYDDLPDMEKIENVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCMQIELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEHVLAATRPKAKEVGISEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKSFFSSVDTGNDDLREKLSLMCVNVHLSVSHMAERYYNELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVLVDKMKLDLSALEPVLLQKSQDVEALMEKLVVDQESADQVRNVVQEDEAIAKVKAEETQAIADDAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPTAKQLLGDSNFLRRLLEYDKENIKPQILLKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATMATLKEKQALLKQVEDQIKTLQDKYEKGVNEKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIEKFQEELANIVGNVFIAAACVAYYGAFTAQYRQLLIEWWIESCLALEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMTSKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSEKSDNLHERLKILLQQTLLTAYTNVSRGLFEQHKLIYSFMLCVDIMREHEQLTEAEWNFFLRGSAGMEKERPPKPEAPWLPIQMWFSCCDLEESFPIFEGLTKHILLRPISIKLGSFETYIN----------PPV--WEGYPKQRHEEE-----KDHVWGLDFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTGSDPMGAFQRFARESGYAERVQSISLGQGQGPIAEKMIKDAMKTGNW 3581          

HSP 2 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 364/603 (60.36%), Postives = 463/603 (76.78%), Query Frame = -3
Query:   63 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSK 1871
            F+   ++  Y ERVQ+ISLGQGQGP+AEKM+  A K G+WVFLQNCHLA SWM+ +EE++K  ++    + + FRLFLSSMP  TFP++VLQNSVKVTNEPPKGLRANI+RAF EM+P FFE ++LG+ WRKLIFGICFFH+II +RKKFGPLGWNI YEF+DSDRECA+LNL ++C +G I WDAL YIT EITYGGRVTD WDQRCLR +L  FF P+T+ +DY YS SGIY+ P  +++ ++K++++ LPL+++PEIFGMHENANL FQ +ET  LI TIL+VQPR ++GG G++ D+IV EL   I  ++ + +  E A   LF  D +GRLNSLTTVL QEVDRFN LL +I  SL  L KAI G VVMSEE+E VY +F NNQVP+LWSN AYPSLKPL +WVKDL +R      W+ +G PKSFW+ GFFFPQGFLTGTLQN+ARKY+ PID LSF++ +   YR+Q  V++  K+++FG  +  DK L SP DGVLVHG++MD  RWDD++  I  ++ G+M  +LP++H  PK +YEP  T Y SPLYKT  RAG LSTTG STNFVV V LP+ + S++WI+ G+AL+C+ S+
Sbjct: 3542 FQRFARESGYAERVQSISLGQGQGPIAEKMIKDAMKTGNWVFLQNCHLAVSWMLAMEELIKTFTDPNQTIKDTFRLFLSSMPCSTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGMKWRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLNLYCHEGKIPWDALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLDDDYTYSDSGIYFAPLADSLQDFKEYIEDLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQPRSSSGGQGKSNDEIVQELVASIQTRVPESLQMEGASESLFVKDPQGRLNSLTTVLGQEVDRFNNLLKLIHISLETLNKAIAGLVVMSEEMEKVYQSFLNNQVPSLWSNTAYPSLKPLGSWVKDLILRTEFVDLWLKRGQPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYNMIPVYRDQAAVIESAKDIQFGTELPMDKELPSPEDGVLVHGMFMDASRWDDKDMVIEDALPGQMNPMLPVVHFEPKQNYEPVHTLYHSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRISDYWISKGSALLCQLSE 4144          
BLAST of SMED30008756 vs. Ensembl Mouse
Match: Dnah6 (dynein, axonemal, heavy chain 6 [Source:MGI Symbol;Acc:MGI:107744])

HSP 1 Score: 4175.93 bits (10829), Expect = 0.000e+0
Identity = 2082/3450 (60.35%), Postives = 2605/3450 (75.51%), Query Frame = -2
Query: 1759 KIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESS-DGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGH-YDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK--NDGRCCENW 12093
            +II I+ E   + FLY+   + K    Y  YNLKVVSY N+ K D+Y +S +  TH V  D+I++I ++R+E EY  + ++ KIP F  FR WKAF  WRK ++  K   C K L  +LFI+N  LRPALL + EMC+ +S MGLC +EK  TYTL +F  AQI +L EV  +L  FR   ++V+R +CR +L   GF PDD      +   Y +      +S +   +D+  Y E+ +KMTYTEQA+KR+HC RLT FIRL DYLI NT+HVL VN+  +LLN+ SD+LK+TP+A+ I  +                   EE+ +V   K + +  ++  EE++++V  P+F+TE +L+VQ+LLF P  E F +GI+  I  F+NTVLSV NLVPD+YFD+FT P IN K EEKTCG GP+++A+F +D +   +I Q  + I AAF++   YA+TF + + F+++NES DL+A++  + DV+FF     +YH++ +    +   + +G++L+D  ++K+ ++PSP RCL+V+N MLP +++K+VDA+I E+QDAEY L   PT T++YVN+L FL EIQ R+E LE EA+V+ +MY LI+ + VPTPPEDFAV+ T+ PSI   +NAIDK++ DR+ +I +FC  L +D+ +L  EV +++    +P ILD+ A++ ++K  L  L++ +++LQ RAF YKSYQKNFKVE ++ + LEEV+AEL+LKQ+LWDSL EWD+   EWL+ +F  L+PE L +Q  KY K V QLEKGLPPN VVP LK KVE+M+EK+ VI +L NP L+ RHW  IE  ++    ++E  LTL +L EL+VF++ +E+++ISGQAS EA+LE +LKKVE++W+ TE+V+LPH+DSKDVFILGGTD+IQ L DDS IN+ATIASSR+VGP+K RVD+W K L LF +T+EEWLNCQRNWLYLESIF+APDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T PGLL+TF+NNN LLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNP AVQPHLRKCFD+ISKL+FA+   P  E    GM   P   E  +TNDILAM+SPEGE+V LGKGLKARGNVEEWLGKVEEAMF +LR+L + +I ++    R EW+ A H +Q++LT+ Q+MWCR++T  LE    + +  + DFE   F+ LN LA +VRG LPKL R  + ALIT++VHARD+V+E+V+ K                                                    DRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAK+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRP+AMMVP+Y LIAEVILYSEGFESSK LA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENPD  EDVVLIRALRDSNLPKFL  DA LF  I+ DLFPGV++PEHDYG  +  I  V+ N  LQ     V KVIQ YET+ VRHGVMLVGPTGGGKTTVY VLA+ L NL    L  + P YQPVK Y+LNPKSITMGELYGEVN +TLEW DGLM   VR    DTS+DH+W+I DGPVDALWIENMNTVLDDNKMLCLANSERIKLTP +HMLFEVQDL VASPATVSRCGMV+VDPEEL WMP+VKTW+ +M+ KL  EV +YL  +F +Y+DDGL F   KC Q + QV I+K+ T+C LLESLL+      L+++  KLN  +   FVFCYLW +GGNL E+ WDSFD F+R +F+DN D R+PS GDLWS + D  ++++D WE+I+P FK++++VPFFEM+VPT DT+R+GYL+EKLL V+ SVLFTG TGVGKSV+A+G LN I E+AGYVPV++NFSAQTSS+RTQE+IE+KLE+KRK +LGAP NK+V+IF+DDLNMP+LD YGSQPPIELLRQYQDFGGFYDR+KL W  IQD+T+ +AC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF +IL GF ADFP+ V+  + NIV AAVEIYNRM  DLLPTPAKSHYVFNLRDLSKC+QGILQCDP  +R++  +F+LFCHE QRVFHDRLIN+EDK +FH I+ EMA+K+FG  I+ E F+  PIIFGDF+K G EK +R+Y+ L D  K++N+L  YLDD+N+ + KE+KLVFF DAI+H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA + GY C QIEL RGY+Y+ FH DL+K+Y+  G+ ++  VFLFTDTQIVVEEFLEDINNILNSGEVP+LFE DE E ++   R  AKE G+SEGNRD +F++ I+RVR  LHIVLCMSPVG +FRSRCRMFPSLVNCCTIDWF  WP EALL+V+KS F  VD G D+L+ KL+LMC  +H SV+  +ER+Y EL+R YYTTPTSYLELI LYL+MLTEK+KQLV+ RDRVKNGLTK+LETN L+  M+++L AL P L QK +D EALM+KL  DQE AD VR+ V+EDEA+AKVKA+ETQAIADDAQRDL+EA+PALE A KALD+LDK DI+EIRVFT PP +V TVME++ +LL  K DW +AK +LGD  FL++L +Y K+NI   +L KL++YI++P+F  E VEKVSKAC+S+ +WVRAMD+YS+ VK VEPK+++L  A  ELD  M  L++KQA L  VE++I  LQ  Y+  V EK++L  N+ALT ARL RAGKLT AL DE+ RW ES+ KF EEL N+VG+VF+ AACVAYYGAFT+ YR  L+  WI  C  LEIP+    +L+ +LGD +E+RQWN++GLPRD +STEN ILVT+GRRWPLMIDPQ+QANRWIRNKE+ + LK+IKL++ NFLR LEN IRLG+P LLE++ E LDPALEPILLKQTF+  GR LIHLGDSDI+Y K F+ Y+T+K+ NPHY+PE+CIKVTIINFTVT  GLEDQLL +V RLE+PELEEQR  LI+RIN+DKNQL+  E++ILKLLF SEGNILD+E+LI+TL +SK+TS     R+ EAE TE  I +AR +Y PVA +GSVMYFV+A+++EIDPMYQ+SLKYFK LFN TIE S+KS +L ER+KILL +T +  Y NV+RGLFE+ KL++SFMLC+ IMR++  +++ EW FFLRG  G+EK+RP KP  PW+ + +W +  D+ +  P+F  L   I    I + +G     +N          PPV   E   K R + E       H + L  +SF KLILVK   EEK+V  +T+FV  NLG +F+E PP DL  L+QDMS  +PLVF+LSTGSDPM  FQRFA+E     +  S   G   G    K   D     NW
Sbjct:  185 QIIKIVHENEHLGFLYMISAVPKSSIEYDTYNLKVVSYENINKNDYYTISKDAVTH-VYNDDIEYIEIERWEQEYLYHRELTKIPIFALFRKWKAFSVWRKNVRSKKITGCRKALRKNLFIVNPYLRPALLKINEMCYLLSFMGLCYIEKFHTYTLQEFKAAQIVRLQEVTERLEVFRCAAKDVVRKSCRFALRAAGFIPDD-----CEVETYEDYFKANIASLVDGPFDLPTYGES-EKMTYTEQASKRHHCMRLTCFIRLNDYLIQNTLHVLTVNTASSLLNFFSDKLKRTPSADVIQKWIT-----------------EEKPEVTEKKGAPL--MEKQEEDESLV--PMFLTELILTVQSLLFEPSLEDFLDGISGAINHFENTVLSVPNLVPDSYFDAFTSPFINKKVEEKTCGPGPNLSAVFEDDRNFLTIIMQIKETIHAAFDSARLYAATFEKFQLFFKENESLDLEALKQEEPDVQFFSSQLEKYHKQHKDSVALRPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMPTTTIEYVNSLVFLDEIQERIETLEEEANVVVQMYKLIEQYQVPTPPEDFAVFATMKPSITAVRNAIDKSVGDRETSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQILDISADQEKIKTMLSDLQSVLDDLQKRAFQYKSYQKNFKVEVSKFDALEEVSAELRLKQLLWDSLSEWDNLQQEWLKSKFDCLDPEVLNSQVTKYAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDALLVDTEIPLTLERLSELHVFNFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINIATIASSRYVGPLKSRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFAL--MPPTEGKIPGMDTEP---EKVFTNDILAMLSPEGERVGLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKPRTEWVIAGHPSQVILTISQIMWCRDLTESLE-CEGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHRNIITALITIDVHARDIVSELVQAK----------------------------------------------------DRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDVVLIRALRDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVEVMINQNLQPELCMVKKVIQLYETMLVRHGVMLVGPTGGGKTTVYQVLAETLGNLEK--LNTDNPFYQPVKTYVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMRTMSKKLNDEVQEYLLNLFNRYVDDGLHFVNKKCTQAIPQVDISKVTTLCCLLESLLLSKDGNILSMEQMKLNTVLCQTFVFCYLWSLGGNLTENYWDSFDTFIRTQFDDNPDARLPSSGDLWSIHIDFDTKRLDPWERIIPTFKYSRDVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVIAKGLLNRIQESAGYVPVYLNFSAQTSSSRTQEIIESKLERKRKNILGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLADFPEAVKQTSSNIVEAAVEIYNRMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREELQIFRLFCHECQRVFHDRLINNEDKHYFHLILTEMANKHFGIAIDLEYFLSKPIIFGDFIKFGAEKSDRIYDDLPDMEKIENVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCMQIELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEHVLAATRPKAKEVGISEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKSFFSSVDTGNDDLREKLSLMCVNVHLSVSHMAERYYNELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVLVDKMKLDLSALEPVLLQKSQDVEALMEKLVVDQESADQVRNVVQEDEAIAKVKAEETQAIADDAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPTAKQLLGDSNFLRRLLEYDKENIKPQILLKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATMATLKEKQALLKQVEDQIKTLQDKYEKGVNEKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIEKFQEELANIVGNVFIAAACVAYYGAFTAQYRQLLIEWWIESCLALEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMTSKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSEKSDNLHERLKILLQQTLLTAYTNVSRGLFEQHKLIYSFMLCVDIMREHEQLTEAEWNFFLRGSAGMEKERPPKPEAPWLPIQMWFSCCDLEESFPIFEGLTKHILLRPISIKLGSFETYIN----------PPV--WEGYPKQRHEEE-----KDHVWGLDFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTGSDPMGAFQRFARESGYAERVQSISLGQGQGPIAEKMIKDAMKTGNW 3529          

HSP 2 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 364/603 (60.36%), Postives = 463/603 (76.78%), Query Frame = -3
Query:   63 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSK 1871
            F+   ++  Y ERVQ+ISLGQGQGP+AEKM+  A K G+WVFLQNCHLA SWM+ +EE++K  ++    + + FRLFLSSMP  TFP++VLQNSVKVTNEPPKGLRANI+RAF EM+P FFE ++LG+ WRKLIFGICFFH+II +RKKFGPLGWNI YEF+DSDRECA+LNL ++C +G I WDAL YIT EITYGGRVTD WDQRCLR +L  FF P+T+ +DY YS SGIY+ P  +++ ++K++++ LPL+++PEIFGMHENANL FQ +ET  LI TIL+VQPR ++GG G++ D+IV EL   I  ++ + +  E A   LF  D +GRLNSLTTVL QEVDRFN LL +I  SL  L KAI G VVMSEE+E VY +F NNQVP+LWSN AYPSLKPL +WVKDL +R      W+ +G PKSFW+ GFFFPQGFLTGTLQN+ARKY+ PID LSF++ +   YR+Q  V++  K+++FG  +  DK L SP DGVLVHG++MD  RWDD++  I  ++ G+M  +LP++H  PK +YEP  T Y SPLYKT  RAG LSTTG STNFVV V LP+ + S++WI+ G+AL+C+ S+
Sbjct: 3490 FQRFARESGYAERVQSISLGQGQGPIAEKMIKDAMKTGNWVFLQNCHLAVSWMLAMEELIKTFTDPNQTIKDTFRLFLSSMPCSTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGMKWRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLNLYCHEGKIPWDALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLDDDYTYSDSGIYFAPLADSLQDFKEYIEDLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQPRSSSGGQGKSNDEIVQELVASIQTRVPESLQMEGASESLFVKDPQGRLNSLTTVLGQEVDRFNNLLKLIHISLETLNKAIAGLVVMSEEMEKVYQSFLNNQVPSLWSNTAYPSLKPLGSWVKDLILRTEFVDLWLKRGQPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYNMIPVYRDQAAVIESAKDIQFGTELPMDKELPSPEDGVLVHGMFMDASRWDDKDMVIEDALPGQMNPMLPVVHFEPKQNYEPVHTLYHSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRISDYWISKGSALLCQLSE 4092          
BLAST of SMED30008756 vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 2114.73 bits (5478), Expect = 0.000e+0
Identity = 1133/2731 (41.49%), Postives = 1686/2731 (61.74%), Query Frame = -2
Query: 1813 FKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLW----EKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDE-LKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSG-WIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKK-RPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFG 9969
            FK+EQ   +DL+ +  EL   Q +W+   +W+  +N+W    F  L  E + +      + + +L K       +++   + K+EQ +  M +I++L NP L+ERHW Q+++ +  +F +  E  TL ++++L +  + E++ EIS  A+ E ++E  L+ + + W  T+  ++P+KD K    L GT+E+ Q  +D+ + ++T+ +SR V   +  VD W + L L  + IE  L  QR W+YLE+IF   DI++QLP+E+  F  V+ ++K IM ++ K   A+R+T  PGLL+T    N +L+ IQK L+ YLE+KR IFPRFYFLSND+LLEIL Q+RNP AVQPHL+KCFD I  L        K++   G          K+  + + M S +GE +     +   G VE WLG VE AM + LR LLR           +R++W+K  A Q+V+T  Q+ W  ++T  L    E   + ++   +     LNK +  +RG L K+ R  + AL+T+ +HARD++ ++ K  + D++ F+W  QLR+YW+  +D+C++R +N+ + YGYEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR +SGLAQSGAW CFDEFNRI+IEVLSV+AQQ+++I +A  A ++RF FEG EI LV +C  FITMNPGYAGRTELP+NLK++FRPIAM+VPD  LIAE+IL+ EGF + K LA+K+  +Y L  +QLS+QDHYDFG+RAL S+L  AG+ +R  PD  ++ VL+ ++RD N+ K    D  LF AI+QDLFP +ELP  DYG+ +  IE  I   GLQI P  + KV+Q YET   RH  M+VG TG  KTT + +L   L++L  AG     P+Y  V+ + LNPK++++GELYGE +  T EW DG++  ++R+ C D   D +W++ DGPVD LWIE+MN+V+DDNK+L L N ERI +   V +LFEV++L+VASPATVSRCGMVY D  +LGW P+V++WL     + K EV + L  MFEK+I+  L F +  C + +     + I ++C+L  ++L  P       DA+  +  + + FVF  +W +  ++ E      D+++R   E  G    P++  ++  Y +    KM  W    EK+   +++    PF++++VPTVDT+R+ YL+  L+  +  VL  G  G GK+ +A+  L ++  +   V V +N SAQT+SN  Q +IE+++EK+ K V      K +I F+DDLNMP  D +GSQPP+EL+R + D+G +YDR K +   I+DM L AA GPPGGGR  +S RL   F + ++  P+E  + +IF +++     DF ++V+     +  A +++YN +    LPTPAK HY+FNLRD+SK  QG+L+ +      K+ + +L+ HE  RVF DRL++  D   F  I+++    +F          K P IFGDF+K       ++YE L D   +K  + + L+++N++ S   M+LV F +AI+HI RI R+I Q RGN LLVG+GG+G+QSL RLA+ +  YN FQIE+ + Y    F  D+K++Y   G+  Q T FLF DTQI  E FLEDINNIL+SGEVP+L++ DE+E +       A+   + E + D +F + I RVRNNLHIVLC+SPVG  FR+  R +P+LVNC TI+WF+ WP EALL VA+     VD+G  E +  K+A +   +H SVA+ S++   EL+R+ Y TPT+YLEL++ Y  +L EK+++L+ + ++++ GL KI ET E +  M +EL   + ++ + QK  E  +  +   + +AD  +  V  +     ++  + QA+AD+AQ+DL+EA+PALE A++AL++L+K DI EI+ +  PP  V+ VM++V +L G +  WA AK  LG+  F+K L ++ KDNI + +LKK+  Y   P+F  + + +VS A +SL +WVRAM++Y +  + VEPK+ R+  A  +L E    L + Q +L  V  K+  L+K YD  + +K+ L         +L+RAG L + LA EK RW E+V    E+LG +VGD  + AA ++Y G F ++YR E+++  WI + REL++P S    +   L +  ++R WN +GLP D  STEN I+VTRG RW LMIDPQ QA +WI+N E    LKII L   ++LR LE+ I+ G P LL+++ E LDP L P+L K      GR LI +GD ++EY+ +F+ Y+TTKLSNPHY PE   K TI+NF V  QGLE QLLG V R ERPELEEQ+++L+I I   K +L+  E+ IL+LL E+ G++LD   L+NTL  SK+T+ E T+++  +E TE  I +AR  Y P A R SV++FV+ +M  IDPMYQFSL  +  LF  +I+ S +S  LE+RI+ L    T A Y    R LFE+ KL+FSF +C +I+  +G ++  E+ FFLRG   ++++ + + P   W++   W+N+ ++ D +  F  L+N   Q                            P +  +  +    E A  L G ++      Q++++V++  ++++  C+T F+  NLG+RF+EPP  ++  + +D +  SPLVF+LS G DP +   + A+   +  +  +   G
Sbjct: 1245 FKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKD-KGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLL--------KIQKVGG-------SSSKW--EAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVSI-----LNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAG----EPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEK---RPKTEV-EPLQRMFEKFINKILSFKKDNCNELVPVPEYSGIISLCKLY-TVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLR---EIEGS--FPNKDTVYEYYVN---PKMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLV-VNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFLK-----EPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESS-DSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITEL-DKLTNFHGLMNSFEQ---------------------------YPRDWHLWYTNSSPEKAM-LPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLG 3899          

HSP 2 Score: 391.734 bits (1005), Expect = 5.968e-108
Identity = 229/604 (37.91%), Postives = 339/604 (56.13%), Query Frame = -3
Query:   78 LPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKK-RSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVED-YKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGT-GRTTDDIVYELADQILEKLIDKINPEEAKPDL-FHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKS-FWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK--YISPLYKTEERAGVLSTTGMSTNFVVAVPLPT-DQESNFWINMGAALI 1862
            L +      R  A+SLGQGQ P+A +++      G WVFL NCHL+ SWM  L+++V++ + E+P   H +FRL+LSS P   FPIS+LQ S+K+T EPPKGL+AN+ R +  M+   F        ++KL+F +CFFHSI+L+RKKF  LGWNI Y F+DSD E +   L ++  +     WDAL Y+ A + YGG VTD WD+R L   +  +F   ++    Y+ S    YY P+  ++  YK+++  LP ++ PE FG H NA+++ QI E + L  T+L +QP+I      G++ ++ V ELA  + +K+ + I+ E  +  L   P      + L  VL+QE+ R+NKL+  I  SL  L+K I+G +VMS  LE ++    +  VP LW  V YPS KPL++W +DLA+R      W  +  P   FWL GF FP GFLT  LQ+ AR+ +  +D LS+EFIV                      ++    +  P DGV V GLY++G  WD +N  ++ +   +++ ++P +H  P  +   +S K  Y  P Y    RAG  ST   S  FV+ + L +    S+ WI  G AL+
Sbjct: 3883 LAEHTGMAHRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDP---HPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLALDP------SPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKV-YPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIV--------------------STVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPA-ESRKKSAKGMYSCPCYYYPNRAG--STDRAS--FVIGIDLRSGSMTSDHWIKRGTALL 4451          
BLAST of SMED30008756 vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 2109.34 bits (5464), Expect = 0.000e+0
Identity = 1137/2733 (41.60%), Postives = 1688/2733 (61.76%), Query Frame = -2
Query: 1813 FKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQD--LNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLW----EKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDE-LKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSG-WIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKK-RPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFG 9969
            FK+EQ   +DL+ +  EL   Q +W+   +W+  +N+W    F  L  E + +      + + +L K       +++   + K+EQ +  M +I++L NP L+ERHW Q+++ +  +F +  E  TL ++++L +  + E++ EIS  A+ E ++E  L+ + + W  T+  ++P+KD K    L GT+E+ Q  +D+ + ++T+ +SR V   +  VD W + L L  + IE  L  QR W+YLE+IF   DI++QLP+E+  F  V+ ++K IM ++ K   A+R+T  PGLL+T    N +L+ IQK L+ YLE+KR IFPRFYFLSND+LLEIL Q+RNP AVQPHL+KCFD I  L        K++   G          K+  + + M S +GE +     +   G VE WLG VE AM + LR LLR           +R++W+K  A Q+V+T  Q+ W  ++T  L    +ER    I   +K  Q   LNK +  +RG L K+ R  + AL+T+ +HARD++ ++ K  + D++ F+W  QLR+YW+  +D+C++R +N+ + YGYEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR +SGLAQSGAW CFDEFNRI+IEVLSV+AQQ+++I +A  A ++RF FEG EI LV +C  FITMNPGYAGRTELP+NLK++FRPIAM+VPD  LIAE+IL+ EGF + K LA+K+  +Y L  +QLS+QDHYDFG+RAL S+L  AG+ +R  PD  ++ VL+ ++RD N+ K    D  LF AI+QDLFP +ELP  DYG+ +  IE  I   GLQI P  + KV+Q YET   RH  M+VG TG  KTT + +L   L++L  AG     P+Y  V+ + LNPK++++GELYGE +  T EW DG++  ++R+ C D   D +W++ DGPVD LWIE+MN+V+DDNK+L L N ERI +   V +LFEV++L+VASPATVSRCGMVY D  +LGW P+V++WL     + K EV + L  MFEK+I+  L F +  C + +     + I ++C+L  ++L  P       DA+  +  + + FVF  +W +  ++ E      D+++R   E  G    P++  ++  Y +    KM  W    EK+   +++    PF++++VPTVDT+R+ YL+  L+  +  VL  G  G GK+ +A+  L ++  +   V V +N SAQT+SN  Q +IE+++EK+ K V      K +I F+DDLNMP  D +GSQPP+EL+R + D+G +YDR K +   I+DM L AA GPPGGGR  +S RL   F + ++  P+E  + +IF +++     DF ++V+     +  A +++YN +    LPTPAK HY+FNLRD+SK  QG+L+ +      K+ + +L+ HE  RVF DRL++  D   F  I+++    +F          K P IFGDF+K       ++YE L D   +K  + + L+++N++ S   M+LV F +AI+HI RI R+I Q RGN LLVG+GG+G+QSL RLA+ +  YN FQIE+ + Y    F  D+K++Y   G+  Q T FLF DTQI  E FLEDINNIL+SGEVP+L++ DE+E +       A+   + E + D +F + I RVRNNLHIVLC+SPVG  FR+  R +P+LVNC TI+WF+ WP EALL VA+     VD+G  E +  K+A +   +H SVA+ S++   EL+R+ Y TPT+YLEL++ Y  +L EK+++L+ + ++++ GL KI ET E +  M +EL   + ++ + QK  E  +  +   + +AD  +  V  +     ++  + QA+AD+AQ+DL+EA+PALE A++AL++L+K DI EI+ +  PP  V+ VM++V +L G +  WA AK  LG+  F+K L ++ KDNI + +LKK+  Y   P+F  + + +VS A +SL +WVRAM++Y +  + VEPK+ R+  A  +L E    L + Q +L  V  K+  L+K YD  + +K+ L         +L+RAG L + LA EK RW E+V    E+LG +VGD  + AA ++Y G F ++YR E+++  WI + REL++P S    +   L +  ++R WN +GLP D  STEN I+VTRG RW LMIDPQ QA +WI+N E    LKII L   ++LR LE+ I+ G P LL+++ E LDP L P+L K      GR LI +GD ++EY+ +F+ Y+TTKLSNPHY PE   K TI+NF V  QGLE QLLG V R ERPELEEQ+++L+I I   K +L+  E+ IL+LL E+ G++LD   L+NTL  SK+T+ E T+++  +E TE  I +AR  Y P A R SV++FV+ +M  IDPMYQFSL  +  LF  +I+ S +S  LE+RI+ L    T A Y    R LFE+ KL+FSF +C +I+  +G ++  E+ FFLRG   ++++ + + P   W++   W+N+ ++ D +  F  L+N   Q                            P +  +  +    E A  L G ++      Q++++V++  ++++  C+T F+  NLG+RF+EPP  ++  + +D +  SPLVF+LS G DP +   + A+   +  +  +   G
Sbjct: 1245 FKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKD-KGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLL--------KIQKVGG-------SSSKW--EAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLM-TAKERSDKKILKVMKKKQVSILNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAG----EPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEK---RPKTEV-EPLQRMFEKFINKILSFKKDNCNELVPVPEYSGIISLCKLY-TVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLR---EIEGS--FPNKDTVYEYYVN---PKMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLV-VNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFLK-----EPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESS-DSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITEL-DKLTNFHGLMNSFEQ---------------------------YPRDWHLWYTNSSPEKAM-LPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLG 3905          

HSP 2 Score: 391.734 bits (1005), Expect = 5.874e-108
Identity = 229/604 (37.91%), Postives = 339/604 (56.13%), Query Frame = -3
Query:   78 LPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKK-RSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVED-YKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGT-GRTTDDIVYELADQILEKLIDKINPEEAKPDL-FHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKS-FWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK--YISPLYKTEERAGVLSTTGMSTNFVVAVPLPT-DQESNFWINMGAALI 1862
            L +      R  A+SLGQGQ P+A +++      G WVFL NCHL+ SWM  L+++V++ + E+P   H +FRL+LSS P   FPIS+LQ S+K+T EPPKGL+AN+ R +  M+   F        ++KL+F +CFFHSI+L+RKKF  LGWNI Y F+DSD E +   L ++  +     WDAL Y+ A + YGG VTD WD+R L   +  +F   ++    Y+ S    YY P+  ++  YK+++  LP ++ PE FG H NA+++ QI E + L  T+L +QP+I      G++ ++ V ELA  + +K+ + I+ E  +  L   P      + L  VL+QE+ R+NKL+  I  SL  L+K I+G +VMS  LE ++    +  VP LW  V YPS KPL++W +DLA+R      W  +  P   FWL GF FP GFLT  LQ+ AR+ +  +D LS+EFIV                      ++    +  P DGV V GLY++G  WD +N  ++ +   +++ ++P +H  P  +   +S K  Y  P Y    RAG  ST   S  FV+ + L +    S+ WI  G AL+
Sbjct: 3889 LAEHTGMAHRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDP---HPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLALDP------SPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKV-YPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIV--------------------STVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPA-ESRKKSAKGMYSCPCYYYPNRAG--STDRAS--FVIGIDLRSGSMTSDHWIKRGTALL 4457          
BLAST of SMED30008756 vs. UniProt
Match: sp|Q9C0G6|DYH6_HUMAN (Dynein heavy chain 6, axonemal OS=Homo sapiens OX=9606 GN=DNAH6 PE=2 SV=3)

HSP 1 Score: 4293.42 bits (11134), Expect = 0.000e+0
Identity = 2099/3450 (60.84%), Postives = 2627/3450 (76.14%), Query Frame = -2
Query: 1759 KIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETP--KVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKA-HANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK--NDGRCCENW 12093
            +II I+RE   + FLY+   + +    Y  YNLKVVSY N+ K D+Y +S    THI   ++I+ I +DR+E EY  + ++ KIP F+ FR WKAF  WRK ++  K   C K L  +LFI+N  LRPALL + E+C+ +S MGLC +EK  TYTL +F  AQ+ +L EV  +L EFR   + V+R ACR +L   GF PDD        P        +  S++   +++  Y ++ +KMTYTEQA+KR++C RLT FIRL DYLI NTMH+L VN+V +LLN+++D+LK+TP+A+       ++ + I  E      +PE      P K+ ++   K  E+E  +   P+F+TE +L+VQ+LLF P  E F +GI   +   QNTVLSV NLVPD+YFD+FT P INNK E KTCG GPS+AA+F +D + H +I+Q  + I AAF +   YA+TF + + F+++NES DL A++  + D+ FF E   +YH++ +    +   + +G++L+D   +++ ++PSP RCL+V+N MLP  ++K+VDA+I E+QDAEY L   PT T +YV++L FL EIQ R+E LE E +++ +MY L++ + VPTPPEDFAV+ T+ PSI   +NAIDK++ DR+ +I +FC  L  D+ EL  EV +++    +P ILD+ A++ +++  L  L++ + +LQ RAF YKSYQKNFKVE ++ E LEEV+AELKLKQ+LWDS  EWD    EWL+ +F  L+PE L  Q +KY K V QLEKGLPPN VVP LK KVE+M+EK+ VI +L NP L+ RHW  IE  ++    ++E  LTL +L +L+VFD+ +E+++ISGQAS EA+LEA+LKKVE++W+ TE+V+LPH+DSKDVFILGGTD+IQ L DDS INVAT+ASSR++GP+K RVDEW K L LF +T+EEWL CQRNWLYLESIF+APDIQRQLP+EAK F+ VDKS+KEIMRKV ++P A+RA T PGLL+TF+NNN LLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNP AVQPHLRKCFD+ISKL+FA+      K+   DG P      E  YTNDILAM+SPEGE+VSLGKGLKARGNVEEWLGKVEEAMF +LR+L + +I ++    R +W+ A H +Q++LTV Q+MWCR++T  LE      +Q + +FE   F+ LN LA +V+G LPKL R  L ALIT++VHARD+VTE+V+ KV  +  F+WQ+QLRYYWD  LDNCV RM+ S YTYGYEYLG  PRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAK+SRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRP AMMVP+Y LIAEVILYSEGFESSK LA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENPD  EDVVLIRAL+DSNLPKFL  DA LF  I+ DLFPGV++PEHDYG  +  I  V+    LQ     V KVIQFYET+ VRHGVMLVGPTGGGKTTVY +LA+ L NL   G+  E   YQ VK Y+LNPKSITMGELYGEVN LTLEW DGLM   VR    DTS+DH+W+I DGPVDALWIENMNTVLDDNKMLCLANSERIKLTP +HMLFEVQDL VASPATVSRCGMV+VDPEEL WMP+VKTW+  ++ KL  E  +Y+  +F++Y+D+GL F   KC Q + QV I+K+ T+C LLESL++G    NL ++  KLN  +   FVFCYLW +GGNL E+ +DSFD F+R +F+DN D R+P+ GDLWS + D  ++++D WE+I+P FK+N++VPFFEM+VPT DT+R+GYL+EKLL VK SVLFTG TGVGKSV+A+G LN I E+AGYVPV++NFSAQTSS RTQE+IE+KLE+KRK +LGAP NKR++IF+DDLNMP+LD YGSQPPIELLRQYQDFGGFYDR+KL W  IQD+T+ +AC PPGGGRNPV+ R +RHF+M  +P PSE SL+QIF +IL GF +DFP  V+    +IV A+VEIYN+M  DLLPTPAKSHYVFNLRDLSKC+QGILQCDP  +R++  +F+LFCHE QRVFHDRLIN+EDK +FH I+ EMA+K+FG  I+ E F+  PIIFGDF+K G +K +R+Y+ + D  K  N+L  YLDD+N+ + KE+KLVFF DAI+H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA + GY C QIEL RGY+Y+ FH DL+K+Y+  G+ +++ VFLFTDTQIVVEEFLEDINNILNSGEVP+LFE DE E+++   R  AKE G+SEGNRD +F++ I++VR  LHIVLCMSPVG +FRSRCRMFPSLVNCCTIDWF  WP EALL+V+K+ F  VD G +ELK KL LMC  +H SV+  +ER+Y EL+R YYTTPTSYLELI LYLSML+EK+KQ+++ RDRVKNGLTK+LETN L+  M+++L AL P L  K +D EALM+KL  DQE AD VR+ V+EDEA AKVKA+ETQAIADDAQRDLDEA+PAL+ A KALD+LDK DI+EIRVFT PP +V TVME++ +LL  K DW SAK +LGD  FLK+L +Y K+NI   +L KL++YI++P+F  E VEKVSKAC+S+ +WVRAMD+YS+ VK VEPK+++L  A  ELD  M  LR+KQA L  VE++I  LQ  YD  V EK++L   +ALT ARL RAGKLT AL DE+ RW ES+ KF EE+ N+ G+VF+ AACVAYYGAFT+ YR  L+  WI  C+ LEIP+    +L+ +LGD +E+RQWN++GLPRD +STEN ILVT+GRRWPLMIDPQ+QANRWIRNKE+ + LKIIKL++ NFLR LEN IRLG+P LLE++ ETLDPALEPILLKQ F+  GR LI LGDSDI+Y K+F+ Y+TTK+ NPHY+PE+CIKVTIINFTVT  GLEDQLL +V RLE+P LEEQR  LI+RIN DKNQL+  E +IL++LF SEGNILD+E+LI+TL +SK+TS     R+ EAE TEQ I VAR KY PVA +GSVMYFV+A+++EIDPMYQ+SLKYFK LFN TIE S K+++L++R+ +LL +T +  Y NV+RGLFE+ KL++SFMLC+++MRQ G +SD EW FFLRG  G+EK+RP KP  PW+    W    D+ +  PVF  L  +I    I + +G     +N ++ + Y       S+   +   +  E   +    +   L+SF KLIL+K   EEK+V  +T+FV  NLG +F+E PP DLP L+QDMS  +PLVF+LSTGSDPM  FQRFA+E     +  S   G   G    K   D     NW
Sbjct:  188 QIIKIIRENEHLGFLYMIPAVPRSSIEYDTYNLKVVSYENINKNDYYTISQRAVTHIY-NEDIEFIEIDRWEQEYLYHRELTKIPIFSLFRKWKAFSVWRKNVRSKKITGCQKSLQKNLFIVNPHLRPALLKINELCYHLSFMGLCYIEKCHTYTLQEFKAAQVIRLAEVTERLGEFRNEAKYVVRRACRFALRAAGFVPDDCAFG----PFEDYHKVQSSGSFINTPHELPTYGDS-EKMTYTEQASKRHYCMRLTCFIRLNDYLIENTMHILTVNAVNSLLNHLTDKLKRTPSAD-------VIQKWITEE------KPEV-----PDKKGTLMVEKQEEDESLI---PMFLTELMLTVQSLLFEPSLEDFLDGILGAVNHCQNTVLSVPNLVPDSYFDAFTSPYINNKLEGKTCGTGPSLAAVFEDDKNFHTIISQIKETIQAAFESARIYAATFEKFQIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGLLLIDTRLLREKLIPSPLRCLEVLNFMLPRQSKKKVDAIIFEAQDAEYKLEFVPTTTTEYVHSLLFLDEIQERIESLEDEGNIVTQMYKLMEQYQVPTPPEDFAVFATMKPSIVAVRNAIDKSVGDRESSIKQFCVHLGSDLEELNNEVNEVKLQAQDPQILDISADQDKIRLILNNLQSVLADLQKRAFQYKSYQKNFKVEVSKFEALEEVSAELKLKQLLWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLPPNSVVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEP------EKVYTNDILAMLSPEGERVSLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLETEHSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLNEDVVLIRALQDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETLGNLQKLGI--ENSFYQAVKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKGISKKLTEETQEYILNLFQRYVDEGLHFINKKCSQAIPQVDISKVTTLCCLLESLILGKDGVNLAMEQTKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTFKYNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGVGKSVIAKGLLNKIQESAGYVPVYLNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLSDFPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEIQIFRLFCHECQRVFHDRLINNEDKHYFHVILTEMANKHFGIAIDLEYFLNKPIIFGDFIKFGADKADRIYDDMPDIEKTANVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEQVLAATRPRAKEVGISEGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFSQVDAGNEELKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLSALEPVLLAKSEDVEALMEKLAVDQESADQVRNTVQEDEATAKVKAEETQAIADDAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPSAKQLLGDSNFLKRLLEYDKENIKPQILAKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKTENLQQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAPWLPTATWFACCDLEESFPVFHGLTQNILSHPISIRLGSFETYINPQKWEGY-------SKMKHEDKHMRQEKEAAHQDPWSAGLSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTGSDPMGAFQRFARESGYSERVQSISLGQGQGPIAEKMVKDAMKSGNW 3595          

HSP 2 Score: 791.186 bits (2042), Expect = 0.000e+0
Identity = 366/603 (60.70%), Postives = 463/603 (76.78%), Query Frame = -3
Query:   63 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSK 1871
            F+   ++  Y ERVQ+ISLGQGQGP+AEKM+  A K G+WVFLQNCHLA SWM+ +EE++K  ++    + + FRLFLSSMP+ TFP++VLQNSVKVTNEPPKGLRANI+RAF EM+P FFE ++LG  WR++IFGICFFH+II +RKKFGPLGWNI YEF+DSDRECA+LNL ++C +G I WDAL YIT EITYGGRVTD WDQRCLR IL  FF P+T+ EDYKYS+SGIY+ P  +++ E+KD++++LPL+++PEIFGMHENANL FQ +ET  LINTIL+VQPR + GG G++ D+IV EL   +  ++ +K+  E A   LF  D +GRLNSLTTVL QEVDRFN LL +I  SL  L KAI GFVVMSEE+E VY +F NNQVP LWSN AYPSLKPL +WVKDL +R S    W+ +G PKS+W+ GFFFPQGFLTGTLQN+ARKY+ PID LSF++ V   YR+Q  V++  K ++FG+ +  D  L SP DGVLVHG++MD  RWDD+   I  ++ G+M  VLP++H  P+ +Y+P  T Y  PLYKT  RAG LSTTG STNFVV V LP+ +  ++WI  G+AL+C+ S+
Sbjct: 3556 FQRFARESGYSERVQSISLGQGQGPIAEKMVKDAMKSGNWVFLQNCHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMPSNTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGKKWRQIIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLKLYCKEGKIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPETLEEDYKYSESGIYFAPMADSLQEFKDYIENLPLIDDPEIFGMHENANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLGQEVDRFNNLLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVPALWSNTAYPSLKPLGSWVKDLILRTSFVDLWLKRGQPKSYWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYSVIPTYRDQAAVIEAAKTVQFGQELPMDMELPSPEDGVLVHGMFMDASRWDDKEMVIEDALPGQMNPVLPVVHFEPQQNYKPSPTLYHCPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRSKDYWIAKGSALLCQLSE 4158          
BLAST of SMED30008756 vs. UniProt
Match: sp|Q9P2D7|DYH1_HUMAN (Dynein heavy chain 1, axonemal OS=Homo sapiens OX=9606 GN=DNAH1 PE=1 SV=5)

HSP 1 Score: 2124.36 bits (5503), Expect = 0.000e+0
Identity = 1177/2808 (41.92%), Postives = 1715/2808 (61.08%), Query Frame = -2
Query: 1801 MNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEK---GLPPNQVVPV-LKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLN-----AAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPN---LNVDAQKLNPTIAIA---FVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNG-DCRMPSQG--------DLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFF--------EMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSV-VARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLN-WITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFF------ADFPQQVRGC------TENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKL----PIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAK---SSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD--------------WASAKSVLGDP-YFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 10020
            + + Q  A  Y + ++ F +     + L  +  E +    LW +  +W      W+ +    ++ E L     +  K + +  K    +P  Q V + ++ ++E+ +  + +I  L NP ++ RHW+ + + IN      +  LT  + +E+N+ D+ E + +++  A  E ++E  L K+E+ W    + VLP+K + D +IL   DE  QL DD  +    ++ S +  P + R++ W   L L  + +EEWLNCQR+WLYLE IFS+ DI +QLP E+K + ++++ +K+IM+   +    +   +   +LD+ ++ N++LD +QK L  YLE+KR  FPRFYFLS+DELLEIL+QT++P AVQPHLRKCF+ I++L F                    QE     +I  M S EGE+V L   +    NVE+WL +VE +M  ++  ++ ++I  + T+ R +W+     Q+ +   Q  W  E+   LE      L+  + F   C Q L+ L  LVRG L ++ RA L ALI + VHA+D+V+++++E V  +N F+W  QLRYYW  T ++  +R  N+ + YGYEYLG S RLVITPLTDRCYL L GAL L  GGAPAGPAGTGKTETTKDL K+LA Q VVFNCSD LD+  MG+FF GLA +GAW CFDEFNRIDIEVLSV+AQQ+ TI+ A+  ++ RFMFEG EI LV +CA FITMNPGYAGRTELPDNLKALFRP+AMMVPDY +I E+ LYS GF  +  LA+K+T  +KL SEQLS QDHYDFGMRA+K+V+  AG LKRENP   E+++ +RA+RD N+PKFL++D +LF  I+ DLFP ++  + DYG     I     NS L+     + K IQ YET  VRHG+MLVGPTG GK+T Y VLA  +++L      + G+      Y+ V  Y+LNPKSITMG+LYGE + LT EW DG+    +R   + +  + +W + DGPVDA+WIENMNTVLDDNK LCL++ E IKLT  + M+FEVQDL+VASPATVSRCGMVY++P  LG MPF++ WL  +   LK    ++   +F  ++++ + F ++   + +A  +     ++ +LL+     P  P      + ++KL+  + +    F+F  +W +G     S   SF +++R K E+       P +G        D   S  +    + + ++++  V   +   PF          +IVPT+DT++  +LL+ LL  K+ VL  G TG GK++ ++   L N++ +  Y+  F+ FSA+TS+N+TQ+ I++KL+K+RK V G P  +  I FIDDLNMP L+TYG+QPPIELLRQ+ D GG+YDR  +  +  + D+    A GPPGGGRN V+ RL+RHF   S     E+S ++IF++IL  +         + ++V G       TE +V A + +Y  + + LLPTPAKSHY FNLRDLSK  QG+L  DP+ V D+  + +L+ HE  RVF DRL+N ED+ +F Q++     ++        +F K+    PI++GDFM PG +   + YE +T  +K+  ++  Y++D+N  ++ ++KLV FMDA+ HI RI+R +RQ  GNALL+GVGG+G+ SLTRLA+ M  Y CFQIEL + Y  + +  D+KK+    G+ N    FLF+DTQI  E FLEDINN+LNSG++P+L+  DE ++++   R   +E G+ +  +  +      RVR+N+H+VLCMSP+G  FR+R R FPSLVNCCTIDWF  WP EAL +VA    +    ++  ++E++  L  +C  IH SV+K+   + AEL RH Y TP SYLEL+ ++  ++ +KK +L T ++R+K+GL K+L T+E +A M+ +L ++ P LE+  KDT   M+++  D   A+  R+ V+ +E  A  KAK+ QAIADDAQ+DLDEA+PAL+ A+ +L  L+KND+ E+R    PP  V+ V+E+VC++ G K                W   K +L DP +FL+ L  + KDNI + ++K ++ YID+  F    + KVSKAC S+  WVRAM  Y    K VEPK++ L  A  +L      L + +  L  VE+ IA +Q  Y   +T+K+ LE        RL RAGKL   L+DEK RW E+V      L N+ GDV + A  VAY G FT  YR  L   W+ + R   +P +   TL+G LG+  ++R W   GLP D +S EN ++    +RW   IDPQ QAN+WI+N E  N L + KLS+ +FLR++EN IR G P LLE++GE LDPALEP+LLKQT+ + G T++ LGD+ I Y +DF++YITTKL NPHY PEI  K+T+INFT++P GLEDQLLG+V   ERP+LEE +N LII     + +L+  E++IL  L  SEGN +D  +LI  L  SK+ +AE   ++  AE TE+ I + R +YIPVA R  +++F V+++A +DPMYQ+SL++F  +F + I NS+++ +L++RI  +    T + Y+NV R LFEK KL+F+F+LC++IM   G I+  EW + L   GG      E P   W+S   W +++ +S+ +P FS+  +D  +   E  +   ++  + E      PLP                      G +D  L  FQKL++++    +K+   + +FV  NL  RF+EP   +L ++F+D +  +PL+FVLS G+DP     +FA+E K   K S+   G   G
Sbjct:  986 LKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININV-RPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYK-ATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLF--------------------QE---DLEITHMYSAEGEEVQLCFSIYPSSNVEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALE---AGNLRSQL-FPQLC-QQLSDLVALVRGKLSRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYW--TNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPSMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGM------YEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLRKLPPLLK-PYEEHFKALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFF-KPFLPREGLKKIPSEKLSRIVELIEPWFIFSLIWSVGATGDSSGRTSFSHWLRLKMENEQLTLLFPEEGLVFDYRLEDAGISGTNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIGPTGTGKTLTISDKLLKNLALD--YISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNWLDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEEDRSWFDQLLKRCMEQW------EVTFNKVCPFQPILYGDFMSPGSDV--KSYELITSESKMMQVIEEYIEDYNQINTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVSTMRPYIQEQGL-QPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPELESSQEEIQ-GLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAIQPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVPHTSEPTLIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLS--GGSISIMTENPAPDWLSDRAWRDILALSN-LPTFSSFSSDFVKHLSEFRVIFDSLEPHRE------PLP----------------------GIWDQYLDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKLSAISLGQGQG 3710          

HSP 2 Score: 493.426 bits (1269), Expect = 5.539e-138
Identity = 262/599 (43.74%), Postives = 369/599 (61.60%), Query Frame = -3
Query:   75 YMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYY--PPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIA-AGGTGRTTDDIVYELADQILEKLIDKINPE---EAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPD-GVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK-YISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALIC 1844
            + +++ AISLGQGQGP AE MM ++ + G WVF QNCHLA SWM  LE +++    NP +VH +FRL+L+S+P+  FP+S+LQN  K+T EPP+G+RAN+ ++++ +   F  +    + ++ L+  +C FH   L+R KFGPLG+NI YEF+D D    I  L MF  +   I +  L Y   EI YGGRVTD WD+RC+ NIL  F++P  +  ++ YS SGIY+  PP ++ ++ Y  ++ SLPL + PEIFG+H+NAN++F   ET  L+ TI+ +QP+ + AG  GR  ++IV ++   IL K+ + IN +      P L+         S+ TVL+QEV R+N+LL VI  +L  L KA+KG VVMS +LE +  +  NN VP LWS  AYPSLKPLS+WV DL  R      W+  G P  FW+ GFFFPQ FLTGTLQN+ARK+   ID +SF+F V                     + EA   L+  P  G  +HGL+++G RWD E  Q+  S   E+   + ++ ++P  + + +    Y+ P+YKT  RAG LSTTG STN+V+AV +PT Q    WI  G ALIC
Sbjct: 3696 FSKKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEHI--NPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVRANLLKSYSSLGEDFLNSCHKVMEFKSLLLSLCLFHGNALERHKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYNPDVLSPEHSYSASGIYHQIPPTYD-LHGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPKSSSAGSQGR--EEIVEDVTQNILLKVPEPINLQWVMAKYPVLYE-------ESMNTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFVISIDTISFDFKV---------------------MFEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWLLPTPNRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALIC 4261          
BLAST of SMED30008756 vs. UniProt
Match: sp|P0C6F1|DYH2_MOUSE (Dynein heavy chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1)

HSP 1 Score: 2114.73 bits (5478), Expect = 0.000e+0
Identity = 1133/2731 (41.49%), Postives = 1686/2731 (61.74%), Query Frame = -2
Query: 1813 FKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLW----EKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDE-LKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSG-WIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKK-RPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFG 9969
            FK+EQ   +DL+ +  EL   Q +W+   +W+  +N+W    F  L  E + +      + + +L K       +++   + K+EQ +  M +I++L NP L+ERHW Q+++ +  +F +  E  TL ++++L +  + E++ EIS  A+ E ++E  L+ + + W  T+  ++P+KD K    L GT+E+ Q  +D+ + ++T+ +SR V   +  VD W + L L  + IE  L  QR W+YLE+IF   DI++QLP+E+  F  V+ ++K IM ++ K   A+R+T  PGLL+T    N +L+ IQK L+ YLE+KR IFPRFYFLSND+LLEIL Q+RNP AVQPHL+KCFD I  L        K++   G          K+  + + M S +GE +     +   G VE WLG VE AM + LR LLR           +R++W+K  A Q+V+T  Q+ W  ++T  L    E   + ++   +     LNK +  +RG L K+ R  + AL+T+ +HARD++ ++ K  + D++ F+W  QLR+YW+  +D+C++R +N+ + YGYEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR +SGLAQSGAW CFDEFNRI+IEVLSV+AQQ+++I +A  A ++RF FEG EI LV +C  FITMNPGYAGRTELP+NLK++FRPIAM+VPD  LIAE+IL+ EGF + K LA+K+  +Y L  +QLS+QDHYDFG+RAL S+L  AG+ +R  PD  ++ VL+ ++RD N+ K    D  LF AI+QDLFP +ELP  DYG+ +  IE  I   GLQI P  + KV+Q YET   RH  M+VG TG  KTT + +L   L++L  AG     P+Y  V+ + LNPK++++GELYGE +  T EW DG++  ++R+ C D   D +W++ DGPVD LWIE+MN+V+DDNK+L L N ERI +   V +LFEV++L+VASPATVSRCGMVY D  +LGW P+V++WL     + K EV + L  MFEK+I+  L F +  C + +     + I ++C+L  ++L  P       DA+  +  + + FVF  +W +  ++ E      D+++R   E  G    P++  ++  Y +    KM  W    EK+   +++    PF++++VPTVDT+R+ YL+  L+  +  VL  G  G GK+ +A+  L ++  +   V V +N SAQT+SN  Q +IE+++EK+ K V      K +I F+DDLNMP  D +GSQPP+EL+R + D+G +YDR K +   I+DM L AA GPPGGGR  +S RL   F + ++  P+E  + +IF +++     DF ++V+     +  A +++YN +    LPTPAK HY+FNLRD+SK  QG+L+ +      K+ + +L+ HE  RVF DRL++  D   F  I+++    +F          K P IFGDF+K       ++YE L D   +K  + + L+++N++ S   M+LV F +AI+HI RI R+I Q RGN LLVG+GG+G+QSL RLA+ +  YN FQIE+ + Y    F  D+K++Y   G+  Q T FLF DTQI  E FLEDINNIL+SGEVP+L++ DE+E +       A+   + E + D +F + I RVRNNLHIVLC+SPVG  FR+  R +P+LVNC TI+WF+ WP EALL VA+     VD+G  E +  K+A +   +H SVA+ S++   EL+R+ Y TPT+YLEL++ Y  +L EK+++L+ + ++++ GL KI ET E +  M +EL   + ++ + QK  E  +  +   + +AD  +  V  +     ++  + QA+AD+AQ+DL+EA+PALE A++AL++L+K DI EI+ +  PP  V+ VM++V +L G +  WA AK  LG+  F+K L ++ KDNI + +LKK+  Y   P+F  + + +VS A +SL +WVRAM++Y +  + VEPK+ R+  A  +L E    L + Q +L  V  K+  L+K YD  + +K+ L         +L+RAG L + LA EK RW E+V    E+LG +VGD  + AA ++Y G F ++YR E+++  WI + REL++P S    +   L +  ++R WN +GLP D  STEN I+VTRG RW LMIDPQ QA +WI+N E    LKII L   ++LR LE+ I+ G P LL+++ E LDP L P+L K      GR LI +GD ++EY+ +F+ Y+TTKLSNPHY PE   K TI+NF V  QGLE QLLG V R ERPELEEQ+++L+I I   K +L+  E+ IL+LL E+ G++LD   L+NTL  SK+T+ E T+++  +E TE  I +AR  Y P A R SV++FV+ +M  IDPMYQFSL  +  LF  +I+ S +S  LE+RI+ L    T A Y    R LFE+ KL+FSF +C +I+  +G ++  E+ FFLRG   ++++ + + P   W++   W+N+ ++ D +  F  L+N   Q                            P +  +  +    E A  L G ++      Q++++V++  ++++  C+T F+  NLG+RF+EPP  ++  + +D +  SPLVF+LS G DP +   + A+   +  +  +   G
Sbjct: 1245 FKIEQPVSKDLQILEKELDALQQVWEITRDWEESWNQWKMGCFQTLQTEAMESMAHGLFRRLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKD-KGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLL--------KIQKVGG-------SSSKW--EAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVSI-----LNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAG----EPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEK---RPKTEV-EPLQRMFEKFINKILSFKKDNCNELVPVPEYSGIISLCKLY-TVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLR---EIEGS--FPNKDTVYEYYVN---PKMRTWTSFEEKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLV-VNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFLK-----EPKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESS-DSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITEL-DKLTNFHGLMNSFEQ---------------------------YPRDWHLWYTNSSPEKAM-LPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLG 3899          

HSP 2 Score: 391.734 bits (1005), Expect = 4.174e-107
Identity = 229/604 (37.91%), Postives = 339/604 (56.13%), Query Frame = -3
Query:   78 LPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKK-RSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVED-YKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGT-GRTTDDIVYELADQILEKLIDKINPEEAKPDL-FHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKS-FWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK--YISPLYKTEERAGVLSTTGMSTNFVVAVPLPT-DQESNFWINMGAALI 1862
            L +      R  A+SLGQGQ P+A +++      G WVFL NCHL+ SWM  L+++V++ + E+P   H +FRL+LSS P   FPIS+LQ S+K+T EPPKGL+AN+ R +  M+   F        ++KL+F +CFFHSI+L+RKKF  LGWNI Y F+DSD E +   L ++  +     WDAL Y+ A + YGG VTD WD+R L   +  +F   ++    Y+ S    YY P+  ++  YK+++  LP ++ PE FG H NA+++ QI E + L  T+L +QP+I      G++ ++ V ELA  + +K+ + I+ E  +  L   P      + L  VL+QE+ R+NKL+  I  SL  L+K I+G +VMS  LE ++    +  VP LW  V YPS KPL++W +DLA+R      W  +  P   FWL GF FP GFLT  LQ+ AR+ +  +D LS+EFIV                      ++    +  P DGV V GLY++G  WD +N  ++ +   +++ ++P +H  P  +   +S K  Y  P Y    RAG  ST   S  FV+ + L +    S+ WI  G AL+
Sbjct: 3883 LAEHTGMAHRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDP---HPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLLALDP------SPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKV-YPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIV--------------------STVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPA-ESRKKSAKGMYSCPCYYYPNRAG--STDRAS--FVIGIDLRSGSMTSDHWIKRGTALL 4451          
BLAST of SMED30008756 vs. UniProt
Match: sp|Q9P225|DYH2_HUMAN (Dynein heavy chain 2, axonemal OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3)

HSP 1 Score: 2112.04 bits (5471), Expect = 0.000e+0
Identity = 1130/2732 (41.36%), Postives = 1676/2732 (61.35%), Query Frame = -2
Query: 1813 FKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTL--EREEWLKAHANQIVLTVEQMMWCREITAIL----EDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVP-VFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDE-LKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSG-WIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKK-RPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFG 9969
            FK+EQ   +DL+ +  EL   Q +W+   +W+  +NEW    F+ L  E + T      + + +L K       +++   + K+EQ +  M +I++L NP L+ERHW Q+ D I  +F +  E  TL +++EL +  + E++ EIS  A+ E ++E  L+ + + W +T+  ++P+KD K    L GT+E+ Q  +D+ + ++T+ +SR V   +  VD W + L L  + IE  L  QR W+YLE+IF   DI++QLP+E+  F  V+ ++K IM ++ K   A+R+T  PGLLDT    N +L+ IQK L+ YLE+KR IFPRFYFLSND+LLEIL Q+RNP AVQPHL+KCFD I  L       P  +                  + + M S +GE +     +   G VE WLG VE+ M + LR LLR           +R++W+K  A Q+V+T  Q+ W  ++T  L    E   ++ L+ M   +V     LNK +  +RG L K+ R  + AL+T+ +HARD++ ++ K  + D+N F+W  QLR+YW+  LD+CV+R +N+ + Y YEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLDYK MGR +SGLAQ+GAW CFDEFNRI+IEVLSV+A Q++ I +A AA ++ F F+G EI LV +C  FITMNPGYAGRTELP+NLK++FRPIAM+VPD  LIAE+IL+ EGF + K LA+K+  +Y L  +QLS+QDHYDFG+RAL S+L  AG+ +R  PD  ++ VL+ ++RD N+ K    DA LF AI+QDLFP +ELP  DYG+ +  +E  I + GLQ  P  + KV Q YET   RH  M+VG TG GKT  + +L   LS+L  AG     P++  V+ + LNPK++++GELYGE +  T EW DG++  ++R  C D   D +W++ DGPVD LWIENMN+V+DDNK+L L N ERI +   V +LFEV+DL++ASPATVSRCGMVY D  +LGW P+V++WL     + K EV + L  MFEK I+  L F +  C + +     + I ++C+L  +L       N   D +     + + FVF  +W +  ++ E      D+++R   E  G    P++  ++  + D   R    +E  +P  +++    PF++++VPTVDT+R+ YL+  L+  +  +L  G  G GK+ +A+  L ++  +   V V +N SAQT+SN  Q +IE+++EK+ K V      K +I F+DDLNMP  D +GSQPP+EL+R + D+G +YDR K     I++M L AA GPPGGGR  +S RL   F + ++  P++  + +IF +++     DF ++V+     +  A +++YN +    LPTP K HY+FNLRD+SK  QG+L+ +      KS + +L+ HE  RVF DRL++  D   F  I+++    +F          K P IFGDF+K       ++YE LTD   +K ++ + L+++N++ S   M+LV F +AI+HI RI R+I Q RGN LLVG+GG+G+QSL RLA+ +  Y  FQIE+ + Y    F  D+K++Y   G+  + T F+F DTQI  E FLEDINNIL+SGEVP+L++PDE+E +       A+   V E + D +F + I RV+NNLHIVLC+SP+G  FR+  R +P+LVNC TI+WF+ WP+EALL VA+     VD+G  E +  K+A +   +H SVA+ S++   EL+RH Y TPT YLEL++ Y  +L EK+++L+ + ++++ GL KI ET E +  M +EL   + ++ + QK  E  +  +   + +AD  +  V  +     V+  + QA+AD+AQ+DL+EA+PALE A++AL++L+K DI EI+ +  PP  V+ VM++V +L G +  WA AK  LG+  F+K L ++ KDNI + +LKK+  Y   P+F  + + +VS A +SL +WVRAM++Y +  + VEPK+ R+  A  +L E    L + Q +L  V  K+  L+K YD  + +K+ L         +L+RAG L + LA EK RW E+V    E+LG +VGD  + AA ++Y G F ++YR E+++  WIG+  EL++P S    +   L +  ++R WN +GLP D  STEN I+VTRG RW LMIDPQ QA +WI+N E    LKII L   ++LR LE+ I  G P LL+++ E LDP L P+L K      GR L+ +GD ++EY+ +F+ YITTKLSNPHY PE   K TI+NF V  QGLE QLLG V R ERPELEEQ+++L+I I   K +L+  E+ IL+LL E+ G++LD   L+NTL+ SK+T+ E T+++  +E TE    +AR  Y P A R S+++FV+ +M  IDPMYQFSL  + +LF  +I+ S +S  LE+RI  L    T A Y    R LFE+ KL+FSF +C +I+  +G ++  E+ FFLRG   ++++ + + P   W++   W+N+ ++ D +  F  L+N   Q                            P +  +  +    E A  L G ++      Q++++V++  ++++  C+T F+  NLG+RF+EPP  ++  + +D +  SPLVF+LS G DP +   + A+   +  +  +   G
Sbjct: 1210 FKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGLFRRLTKLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMDQHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKD-KGHHRLRGTEEVFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKW-----------------EAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVKEWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSI---LNKYSEAIRGNLTKIMRLKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLTDEEVLLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAG----DPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEK---RPKAEV-EPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITSLCKLYSALATPENGVN-PADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLR---EIEGS--FPNKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNAPFYKIMVPTVDTVRYNYLVSSLVANQNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLV-VNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFLK-----EPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESS-DSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITEL-DKLTNFHGLMNSFEQ---------------------------YPRDWHLWYTNAAPEKAM-LPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMAQRFHALSLG 3870          

HSP 2 Score: 392.889 bits (1008), Expect = 1.492e-107
Identity = 225/596 (37.75%), Postives = 338/596 (56.71%), Query Frame = -3
Query:   78 ERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKK-RSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDY-KYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIA-AGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDL-FHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKS-FWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK--YISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQES-NFWINMGAALI 1838
            +R  A+SLGQGQ P+A +++      G WVFL NCHL+ SWM  L+++V++ + E+P   H +FRL+LSS+P   FPIS+LQ S+K+T EPPKGL+AN+ R +  MS   F        ++KL+F +CFFHS++L+RKKF  LGWNI Y F+DSD E +   L ++  +     WDAL Y+ A I YGG VTD WD+R L   +  +F  +++   + + S    Y+ P+  ++  YK+++  LP ++ PE FG H NA+++ QI E Q L +T+L +QP+I      G+T ++ V ELA  + +K+ + I+ E  +  L   P      + L  VL+QE+ R+N L+  I  SL  L+K I+G +VMS  LE ++    +  VP LW   AYPS KPL+ W +DLAMR      W  +  P   FWL GF FP GFLT  LQ+ AR+ +  +D LS+EFIV                      ++    +  P DGV V GLY++G  WD +N  ++ +   +++ ++P +H  P  +   +S K  Y  P Y    RAG    +    +FV+ + L +   + + WI  G AL+
Sbjct: 3862 QRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDP---HPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEETPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPTRAGGQTREEKVLELAADVKQKIPEMIDYEGTQKLLALDP------SPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGK-AYPSQKPLAAWTRDLAMRVEQFELWASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIV--------------------STVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPA-ESRKKSAKGMYSCPCYYYPNRAG----SSDRASFVIGIDLRSGAMTPDHWIKRGTALL 4422          
BLAST of SMED30008756 vs. UniProt
Match: sp|E9Q8T7|DYH1_MOUSE (Dynein heavy chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1)

HSP 1 Score: 2098.55 bits (5436), Expect = 0.000e+0
Identity = 1244/3155 (39.43%), Postives = 1823/3155 (57.78%), Query Frame = -2
Query: 1801 PLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMC-KLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIAR---KEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEK---GLPPNQVVPV-LKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNK----LAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPD-----YQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPN---LNVDAQKLNPT---IAIAFVFCYLWGIGGNLHESNWDSFDNFVRNK---------FEDNG---DCRMPSQG--DLWSSYADLHSRKMDLWEKIVPV---FKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLN-WITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILT----GFFAD--FPQQVRGC------TENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKL----PIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGE--DELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD--------------WASAKSVLGDP-YFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 11043
            PLFI + VL    + +    E F+     ++  F   +L+  + VP        K V+ + F        P + ++   +  +  L    ++A+  A      YA  + +  +    + ST L   +T     E  RE    + +E  +    +     IG   ++   +KQ  L   ++ L     ML ++A+   KEVD++ +E +     +  +P +  +     +++  I  ++  LE     +   Y+++D F      +DF           +    ID        + +KF      D    + +++ ++  +    I    A  HE+  E+ ++K  + + Q  A  Y + ++ F +     + L  +  E +    LW +  +W      W+ +    ++ E L     +  K + +  K    +P  Q V + ++ ++E+ +  + +I  L NP ++ RHW+ + + IN      +  LT  + +E+N+ D+ E + +++  A  E ++E  L K+E+ W    + VLP+K++ D +IL   DE  QL DD  +   +++ S +  P + R++ W   L L  + +EEWLNCQR WLYLE IFS+ DI RQLP E+K + ++++ +++IM+   +    +   +   LLD+ ++ N+LLD +QK L  YLE+KR  FPRFYFLS+DELLEIL+QT++P AVQPHLRKCF+ I++L F                    QE     +I  M S EGE+V L   +    NVE+WL +VE +M  ++  ++  +I  + T+ R EW+     Q+ +   Q  W  E+   LE        G I    K F  L+K    L  LVRG L ++ R  L ALI + VHA+D+V++++ E V  ++ FEW  QLRYYW  T D+  +R  N+ + YGYEYLG S RLVITPLTDRCYL L GAL L  GGAPAGPAGTGKTETTKDL K+LA Q VVFNCSD LD+  MG+FF GLA +GAW CFDEFNRIDIEVLSV+AQQ+ TI+ A+  ++ RFMFEG EI LV +CA FITMNPGYAGRTELPDNLKALFRP+AMMVPDY +IAE+ LYS GF  +  LA+K+T  +KL SEQLS QDHYDFGMRA+K+V+  AG LKRENP   E+++ +RA+RD N+PKFL++D +LF  I+ DLFP ++  E DYG     I    E + L+     ++K IQ YET  VRHG+MLVGPTG GK+  Y VLA  ++      L + +P      Y+ V  Y+LNPKSITMG+LYGE + LT EW DG+   ++R   + +  + +W + DGPVDA+WIENMNTVLDDNK LCL++ E IKLT  + M+FEVQDL+VASPATVSRCGMVY++P  LG MPFV+ WL  +   +K    +    +F KY+++ + F +    + +A  +     ++ +LL+     P  P      + ++KL+     I   F+F  +W +G     ++  SF  ++R K         F ++G   D R+   G         +    K   W K +     F    +  +  +IVPT+DT++  YLL  LL   + VL  G TG GK++     L        Y+  F+ FSA+TS+N+TQ++I++KL+K+RK V G P  +  I FIDDLNMP L+TYG+QPPIELLRQ+ D GG+YDR  +  +  + D+    A GPPGGGRN ++ RL RHF   S     E+S ++IF+ IL     G   +  + + V G       TE +V A + +Y  + + LLPTPAKSHY FNLRDLSK  QG+L  +PS V DK  + +L+ HE  RVF DRL+N ED+ +F +++ E   + FG      +F K+    PI++GDFM PG +   + YE +T  +K+  ++  Y++D+N  ++ +++LV F+DA+ HI RI+R +RQ  GNALL+GVGG+G+ SLTRLA+ M  Y CFQIEL + Y  + +  D+KK+    G+ N    FLF+DTQI  E FLEDINN+LNSG++P+++  DE +++I   R   +E G+ +  +  +      RVR+N+H+VLCMSP+G  FR+R R FPSLVNCCTIDWF  WP EAL +VA +    +   E  +E+   L  +C  IH SVA +   + AEL RH Y TP SYLEL+ ++  ++ +KK +L T ++R+K+GL K+L T+E +A M+ EL  +RP LE+  KDT   M+++  D   A+  R  V+ +E  A  KA + QAIADDAQ+DLDEA+PAL+ A+ +L  L+KND+ E+R    PP  V+ V+E+VC++ G K                W   K +L DP  FL+ L  + KDNI EA++K ++ YID+  F    + KVSKAC S+  WVRAM  Y    K VEPK++ L  A  +L+     L + +  L  VE+ IA +Q  Y   V +K+ LE        RL RA KL   LADEK RW E+V      L N+ GDV + A  VAY G FT  YR  L   W+ +     +P +   TL+  LG+  ++R W   GLP D +S EN ++    +RW   IDPQ QAN+WI+N E  + L + KLS+ +FLR++EN IR G P LLE++GE LDPALEP+LLKQT+ + G  ++ LGD+ I Y +DF++YITTKL NPHY PEI  K+T+INFT++P GLEDQLLG+V   ERP+LEE +N LI+     + +L+  E++IL  L  SEGN +D  +LI  L  SK+ +AE   ++  AE TE+ I + R +YIPVA R  +++F V+++A +DPMYQ+SL++F  +F + I NS+++ +L++RI  +    T + Y+NV R LFEK KL+F+F+LC++IM   G I+  EW + L G G I+    E P   W+S   W +++ +S+ +P F+   ND            + +S  +   DS  P                    + L G ++  L  FQKL++++    +K+   + +FV  +L  RF+EP   +L  +F++ +  +PL+FVLS G+DP     +FA+E K   K S+   G   G
Sbjct:  642 PLFIVDLVLDNSGVHYSTPLEHFE---MILLNLFDKGILAT-HAVP-----QLEKLVMEDIF----ISGDPLLESVGLHEPLVEELRANITNAMHKAMMPLQAYAKEYRKYLELNNNDISTFLKTYQTQCPSAEEVREVVITHLKEKEILDNSLPSSIIIGPFYINVDNVKQ-SLSKKRKAL--ATSMLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELRDWMKGIPEKLVFLEERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANNWPSKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSIHVEIARAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQEVALDIRTRIEEFKPYIPLIQGLRNPGMRNRHWEVLSNEININV-RPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSSILFNVLPYKET-DTYILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEQRINSWETKLKLTQEVLEEWLNCQRAWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLF--------------------QE---DLEITHMYSAEGEEVKLSFSIYPSSNVEDWLLEVERSMKASVHDIIEMAIKAYPTMLRTEWVLNWPGQVTIAGCQTYWTMEVAEALE-------AGNIS--SKLFPQLSKQLSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYW--TKDDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRVLAAAMT------LLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLKRLPAIIK-PYEEQFKSLFTKYLENSINFVRNTVKEVIASTNSNLTMSLLKLLDCFF-RPFLPREGLKKIPSEKLSHIPELIEPWFIFSLVWSVGATGDHTSRISFSQWLRLKMRLEQVKLGFPEDGLVYDYRLDDAGISSTEDDDEEEDENKQVSWVKWMDYSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTNHKPVLCIGPTGTGKTLTVSNKLLKYLP-LEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILECWMDGLLGEKSYREPVPGAPNIDDLTEPLVDATINVYGIITSQLLPTPAKSHYTFNLRDLSKVFQGMLMAEPSKVEDKVQLLRLWYHENCRVFRDRLVNEEDRSWFDELL-EAQMEEFGV-----AFNKVCPFQPILYGDFMSPGSDV--KSYELITSESKMMQVIEEYMEDYNQINTAKLRLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQDQIINTMRPYIQEQGL-QPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATTFLSEIPELECSEEVIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTMLTMEQIKVDTAIAEETRKSVQAEEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYEYWVNQLTVHHVPHTSKPTLITTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERESGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSG-GSIQTMF-ENPAPQWLSDRAWRDILALSN-LPTFATFSNDFV----------MYLSEFQAIFDSAEP------------------HRELLPGIWNAYLDEFQKLLILRCLRGDKVTNAMQDFVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKFSAISLGQGQG 3695          

HSP 2 Score: 498.819 bits (1283), Expect = 1.125e-139
Identity = 259/597 (43.38%), Postives = 375/597 (62.81%), Query Frame = -3
Query:   75 YMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYY--PPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAK---PDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK-YISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALIC 1844
            + ++  AISLGQGQGP AE MM  + + G WVF QNCHLA SWM  LE +++    NP +VH +FRL+L+S+P+  FP+S+LQN  K+T EPP+G++AN+ +++N +S  F  +    + ++ L+  +C FH   L+R+KFGPLG+NI YEF+D D    I  L MF  +   I +  L Y   EI YGGRVTD WD+RC+ NIL  F++P  +  ++ YS SGIY+  PP ++ +N Y  ++ SLPL + PEIFG+H+NAN++F   ET  L N IL +QP+ ++ G G++ +++V ++A+ IL ++   I  +E     P L+         S+ TVL+QEV R+NKLL VI  +L  + KAIKG VVMS ELE +  +  NN VP LW + AYPSLKPL++W+ DL +R    + W+  G P  FW+ GFFFPQ FLTGTLQN+ARK+   ID ++F+F V        E   ++KE               P  G  +HGL+++G RWD  N Q+  S   E+   + ++ ++P+ + + ++   Y+ P+YKT  RAG LSTTG STN+V+AV +P++Q    WI  G ALIC
Sbjct: 3681 FSKKFSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLAPSWMPALERLIEHI--NPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLKSYNSLSDDFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSSEHSYSNSGIYHQIPPTYD-LNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFNAILQLQPKSSSMG-GQSREELVEDVAENILLQVPGPIELQEVTKKFPVLYE-------ESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAYPSLKPLASWIMDLLLRLDFMHSWINDGIPPVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLP------EASSEIKE--------------RPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLPEANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVALIC 4246          
BLAST of SMED30008756 vs. TrEMBL
Match: gnl|BL_ORD_ID|20342220 (tr|A0A1S3JEF3|A0A1S3JEF3_LINUN dynein heavy chain 6, axonemal OS=Lingula unguis OX=7574 GN=LOC106172395 PE=4 SV=1)

HSP 1 Score: 4850.8 bits (12581), Expect = 0.000e+0
Identity = 2384/3656 (65.21%), Postives = 2874/3656 (78.61%), Query Frame = -2
Query: 1786 FFIKMNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGF-----------IKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETI-----VRKSVSEADKHVKRRKIGTLD-PIXXXXXXXXXXXXXXXXXXXXLVKPEIQDIEVVLARGHAK--NHVTQATVVKPPHIYGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQS-YDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVV------IPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQ-EVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPS--EEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 12666
            F  +MN       + +    N  ++ G +   +++     ++ F           ++FN PT AQ +K+  P    LEPL +L+ +Q  N    I  + KE +      +K   +A K  +   +  +D P      P      K K++       +I  +     +  +    HV +A+ V  P I  K             EG  +  ++I ++RE P+I FLYL+  + K   +YHY+NLKVVS+ N+ K+D+  +S+ G T +   DE +H+ LDR+E EY  + K+ KI  F +FR WKAF  WRK ++  K   C K L  +LFI+N SL PALLNVREMC+RISDMGLCKVEKG TY+L +F  AQ AQLNEVA +L EFRELV+EV+RSACRT+LLE GF PDDYF DG+++P  G+ P GT SS+ MQS YDMD+Y EAPDKMTYTEQANKR+HC+RLT FIRLADYLIVNTMHVLAVNSV T+LNY+++QL+ TP   +I   + IV E+      +     E+   V+  +++  E+ K      A        +PPLFITEF+L    L F PD + FQEGI EVIK+FQ+ VLSV NLVPDTYFD+FT+P+IN KFEEK+CGEGPS+ +MF +D HL ++I    +A+ AAFNA  +YA  F   R+FY+ NESTDL+A+R  ++DV FF E   RYH++  M + I  ++PIGM+LVDA +MK L++PSP RCLDVIN++LPV+AR EVD LI E QDA++ L   PT+T++YV++LNFL EIQ R++PLE+EA ++KEMY+LID F VPTPPEDFAVYQTL PS+   +NAIDK+LA+RD N+DKFC  LDKDIAEL +EVK+++Q   NP ILD +A++ ++   L+K+   + +LQ RAFTYKSYQKNFKVE  + + LEE AAE+KLK +LW SLDEWD     W       L+PE L    AKY K V QLEKGLPPN VVP LK++VE MR+KM +IT+L NP ++ RHW+ I +II Y F+  E+ +TLGKL+EL  F + E ++EISGQASSEASLE++LKKVE+AW+ TE+ VLPHKDSKDVFILGGTDEIQ L DDSNIN+ TIASSRHVGPIKP+VD+W+K LDLFGKT++EWLN QRNWLYLESIFSAPDIQRQLP+E+K FM VDKSYK+IMRKV KVPLAMRA T PGLL+TF+NNN LLDQIQKCLEAYLESKR IFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKL+FA+  +   +++       Q + EV++TNDILAMISPEGEKV LGKGLKARGNVE+WLGKVEEAMF NLR+L+++SI +F+   REEW+  HA+Q++LTV QMMWC +IT +L    ++RL GM +FE K F DLNKLA +VR  +PKL RATLCALIT++VHARDMVTEMVK KV  +N FEWQKQLRYYWD  +DNC VRMSNSLY YGYEYLG SPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAK+SRFMFEGREI+L+ TCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFE SK LAQKMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENPDK EDVVLIRALRDSNLPKFL  DA LF+AILQDLFPGV +PEHDYGR + EI  V+ +  LQ     V KVIQ YET+ VRHGVMLVGPTGGGKTT Y +LA VL NL+A GL ++ P +QPVK Y+LNPKSITM ELYG +NKLT+EWHDGLM   VR    DTS+DHQWV+CDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPY+HM+FEVQDL+VASPATVSRCGMVYVDP EL W+P+VKTW++S+    + E ++YL  +F KY+DDGLKF Q KC Q + QV I+K+ ++C+LLESLL   G P+L  D  KL+P IA +FVF YLW IGGN+ ++NWD+FD FVR +FED G+ ++P  GDLWSSY D  +R+MDLWE+IVP FK+NKEVPFFEM+VPTVDT+RFGYL+EK+L V  SVLFTG+TGVGKSV+ARG + NI++  GYVP+FINFSAQTSSNRTQEMIE KLEKKRK +LGAP +KRV+IF+DDLNMPKLDTYGSQPPIELLRQYQDF GFY+R+KL WI IQD+ + AAC PPGGGRNPV+ R +RHF+MF+IP P+E +L+ +F +ILTGF +DFP  V+ C E IV AAVEIYNRM TDLLPTPAKSHY+FNLRDLSKCIQGILQ D   +RD + +F+LFCHEA RVFHDRLIN+EDK +F+ I+AEMASK+FG+N++P+SF   PIIFGDF+K G EK +R+YE L++  K++++L  YLDD+NM+SSKEMKLVFF+DAI+H++RIARMIRQ+RGNALLVGVGGTGKQSLTRLA+ M GY CFQIEL RGY Y+ FH DLKK+Y+  G  NQ TVFLFTDTQIVVEEFLEDINNILNSGEVP+LFE DE ER+II CR  AKEAG+ EGNRD I+EF INRVRNNLHIVLCMSPVG++FRSRCRMFPSLVNCCTIDWF  WP EALL V+ S F +VD+G D+LK K+A MC EIHTSV++ SERFY ELKR YYTTPTSYLELI LY+SML EKKKQLVT RDRVKNGL KILETNEL+  M+VELVAL P+L++K  +T+ALM++L  DQE+AD VR  V EDEAVAKVKA+ET+AIADDAQ+DLDEA+PAL  A KALDALDKNDI+E+RVFT PP++VQTVME+VC+LLGQKTDWASAK+VLGD  FLKKL DY KDNIP+++LKKLK+YI++P F  E VEKVSKAC+SL +WV AMD+Y++  +TVEPK+++L  A  EL+ VM  LR+KQ++L AVE KIA LQK YD+S+ EK+ LE  LA T+ RLKRA KLTTAL DEK+RW  +V+ F  ++GNV+GDVF+ AACVAYYGAFTS YR EL+S WI  C+ L+IP+++ +TL  VL D FE+RQWN++GLPRDQVSTENAILVTRGRRWPLMIDPQEQANRW+RN+E  N LK++KL++G FLRTLENCIR+GMP L+ED+GETLDPALEP+LLKQTF++ GR LI LGDSDI+Y ++F+ Y+TTK+SNP Y+PE+CIKVTIINFTVT  GLEDQLLGEV  LERP+LEEQRN LI+RIN DKNQL+  E+RILKLLFESEGNILD+E+LINTLNESKVTS   T+R+AEAE TE+KIT+AR KY  VA RGSVMYFVVA+M E+DPMYQFSLKYFK LFN TI+NS+KS DL  R++ILL  TT   Y NVARGLFEKDKLVFSFMLC +IMR+ G I+  EW FFLRG  G++K+RP KP   WI    WN + D+SD +PVFS + NDI    + V +G+L +S N +   +Y PLPP P+  +E  +  + D +      GH+++RL SFQKL+ +K F EEK++L IT FV+ NLG  FVE P  DL  L+++M++V+PLVFVLSTGSDPM  F RFA+E+    K  +   G   G    K
Sbjct:    8 FSPRMNGQMNGQVNGHSGQLNGQRANGALPSVDQEKLKARLYSFAPKQAPINTRALRFNRPTNAQLRKENTPVAAKLEPLPSLQKYQMVNQPEFIHMKAKEKMEAQGFFKKEEPQAKKMKRASSVEPMDRPASASPLPELPEEFKQKQESMSAASRQISPVPPKEPKPPSPKGRHV-RASTVPGPSITAK--------GTTHLEGIKDPLQMIQLVRENPKIGFLYLSPAVPKSSVDYHYFNLKVVSHENINKDDYCTISIKGVTRMRDDDETEHVPLDRWEQEYRYFRKLIKISVFAKFRKWKAFSVWRKNVRTKKLSDCKKALNENLFIVNPSLCPALLNVREMCYRISDMGLCKVEKGHTYSLHEFREAQFAQLNEVADRLAEFRELVKEVVRSACRTALLEAGFTPDDYFYDGSESPGLGDAP-GTASSFQMQSNYDMDIYGEAPDKMTYTEQANKRSHCKRLTCFIRLADYLIVNTMHVLAVNSVSTMLNYLTEQLQNTPALAQI---QSIVDEIESKSKVKKGDEDEDDEDVKAKEKAKEEEAKAKAAAAADDEEEANKLPPLFITEFILEPNQLNFTPDEDEFQEGIAEVIKKFQDAVLSVMNLVPDTYFDAFTRPIINGKFEEKSCGEGPSLISMFEDDKHLQSIIQNIREALTAAFNAAHQYADCFEPHREFYKVNESTDLEAVRQAEHDVAFFAETLERYHKQHLMAEAIPVKRPIGMLLVDAIQMKDLLIPSPLRCLDVINDLLPVLARSEVDRLIAELQDAQFKLEMAPTSTIEYVDSLNFLDEIQERIDPLEKEAFIVKEMYELIDMFKVPTPPEDFAVYQTLNPSVTNVRNAIDKSLAERDANVDKFCTHLDKDIAELAKEVKEVKQEAQNPEILDPRADQTKINNLLKKMSVRLEDLQKRAFTYKSYQKNFKVEVTKFDALEETAAEMKLKNMLWTSLDEWDGLLKNWTEAPLDTLDPEQLTAIVAKYGKAVQQLEKGLPPNGVVPTLKERVESMRDKMPMITDLRNPSIKPRHWENIYNIIGYTFT-PEDPMTLGKLVELEAFQHTEAVQEISGQASSEASLESILKKVEDAWKSTEFPVLPHKDSKDVFILGGTDEIQVLLDDSNINIQTIASSRHVGPIKPKVDDWLKQLDLFGKTLDEWLNSQRNWLYLESIFSAPDIQRQLPAESKMFMQVDKSYKDIMRKVNKVPLAMRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRNIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLEFAVQSSGDGKNTPDKDHDGQGEAEVQFTNDILAMISPEGEKVGLGKGLKARGNVEDWLGKVEEAMFNNLRRLVKESIKDFEVRTREEWVALHASQVILTVSQMMWCTDITNVLTSD-DDRLVGMQNFEKKSFDDLNKLAAIVRQEIPKLVRATLCALITLDVHARDMVTEMVKVKVDSVNSFEWQKQLRYYWDYEIDNCAVRMSNSLYIYGYEYLGASPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVSRFMFEGREIRLIPTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFEDSKNLAQKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGALKRENPDKSEDVVLIRALRDSNLPKFLVDDAGLFQAILQDLFPGVTIPEHDYGRLQEEILSVMVSKKLQPEMCIVKKVIQLYETMIVRHGVMLVGPTGGGKTTSYEILADVLKNLHAEGLNKDNPFFQPVKTYVLNPKSITMEELYGGINKLTMEWHDGLMALTVRTGVQDTSEDHQWVVCDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYMHMVFEVQDLAVASPATVSRCGMVYVDPGELRWLPYVKTWMDSVKDHFREETVEYLMELFNKYVDDGLKFIQKKCTQAINQVEISKVTSLCKLLESLLCTRGGPDLRQDPGKLHPLIATSFVFSYLWSIGGNIIDANWDAFDTFVRTQFEDCGEAKLPQNGDLWSSYVDFETRRMDLWERIVPAFKYNKEVPFFEMLVPTVDTVRFGYLMEKMLKVNHSVLFTGSTGVGKSVIARGHMTNIADRQGYVPIFINFSAQTSSNRTQEMIEGKLEKKRKTILGAPKDKRVVIFVDDLNMPKLDTYGSQPPIELLRQYQDFHGFYEREKLYWIQIQDVIICAACAPPGGGRNPVTPRFIRHFSMFTIPTPAEHTLKHMFKAILTGFLSDFPAAVKQCAEGIVGAAVEIYNRMSTDLLPTPAKSHYIFNLRDLSKCIQGILQADVGVIRDNNQIFRLFCHEAMRVFHDRLINNEDKSYFYTIMAEMASKHFGQNVDPDSFTTHPIIFGDFIKVGAEKADRVYEELSNIDKIRSVLTDYLDDYNMSSSKEMKLVFFLDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLASHMCGYQCFQIELSRGYGYDAFHEDLKKLYDLAGSQNQDTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFESDELERLIIACRPGAKEAGIPEGNRDAIYEFAINRVRNNLHIVLCMSPVGNAFRSRCRMFPSLVNCCTIDWFIEWPREALLGVSNSFFANVDLGRDDLKQKVAEMCCEIHTSVSEMSERFYTELKRRYYTTPTSYLELINLYMSMLGEKKKQLVTARDRVKNGLIKILETNELVDKMQVELVALEPELKKKSVETDALMERLVVDQEKADAVRKVVMEDEAVAKVKAEETKAIADDAQKDLDEALPALSAATKALDALDKNDISEVRVFTKPPELVQTVMEAVCILLGQKTDWASAKAVLGDSQFLKKLVDYDKDNIPDSMLKKLKKYIENPKFNPETVEKVSKACKSLCMWVNAMDLYARVYRTVEPKRQKLAAAESELEAVMSTLREKQSKLAAVEEKIATLQKSYDDSINEKRTLEKKLAQTAGRLKRASKLTTALGDEKDRWEMNVADFEVQIGNVIGDVFVAAACVAYYGAFTSVYRQELVSSWIEHCKSLDIPITDGMTLASVLADPFEIRQWNTDGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWVRNREARNGLKVVKLTDGTFLRTLENCIRIGMPVLMEDVGETLDPALEPVLLKQTFIQGGRLLIRLGDSDIDYDRNFRFYMTTKMSNPLYLPEVCIKVTIINFTVTKSGLEDQLLGEVVSLERPDLEEQRNQLIVRINADKNQLKQIEDRILKLLFESEGNILDNEELINTLNESKVTSGVITQRLAEAEKTEEKITIAREKYRSVATRGSVMYFVVADMGEVDPMYQFSLKYFKQLFNMTIQNSEKSDDLSVRLQILLDSTTRVVYENVARGLFEKDKLVFSFMLCGEIMRERGEITPEEWNFFLRGAAGMDKQRPPKPDVDWIHQGTWNTLCDLSDTLPVFSGIHNDIMATPVFVEMGDLRVSCNPDTWPTYGPLPPEPTPLKEGEEPPKDDGK----TKGHWNMRLTSFQKLVAIKCFAEEKVMLSITNFVRQNLGQSFVESPSVDLATLYENMTRVTPLVFVLSTGSDPMGAFLRFARERGYTDKIQAISLGQGQGPVAEK 3644          

HSP 2 Score: 859.751 bits (2220), Expect = 0.000e+0
Identity = 397/600 (66.17%), Postives = 480/600 (80.00%), Query Frame = -3
Query:   72 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1871
            F    +++ Y +++QAISLGQGQGPVAEK++  + K GDWVFLQNCHLAASWM+ LE IVK + E P ++HE+FRL+LSSMP+K FP+SVLQNSVKVTNEPPKGLRANIKRAF E++PQFFE H+LGL WRK++FGICFFH+II +RKKFGPLGWNI+YEFSDSDRECA+LNL MFCADG I WD L YIT EITYGGRVTD  DQRCLR +L  FF P ++ + YKYS+SGIYY P+ + +N+Y+ +++ LPL++EPEIFGMH NAN++FQ QET  LI TILDVQPR+  G  G++ DDIVYELA+ IL K+++ I  E A+ D+F  D KGRLNSLTTVL QEVDRFNKLL VIKNSL QL KAIKGFVVMSEELE +Y AF NNQVP LW N AYPSLKPL +WVKDL +RC     W++ G PKSFWL GFFFPQGFLTGTLQN+ARKYD PIDHL+FEFI    +R+Q +V + MK LKFGE +E DK + +P DGVLVHGL+MDG RW+ E  ++ +S++G M   L ++HM P MD+ P+   YI+PLYKT  RAGVLSTTGMSTNFVV V LP+    ++WI MGAAL+C+
Sbjct: 3616 FLRFARERGYTDKIQAISLGQGQGPVAEKLIAESIKNGDWVFLQNCHLAASWMLSLENIVKGQQEAPDDIHEDFRLYLSSMPSKHFPVSVLQNSVKVTNEPPKGLRANIKRAFTEITPQFFEEHILGLEWRKIVFGICFFHAIIQERKKFGPLGWNIKYEFSDSDRECALLNLQMFCADGEIPWDTLIYITGEITYGGRVTDGIDQRCLRTVLKRFFAPVSLEKGYKYSESGIYYSPDADLLNDYRQYIEELPLIDEPEIFGMHINANIAFQRQETNSLIGTILDVQPRLGGGSGGKSNDDIVYELAESILGKIVENIEMENARQDMFDADAKGRLNSLTTVLTQEVDRFNKLLKVIKNSLRQLLKAIKGFVVMSEELEQIYNAFLNNQVPRLWENAAYPSLKPLGSWVKDLVLRCEFIQHWVIHGQPKSFWLSGFFFPQGFLTGTLQNHARKYDLPIDHLTFEFITIPFFRDQADVSEAMKTLKFGEELEMDKEIPAPEDGVLVHGLFMDGFRWNMEEMRVESSLQGVMNEPLVMLHMKPMMDFVPDPADYIAPLYKTGLRAGVLSTTGMSTNFVVFVHLPSAVPQDYWIAMGAALLCQ 4215          
BLAST of SMED30008756 vs. TrEMBL
Match: gnl|BL_ORD_ID|23500332 (tr|A0A210QMM2|A0A210QMM2_MIZYE Dynein heavy chain 6, axonemal OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT23210 PE=4 SV=1)

HSP 1 Score: 4783.01 bits (12405), Expect = 0.000e+0
Identity = 2338/3600 (64.94%), Postives = 2836/3600 (78.78%), Query Frame = -2
Query: 1786 IKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKE------TIVRKSVSEADKHVKRRKIGTLDPIXXXXXXX-----XXXXXXXXXXXXXLVKPEIQDIEVVLARGHAKN-HVTQATVVKPPHIYGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPN-YGEGPPGTGSSYMMQS-YDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVP---SEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 12534
            + F   TIAQ KK   P     EP+ +LK +Q  N    +QR+++E      T+++K    + K   RR+   LDP++             L  K +    +   P+        ++ HA+   ++Q+T  KP  +              S+EG  +  +II I++    + F+YL+  + K    YHYYNLKVV++ N+ K D+  +S  G   +   DE + ++LDR+E E+  + K+ KI TF  FR WKAF  WRK ++  +   C+K L  +LFI+N SLRPALLNVREMCHRISDMGLCKVEKG TYTL DF +AQ  QL EVA +LTEFRELV+EV+RSACRT+LLE GF PDDYF DG ++P   G+  PGT SSY+M S YDMD+Y EAPD+MTYTEQANKR+HC++LTNFIRLADYLIVNTMHVLAVNSV TLLNY+++QL  TPT  +I             + Y D ++ EE  K+     +  +D + P+       PPLFI+EFVL    LLF PD E FQEG+ +VI++FQ+ VLSVQNLVPDTYFD+FT+P+INNKFEEK+CG+GPS+  MF +D HL+ +I+   DA  AAFNA  +YA TF   R+F+ +NES DL+A++T ++DV FF EA  RY+ + RM ++I E++PIGM+LVD TKMK L++PSP RCLDV+N++LP+ A  EV+ LI E QDA++ L   PT T+++V  L FL +IQVR++P E+EA ++K+MY+LI+ +NVPTPPEDFAVYQTL PSI   +NAIDK+L +RD NIDKFC  LDKDIAEL +EVK+++Q   NP+ILDV + K +VK  L +L   M++LQ RAFTYKSYQKNFKVE  + + LEE  AELKLK++LW ++D+WD+   +W    F  L+PE + + T +Y K V QLEKGLPPN VVPVLK+KVE+MRE++ VIT+L NP L+ RHW+ IE+I+++KF+  E+ LTLGKL ++  F   E L+E+SG+ASSEASLE++LKKVE++W+ TE++VL HKDS+DVFILGGTDEIQQL DDSNIN+ATIASSRHVGPIK RVD+WVK LDLFGKT++EWL CQR WLYLESIFSAPDIQRQLP+EAK FM VDKSYK+IMRKV KVPLA+RA T PGLL+TF+NNN LLDQIQKCLEAYLESKR +FPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAI+KL+F I        SD      + QE++Y+NDILAM+SPE EKVSLG+GLKARGNVE+WLGKVEEAMF NLR+L + +I +F+   R+EW+ +HA+QIVL V Q++WCR++T ILE    +RL+GM +FE K F+DLN+LA +VR  +PKL RA LCALIT++VH RDM+TEM + KV D+N FEWQKQLRYYWD  +DNC +RMSNSLY  GYEYLG S RLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+L+KQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAK AK+SRFMFEGREIKL+ TCAAFITMNPGYAGRTELPDNLKALFRP AMMVPDYRLIAEVILYSEGFESSK LAQKMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKR+NPDK EDVVLIRALRDSNLPKFL+QDA LF+AILQDLFPGVE+PEHDYGR + EI  V+E   LQ+  +Q+ K+IQ YET+ VRHGVMLVGPTGGGKT+VY VL   L+NL+ A  A +   YQPV  Y++NPK+ITM ELYG +NKLTLEW DGLM   VR    DTS+DHQWV+CDGPVDALWIENMNTVLDDNKMLCLANSERIK TP++HMLFEVQDL+VASPATVSRCGMV++D EEL WMP+ +TW+   + K+K E  +YL  +F++YI+ GL +   KC Q + QV I+K+  +C LLESLL   G P+ ++DA KLN  +   FVFCY+W IGGNL E+NWD+FD+F R+ F+DNGD ++P+ GDLWS Y D  +R+MD WEKIVP FK++KEVPFFEM+VPTVDT+RFGYLL+KLL V+ SVLFTG TGVGKSV+ARG LNNI+E A YVP+FINFSAQTSS RTQEM+E KLEK+RK V+GAP  KRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGG YDR KLNW  IQD+TL+AAC PPGGGRNPVS R+ RHFAM  IP+PSE SL+ +F  IL GF  DFP  VR CT+ IV AAVEIY RMYTDLLPTPAKSHYVFNLRDLSKC+QGILQ D   +RD   +F+LFCHEA RVFHDRLIN+EDK FF+ I++EMA+K+FGEN+EP SF+  PI+FGD++K G E  +RLYE L +  KVKN+L  YLDDFNM SSKEMKLVFF+DAI+H++RI RMIRQ+RGNALLVGVGGTGKQSLTRLAA + GY  FQIEL RGYDYN FH DLKK+Y+  G+ NQHTVFLFTDTQIVVEEFLEDINN+LNSGEVP+LFE DEYE++IIGCRA AKEAG+ EGNRD I+EFCINRVRNNLHIVLCMSPVG++FR+RCRMFPSLVNCCTIDWFT WP EALL V+KS FE+VD+G+DELK  +A MC EIHTSV+  +ERFYA+LKR YYTTPTSYLELI LYLSML EK K L   RDRV+NGL K+LETN+L+  M+ ELVAL P+L++K  DT  LM++L  DQE AD VR  V EDEA AK KA+ETQAIADDAQRDLD+A+PALE ++KALD+LDKNDI+EIRVF+ PP++VQTVME+VC+L+G KTDWA+AKSVLGD  FLK + +Y KD+I E+ ++KLK+Y+++P F  E VEKVSKAC+S+ +WV AMD YSK  KTVEPK+++L  A  EL  VM  L++KQ +L AVE KIAELQKIYD SV+EK+ LE N+A T++RLKRA KLTTAL DE+ RW E+V +FN+++GNVVGDVF+ AACVAYYGAFT++YR EL++GW  RC+E+EIPV+  +T++ +L D FE+RQWN +GLP+DQ+STENAILVTRGRRWPLMIDPQEQANRWIRNKE  N LK IKL++ NFLRTLENCIR+GMP L ED+GETLDPALEP+LLKQTF+  GR LI LGDSDI+Y ++F+ Y+T+K++NPHY+PE+CIKVTIINFTVT QGLEDQLLG+V  LERP+LEEQRN LI++IN DKNQL+  E+RILKLLFESEGNILD+E+LINTLNESKVTS    +R+AEAE+TE+KI  AR KYIPVA RGSVMYFVVA+M E+DPMYQFSLKYFK LFN TI  S+KS DL+ R++I L ETT A Y NVAR LFEKDK+VFSFMLC++IM+Q G I+  EW FFLRG  G++++R  KP   +I +  WN   D+SD +P+F  +  D+ +  + V +GE  I  N ++  +Y P PP P    E   Q+  +D     ++ GH++LRL SFQKL+ +K F EEK +  +T+FV+ NLG +FVE PP  L  L+ DM+K +PLVFVLSTGSDPM  F RFA+EK    K  S   G   G    K
Sbjct:  100 LNFGRVTIAQMKKGKSPGATNFEPVPSLKKYQERNQPEFLQRKFREEQSARGTLIQKDEPASKKM--RRQGSVLDPLERSAESPLPELPEDLKTKQESLIKMPTPPKSPKPASPRSKAHAQGPKISQST--KPKMLE-------------SFEGLCDAQEIIDIIKADRGVGFMYLSPAVPKTSVKYHYYNLKVVNHENINKADYCTISQQGAARMRNDDETEFVTLDRWEQEFHYFQKLIKIRTFALFRKWKAFSVWRKNVRTKRLKSCTKSLNENLFIVNPSLRPALLNVREMCHRISDMGLCKVEKGNTYTLNDFKDAQFKQLEEVAGRLTEFRELVKEVVRSACRTALLEAGFTPDDYFYDGAESPGLMGDAAPGTSSSYLMPSNYDMDIYGEAPDRMTYTEQANKRSHCKQLTNFIRLADYLIVNTMHVLAVNSVSTLLNYLTEQLSATPTIAQI-------------QAYADEAK-EEADKLIEDADAEKDDDEVPQA------PPLFISEFVLEPNQLLFQPDLEDFQEGLKDVIQKFQDAVLSVQNLVPDTYFDAFTRPIINNKFEEKSCGDGPSLTTMFEDDKHLNTIIDNIKDATAAAFNAASQYADTFEPHREFFRENESMDLEAVKTQEHDVAFFTEALERYNGQHRMAQVIKEKRPIGMLLVDGTKMKNLLIPSPLRCLDVVNDLLPIKAHNEVNRLIAELQDAQFKLEFAPTTTMEFVKTLTFLDDIQVRIDPAEKEAMIVKDMYELIELYNVPTPPEDFAVYQTLSPSITNVRNAIDKSLTERDANIDKFCTHLDKDIAELAKEVKEVKQEAQNPMILDVNSEKDKVKNILSRLLTQMDDLQKRAFTYKSYQKNFKVEVTKFDALEEAHAELKLKELLWTAIDDWDNLLLDWTTVPFETLDPETMSSTTMRYAKSVMQLEKGLPPNAVVPVLKEKVEEMRERLPVITDLRNPTLKPRHWEMIENILDHKFT-PEDPLTLGKLTDIQAFKNAEALQEVSGKASSEASLESILKKVEDSWKTTEFMVLFHKDSRDVFILGGTDEIQQLLDDSNINIATIASSRHVGPIKSRVDDWVKQLDLFGKTLDEWLTCQRAWLYLESIFSAPDIQRQLPAEAKMFMQVDKSYKDIMRKVNKVPLAIRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRAVFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAIAKLEFGI-------QSD----QAEDQEIQYSNDILAMVSPESEKVSLGRGLKARGNVEDWLGKVEEAMFSNLRRLTKAAIGDFEKRPRKEWVVSHASQIVLAVSQIVWCRDVTEILESDTFDRLEGMKEFEQKNFRDLNELASVVRQEIPKLARANLCALITIDVHGRDMITEMCQNKVDDVNSFEWQKQLRYYWDLEMDNCAIRMSNSLYVCGYEYLGASARLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALSKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKIAKVSRFMFEGREIKLISTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPDYRLIAEVILYSEGFESSKNLAQKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGALKRQNPDKSEDVVLIRALRDSNLPKFLQQDALLFQAILQDLFPGVEIPEHDYGRLREEIINVVEAKNLQVVETQITKIIQLYETMVVRHGVMLVGPTGGGKTSVYKVLGDTLTNLHTAKEANDF--YQPVHTYVMNPKAITMEELYGGINKLTLEWADGLMAITVRKCVTDTSEDHQWVVCDGPVDALWIENMNTVLDDNKMLCLANSERIKFTPFIHMLFEVQDLAVASPATVSRCGMVFIDAEELKWMPYAQTWITQFSEKMKPETSEYLLELFKRYIESGLVYVHKKCTQAINQVDISKVAMLCNLLESLLFRRGGPDFSMDASKLNIIVCTTFVFCYVWSIGGNLIETNWDAFDSFCRSLFDDNGDAKLPAGGDLWSCYMDFETRRMDSWEKIVPAFKYDKEVPFFEMLVPTVDTVRFGYLLQKLLAVRFSVLFTGGTGVGKSVIARGLLNNIAEKADYVPIFINFSAQTSSKRTQEMLEGKLEKRRKNVIGAPVGKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGMYDRQKLNWKEIQDVTLAAACAPPGGGRNPVSPRMFRHFAMLCIPSPSEHSLKHMFMQILNGFLMDFPTSVRQCTDAIVSAAVEIYGRMYTDLLPTPAKSHYVFNLRDLSKCVQGILQADTGVIRDNKQMFRLFCHEAMRVFHDRLINNEDKQFFYTILSEMANKHFGENVEPASFVTNPILFGDYIKMGAEPADRLYEEL-ELQKVKNVLQDYLDDFNMQSSKEMKLVFFLDAIEHVSRITRMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKSFQIELSRGYDYNSFHEDLKKLYQLAGVKNQHTVFLFTDTQIVVEEFLEDINNVLNSGEVPNLFEADEYEQLIIGCRAGAKEAGIPEGNRDAIYEFCINRVRNNLHIVLCMSPVGNAFRTRCRMFPSLVNCCTIDWFTEWPREALLGVSKSFFENVDLGKDELKTSIAEMCVEIHTSVSTMAERFYAQLKRRYYTTPTSYLELINLYLSMLGEKAKSLRNARDRVQNGLLKLLETNDLVDNMKKELVALEPELKKKSLDTNNLMERLVVDQESADKVRKVVMEDEATAKAKAEETQAIADDAQRDLDQALPALEASVKALDSLDKNDISEIRVFSKPPELVQTVMEAVCILMGAKTDWAAAKSVLGDSNFLKNMLNYDKDSISESTIRKLKKYVENPKFVPETVEKVSKACKSMCMWVLAMDCYSKVFKTVEPKRQKLAAAESELQTVMSLLKEKQDQLAAVEAKIAELQKIYDESVSEKQKLERNIAQTASRLKRAAKLTTALGDEQVRWDETVKEFNKQIGNVVGDVFVSAACVAYYGAFTATYRQELVTGWTERCQEMEIPVTSGMTIISILADPFEIRQWNMDGLPKDQLSTENAILVTRGRRWPLMIDPQEQANRWIRNKEAKNGLKFIKLTDANFLRTLENCIRIGMPVLCEDLGETLDPALEPVLLKQTFMSGGRLLIRLGDSDIDYDRNFRFYMTSKMTNPHYLPEVCIKVTIINFTVTKQGLEDQLLGDVVGLERPDLEEQRNQLIMKINADKNQLKAIEDRILKLLFESEGNILDNEELINTLNESKVTSGVIKQRLAEAEVTEEKINTAREKYIPVAARGSVMYFVVADMGEVDPMYQFSLKYFKQLFNTTISMSEKSPDLQARLRICLKETTSAIYKNVARALFEKDKIVFSFMLCVEIMKQEGHIAMPEWNFFLRGATGMDRQRAPKPDVDFIKILTWNQACDISDTVPIFRGVHTDLIKTPVWVKLGETEIHANPDEYSTYEPHPPAPEPLKEGQEQEIEVDD---GTIKGHWNLRLTSFQKLMFIKVFKEEKTIFAVTDFVRENLGQQFVESPPVSLQTLYDDMNKTTPLVFVLSTGSDPMGAFLRFAREKGYSDKIQSISLGQGQGPVAEK 3644          

HSP 2 Score: 852.432 bits (2201), Expect = 0.000e+0
Identity = 389/600 (64.83%), Postives = 484/600 (80.67%), Query Frame = -3
Query:   72 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1871
            F    ++K Y +++Q+ISLGQGQGPVAEK++ ++ K GDWV LQNCHLAASWM+ +E +VK+  E P ++HE+FRLFLSSMP+ TFP+SVLQNSVKVTNEPPKGLRAN++RAF EM+P FFE +VLG+ W+++IFGICFFH+IIL+RKKFGPLGWNIRYEFSDSDRECA+LNL MFC DG I WDAL YI  EITYGGRVTD  D+RCL  +L TFF+P+T+  DYKYS SGIYY P+ E + +Y+D+++SLP +EEPEIFGMHENAN++FQ QET  L+ TILDVQPR+++GGTG++ DDIVYELA+ ILEK++ K++ +EA  ++F  D KGRLNSLTTVL QEVDRFN LL VIK+SL+ L+KAIKG VVMSE LE VY AF N QVP++W+N AYPSLKPL++WV+DL  R +    W+  G PKS+W+ GFFFPQGFLTG+LQNYARKY+ PIDHLSF F   K  R+Q+EV KQM ELKFGE IE DK +  P DGVLVHG++MDG RWD E+  ++ S+ G M  VLP++HM PKMD+ P+   Y +PLYKT  RAGVLSTTG STNFVV   LP++  +++WI  GAAL+C+
Sbjct: 3616 FLRFAREKGYSDKIQSISLGQGQGPVAEKLISSSVKSGDWVILQNCHLAASWMLSMENVVKQMGEAPQDIHEDFRLFLSSMPSTTFPVSVLQNSVKVTNEPPKGLRANMRRAFGEMTPTFFEENVLGVKWKRMIFGICFFHAIILERKKFGPLGWNIRYEFSDSDRECALLNLQMFCKDGAIPWDALIYIAREITYGGRVTDVQDKRCLGTVLKTFFYPETLDPDYKYSPSGIYYAPDMEELQQYRDYIESLPQIEEPEIFGMHENANIAFQNQETMALVTTILDVQPRLSSGGTGKSNDDIVYELAESILEKVMGKLDIDEANQEMFALDAKGRLNSLTTVLTQEVDRFNNLLKVIKDSLLTLQKAIKGLVVMSEALEGVYNAFLNKQVPSMWANAAYPSLKPLASWVEDLTHRTAFIDNWIRHGLPKSYWMSGFFFPQGFLTGSLQNYARKYNLPIDHLSFHFHPMKFTRDQKEVTKQMAELKFGEEIELDKEIDLPADGVLVHGMFMDGCRWDPEDMVVVDSVPGIMNDVLPVIHMEPKMDFSPDPEDYRAPLYKTSARAGVLSTTGHSTNFVVMTHLPSNFSNDYWIAKGAALLCQ 4215          
BLAST of SMED30008756 vs. TrEMBL
Match: gnl|BL_ORD_ID|18224252 (tr|A0A1I8GYQ2|A0A1I8GYQ2_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 4750.65 bits (12321), Expect = 0.000e+0
Identity = 2351/3650 (64.41%), Postives = 2831/3650 (77.56%), Query Frame = -2
Query: 1786 PTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSV-SEADKHVKRRKIGTLDPIXXXXXX-------------------XXXXXXXXXXXXXXLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIYGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNL-----------------KVVSYHNVIKEDFYMVSL-NGCTHIVAGD-EIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAE-APDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYK----IIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEE------------KAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDS--KDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKV--PLAMR--------ATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGK--LKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHD-PWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDS-EFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 12519
            PT AQ++  A P+  +LEPL  LK  QH +    I+++ K+ +  +    +     K R+ G L+P+ D                                 +    + P+  D     A+G    H   A+V +          T +   A  + GET+I K+I++LR  P+IKF YL   +      ++ Y L                 +VV Y+ + + D+  +S+  G   +  GD +I+++ LDRF +EY +  ++ K  TF  F+ WKAF+ W+K + + K  +  K L  +LFIIN SLRPA+LNVREMC+RISDMGLCK++KGRTY L DF  AQ  QL+EV+ +L EFR+LV+EV+R+ACRT+LLE GF PDDYF+D          PPGT SSYMMQSYDMD+YAE +PDKMTYTEQANKRNHCQRL+ FIRLADYLIVNTMHVLAVNSV T+LNY+ +QL  TP+ EEI +Y         +    +     +        +P +Q       PPEE                 +PPLFITEFVL +  + F P  + F + I+ ++  F++ VL+VQNLVPD YFD+FT+P+INNKFEEK         AMF +D HL  +  Q  D++DAAFNA ++Y++TF   R+FY++NE+TDL++ +  + DVEFF EA  RY+R+ RM   I E++PIGM+LV+   MK L++PSPQRCL+ I+++LP +AR EVD L+KESQDAEY L  EP +T DYV+ L FL EIQ R+EPLE EA+V+KEMY+L+D F VP PPED AV+QTL+PSID+AKNAIDKALA+R+ N+DKF + +++DIAE+ +EV++++Q   NP+ILDV + K +V +E+ KL   M EL+ RA+ YK+YQKNFKVEQ + ++LEEV AELKLK++LW+S+DEWD   ++W    FM+L+ EDL   T KY+K V QLEKGLPPN VVP LK+KV+ MR K+ V+T+L N  L++RHW +IE+I++    +  E  TLG LIE+  F++ E L+E+SGQASSEASLE +L +VEEAW+  E+++LP+K+   KDV++LGGTD+IQQL DDSNIN+ATIASSRHVGPIK RVD+W  NL+LFGKT+EEW+ CQRNW+YLES+FSAPDIQ+QLPSE+KSFMSVDKSYKEIMRK QK+  P  MR        + TT   L  F+N              YLESKRV+FPRFYFLSNDELLEILAQTRNP AVQPHLRKCFDAISKL+F I   PK    +G P    P EV Y+NDI AM+SPEGEKVSLGKGLKARGNVE+WLGKVEEAMF NLRKL + S+ ++   +REEWL  H +Q+VLTV Q MWC +I  IL    + RL+GM  FE KCFQDLNKLA +VRG LPKL RA LCALIT++VHARDMVTEMV+ ++ D+  F+WQKQLRYYWD   DNC+V+MSNS Y YGYEYLG SPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIR AKA  + RFMFEGREIKLV TCAAFITMNPGYAGRTELPDNLKALFRPI+MMVPDYRLIAEVILYSEGFESSK LA KMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAG LKRENPDK EDVVLIRALRDSNLPKFLKQDA LF+AIL+DLFPGV+LPEHDYG F+ EI  VI + GLQI+ +QVLKVIQF+ETL VRHGVMLVGPTGGGKTTVY VLA VL NL     +  RP+YQPVK Y+LNPKSITMGELYG  N  T+EWHDGLM   VR  C D ++DHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTP++HMLFEVQDL+VASPATVSRCGMVYVDPE++GW P+V+TWL  +T +   + +++DY++ +F KYID GL F   KC Q MAQV+IAK+ T+C L +SLL GPGAP+L  D  K+ P +  +FVF YLWG+GGN  ++NWDS DNFVR +FEDNGD R+PS GDLWSSY D+ +++MDLWEKI+P F +NK +PFFEM+VPTVDT+RFGYLLEK   + +SVLFTG TGVGKSVVARG LN+I+E A YVP++INFSAQTSSNRTQEMIE+KLEKKRK VLGAPT K++IIF+DDLNMPKLDTYGSQPP ELLRQYQDFGGFY+RDKL WI++QDM L AAC PPGGGRNPV+ RL+RHF MF +P PSE +L+ +F SI+  F  DFP  +RG  E IV +AVE+Y RM TDLLPTPAKSHYVFNLRDLSKC+QGILQ DP CVRDK  +F+LFCHE QRVFHDRLIN EDKMFFHQI+ EMASKYFGE ++ ESFI  PI+FGDFMK G EK +RLYE LTD  KVK IL  YLDD+NM S+KEMKLVFFMDAI+H+ RIARMIRQ+RGNALLVGVGGTGKQSLTRLAA +N Y CFQIEL RGY Y  F  D+K++Y   G+ NQHTVFLFTDTQIVVEEFLEDINNILNSGEVP+LFE DE ER+IIGCR AAKE G++EGNRD I++FCINRVRNNLHIVLCMSPVG++FRSRCRMFPSLVNCCTIDWFT WP EAL++VA+S F   D+G+DELK KL+ MC  IHTSV   +++FY ELKR +YTTPTSYLELI LYLSML  KK +L   RDRVKNGL K+LETN+L+ TMEV L  +RP+LEQKQKD EALM+ L  DQE+AD+VR KVKEDEAVAKVKA ET+AI  DAQ+DLDEA+PALE A+KAL++LDKNDI+EIRVFT+PP +VQTVME+VCLLLG KTDWASAK VLGD  FL++L DYPKD I   +L  LK+Y+++P FT  NVEKVSKAC+S+ +WVRAMD+Y+K  +TVEPKKK+LE AN EL+ VM  LRQKQA+L  VE+KIA LQK +D++V EKK LEH LALT+ARLKRAGKLTTALADEK+RW  +V  FN+E+G+VVG+VF+ AACV+YYGAFTS YR EL++ W+ RC EL+IP SE++TL  VLG+ + LRQWN++GLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWI+NKE+ N L++IKLS+ NFLRTLEN IRLGMP L ED+GE+LD ALEP+LLKQT+   GR LI LGD D+EY K+F  Y+T+KLSNPHY+PE+CIKVTIINFTVTP+GLEDQLL EVTRLERP+LE+QRN LI++INN++ +L+  E+ ILK+L+ESEGNILD+E+LI TLN+SK+TSAETTK++AEAE+TEQKI+ ARSKYIPVA RGS MYFVVANMAEIDPMYQFSLKYFK LFNNTIE+S+KS +LE+RI+I+LA TT +TYNNVARG+FEKDKLVFSF+LCI+I++Q+ +IS  EW FFLRG GG+EKKRPE+P +  W++  VW NV+D++D  P+F +L  D+ +  + VTIGE+T   N      + P P  PS+  I KSR D    A+  SGH+D RL SFQKL+L+K   E+K+V  ITEFVK NLG  FVE P  +L LL+ DMSK +PLVFVLSTGSDPMN FQRFAKEK    +  +   G   G    K
Sbjct:  251 PTKAQQRTQAAPSSNYLEPLATLKHRQHISHPDYIRQKAKDKLQEEGQWRDGPDPKKLRRSGVLEPLTDETRAGLPELPEPLKERQESLSRPQSAAAAAAAAEVGGSISPDGGDERKASAQGRV--HAASASVSR----------TKVEVDAAQFYGETDIMKVINVLRANPKIKFFYLNPAVPITNVGFNSYKLNCVSTVANSNNRLVSLRRVVDYNKMDQSDYATLSIEGGFVRMREGDTDIEYLPLDRFIYEYSIVGEIVKRRTFFDFKKWKAFMTWKKTVNWLKIDRAKKGLEENLFIINRSLRPAILNVREMCYRISDMGLCKIDKGRTYRLPDFKTAQQEQLDEVSKRLKEFRDLVKEVVRTACRTALLEAGFTPDDYFVDEALME-----PPGTASSYMMQSYDMDIYAEESPDKMTYTEQANKRNHCQRLSCFIRLADYLIVNTMHVLAVNSVTTMLNYLQEQLANTPSLEEIQSYNRQEDEDDDDEAEEKAAAKAAAAAASAPTDPAQQPG-----PPEERPKSGTAAAPAEEPVAKVPPLFITEFVLDLSQIDFAPSNKDFVDEISVIVDAFKDVVLNVQNLVPDAYFDAFTRPIINNKFEEKD--------AMFEDDRHLSAITQQIRDSLDAAFNAANQYSNTFEPFRKFYQENEATDLESFKQAQIDVEFFHEALKRYNRQERMATGIVEERPIGMLLVNGANMKSLLIPSPQRCLEAIHDLLPRLARGEVDRLVKESQDAEYKLLQEPKDTTDYVDLLTFLDEIQQRIEPLENEAEVVKEMYELVDHFKVPVPPEDQAVFQTLFPSIDKAKNAIDKALAEREANVDKFVSCMERDIAEINKEVREVKQEAQNPMILDVTSEKDKVMKEVAKLLTRMEELRKRAYQYKAYQKNFKVEQTKFDELEEVLAELKLKEMLWNSIDEWDKYLDQWKAAPFMELDVEDLSNTTMKYMKAVQQLEKGLPPNPVVPRLKEKVDDMRTKLPVVTDLRNENLKDRHWNKIEEIVSLALRDQPEPFTLGTLIEIKAFEHSEALQEVSGQASSEASLEQILLRVEEAWKTQEFIILPYKEHLYKDVYMLGGTDDIQQLLDDSNINIATIASSRHVGPIKHRVDDWQANLELFGKTLEEWVTCQRNWMYLESVFSAPDIQKQLPSESKSFMSVDKSYKEIMRKAQKLRWPCDMRLKLAYWRHSRTTICCLMKFRN--------------YLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAISKLEFGIL-APKT-PQEGEPAA-DPNEVTYSNDIHAMLSPEGEKVSLGKGLKARGNVEDWLGKVEEAMFSNLRKLTKASLLDYMDSKREEWLTRHCSQVVLTVSQTMWCSDIEEILSGEPDTRLEGMKKFEQKCFQDLNKLAAVVRGDLPKLLRALLCALITIDVHARDMVTEMVENEIDDVASFDWQKQLRYYWDKDEDNCIVKMSNSRYYYGYEYLGASPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRQAKAGNMFRFMFEGREIKLVKTCAAFITMNPGYAGRTELPDNLKALFRPISMMVPDYRLIAEVILYSEGFESSKNLALKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGALKRENPDKHEDVVLIRALRDSNLPKFLKQDAVLFKAILRDLFPGVQLPEHDYGLFREEICSVITSRGLQIDDTQVLKVIQFWETLLVRHGVMLVGPTGGGKTTVYKVLADVLDNLKKN--SPTRPEYQPVKTYVLNPKSITMGELYGSYNLQTMEWHDGLMGVSVRTACADETEDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPFIHMLFEVQDLAVASPATVSRCGMVYVDPEDMGWRPYVRTWLTKLTTEHNFREDLVDYVFELFNKYIDPGLTFIHKKCTQAMAQVNIAKVMTVCNLFQSLLCGPGAPSLAGDENKVKPLVCTSFVFSYLWGVGGNTIDANWDSIDNFVRQQFEDNGDARLPSTGDLWSSYVDMDTKRMDLWEKIIPAFTYNKSIPFFEMVVPTVDTVRFGYLLEKSFALGRSVLFTGGTGVGKSVVARGHLNSIAEKANYVPIYINFSAQTSSNRTQEMIEDKLEKKRKNVLGAPTGKKIIIFVDDLNMPKLDTYGSQPPCELLRQYQDFGGFYERDKLYWISVQDMLLGAACAPPGGGRNPVTPRLIRHFNMFCLPPPSEYTLKHMFNSIMVRFLVDFPPSIRGQGEAIVGSAVELYFRMATDLLPTPAKSHYVFNLRDLSKCVQGILQADPGCVRDKGQLFRLFCHETQRVFHDRLINAEDKMFFHQIICEMASKYFGEQVDAESFITKPILFGDFMKMGAEKADRLYEELTDVNKVKQILGDYLDDYNMVSNKEMKLVFFMDAIEHVTRIARMIRQERGNALLVGVGGTGKQSLTRLAAHINSYKCFQIELSRGYGYKDFREDIKQLYTLAGVENQHTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEADEKERLIIGCRPAAKEVGIAEGNRDAIYDFCINRVRNNLHIVLCMSPVGNAFRSRCRMFPSLVNCCTIDWFTEWPREALMSVAQSFFSTADVGDDELKEKLSEMCVMIHTSVTDMADKFYNELKRKFYTTPTSYLELINLYLSMLAAKKNELTGGRDRVKNGLLKLLETNQLVGTMEVTLTEMRPKLEQKQKDVEALMEVLTADQEKADVVRSKVKEDEAVAKVKAMETEAIQQDAQKDLDEALPALEAAVKALNSLDKNDISEIRVFTSPPPLVQTVMEAVCLLLGSKTDWASAKQVLGDTNFLRRLMDYPKDEITNKMLAGLKKYMENPEFTPSNVEKVSKACKSMCMWVRAMDMYAKVYRTVEPKKKKLEAANAELNVVMSTLRQKQAQLQEVEDKIATLQKKFDDTVGEKKTLEHELALTAARLKRAGKLTTALADEKDRWEVTVENFNKEIGDVVGNVFIAAACVSYYGAFTSEYRAELVNMWVSRCLELKIPTSENVTLFNVLGNPYTLRQWNTDGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIKNKESRNGLQMIKLSDPNFLRTLENAIRLGMPVLCEDVGESLDAALEPVLLKQTYTSGGRLLIRLGDKDVEYDKNFAFYMTSKLSNPHYLPEVCIKVTIINFTVTPRGLEDQLLSEVTRLERPDLEKQRNELILKINNERAKLKAIEDNILKMLYESEGNILDNEELIKTLNDSKITSAETTKKLAEAEITEQKISAARSKYIPVAERGSCMYFVVANMAEIDPMYQFSLKYFKNLFNNTIESSEKSDNLEQRIQIMLAATTNSTYNNVARGIFEKDKLVFSFLLCIEILKQSKIISPEEWNFFLRGAGGMEKKRPERPAEITWMNDPVWRNVIDLADFSPIFRSLTADLLRTPVRVTIGEVTGEGNPADFSGFGPTPTEPSDADIAKSRGDDPSVAERFSGHWDKRLTSFQKLMLIKVLQEQKVVPAITEFVKENLGKEFVEAPSIELNLLYSDMSKTTPLVFVLSTGSDPMNTFQRFAKEKNFDDRYHAISLGQGQGVVAEK 3851          

HSP 2 Score: 901.738 bits (2329), Expect = 0.000e+0
Identity = 415/602 (68.94%), Postives = 500/602 (83.06%), Query Frame = -3
Query:   66 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENS 1871
            F+   K+KN+ +R  AISLGQGQG VAEK++ AA K GDWVFLQNCHLAASWM+ LE IVK  +E P +++++FRLFLSSMPAK FP+SVLQNSVKVTNEPPKGLR NIKRAF EMSP+ FET++LG  W+K++FGICFFH IIL+RKKFGPLGWNIRYEF+DSDR+CA+LNL MFCA+G I WDAL YIT EITYGGRVTD WDQRCLR ILT FFHPKT+   YKYS SG+YYPP+  T+ +YKD+VD LPL+E+PEIFG+H NANL++QI+ET+ ++  IL++QPR+A+GG G++ D+IVYELAD IL K++ KI+ + AKP+LF  D +GRLNSLTTVL QE+DR+N+LL+VI+ SL QLKKAIKGFVVMSEEL+SVYTAF NNQVP LWSNVAYPSLK LS W+KDL +RC   ++W+ QG PKSFWLPGFFFPQGFLTGTLQNYARKY+YPIDHLSFEFIV   YR+QEEV K M+ + FGE I  D+ +  P DGVLVHGL+ DG R+D E  +   S    ML VLP++HM PKMD+ P+ + YISPLYKT+ RAGVLSTTG STNFVV+VPLP+D+  +FWINMGAAL+CE +
Sbjct: 3823 FQRFAKEKNFDDRYHAISLGQGQGVVAEKLISAAVKSGDWVFLQNCHLAASWMLSLENIVKDMAEKPEDINQDFRLFLSSMPAKAFPVSVLQNSVKVTNEPPKGLRNNIKRAFAEMSPEEFETNILGTDWKKIVFGICFFHGIILERKKFGPLGWNIRYEFNDSDRQCALLNLKMFCAEGEIPWDALIYITGEITYGGRVTDNWDQRCLRTILTQFFHPKTLEPGYKYSPSGVYYPPDQPTLQDYKDYVDQLPLIEDPEIFGLHSNANLAYQIEETRSMVEVILEIQPRVASGGGGKSNDEIVYELADSILGKIMTKIDLDLAKPELFEEDSQGRLNSLTTVLTQEIDRYNRLLTVIRTSLEQLKKAIKGFVVMSEELDSVYTAFINNQVPKLWSNVAYPSLKTLSNWIKDLILRCWFVHYWLTQGMPKSFWLPGFFFPQGFLTGTLQNYARKYNYPIDHLSFEFIVKPVYRDQEEVNKAMQTVGFGEEIPQDQEIERPEDGVLVHGLFTDGFRFDCETMRAALSHHNVMLDVLPMLHMQPKMDFTPDPSHYISPLYKTKVRAGVLSTTGHSTNFVVSVPLPSDKPQDFWINMGAALLCEKT 4424          
BLAST of SMED30008756 vs. TrEMBL
Match: gnl|BL_ORD_ID|22919750 (tr|A0A4S2M280|A0A4S2M280_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004505 PE=4 SV=1)

HSP 1 Score: 4725.61 bits (12256), Expect = 0.000e+0
Identity = 2321/3666 (63.31%), Postives = 2825/3666 (77.06%), Query Frame = -2
Query: 1786 EAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDP---------IXXXXXXXXXXXXXXXXXXXXLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHI--YGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDY-EDLSRPE------EQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGK--------------YDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFK---------------------------------------VEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQ--PQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVV-EERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDP--WISLNVWNNVVDVSDIIP-VFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 12552
            E + G + F  PTIAQ K+ +IPA  F+EPLT LK++Q +NSV  I  R   T+  +     +   K+R++ +            I               +  +  ++P  QD      +     ++ Q T    PH   +GKC +++++D+  SYEGET+I KII  LRE+PEIKF YLTH L K  T YHYYNLKV  +  + + ++Y +SL+GCTH+V  DE +HISL+RFE EY+ +  + KIPTF +FR+WK F RWRKVI+Y K  QC + L ++L+I NSSLRPALLNVREMC+RISDMGLCK+EKG+TYTL++F+  Q+ QLNEV ++L EFRELV+EV+RSACRT+LLE GF PDDYFI+    P   E     G+SY+   YD+++++EA DKMT+TE A KR +CQRLT FIRLADY IV+T+H L VNSVYTLL+ + D L+ TP  EEI +Y+I V  +    +    + RP+      E    +P    S+  +   E + A V  PLF+ EF+L    L  +PD   F++GI E+I +FQ  V  ++NLVPD YFD+FT+P+INNKFEEKTCG GP +  MFAED  L  +I     ++  AF A   Y +TF E+  FY +N     + I+  +               ++ FFR+   ++HRE+ M +L+  Q+ IGM L+D + M+ L+LPSP RCL++ + +LPV AR EVD L++E+Q+A+YTL   P+ TVD+V  L FL  +Q R+EP+E+EADV+KE+YD+I+AFNVP PPED+AVYQTL PSI+RAKN+ID+AL++RD  +D F ASLDKD+AE+  ++K+ +Q INNP++LD  A +  V+ EL+++K+T+ +LQ RA  Y+ Y ++FK                                       +EQ R+E+L+ + AE+KLKQ+LW+SL++WD  Y +WL  +F+KL+ ++L     KY+K V  LEKGLPPN VVP+LK KV+ M+ K+  I ++ NP LQ RHWQ++E++I +  +E E  L+LG LIELN F + E + E+S QASSEASLE LLKKVE+AW+ TE+ VLP+KDSKD+FI+GGTDEIQQL+DDS IN+ATIASSRHVGPIK RV+EW   LDLFGKT+EEWL CQR+WLYLESIFSAPDIQRQLPSEAKSFM+VDKSYK++MRKVQKVPLAMRA T PGLLDTF+NNNQLL+QIQKCLEAYLESKR +FPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKL+FA              QTP+  P E  YTNDILAM+SPEGE+V+LGKGLKARGNVE+WLGKVEEAMF NL++L++ SI  FD+ +R+EWLK+HANQI+LTVEQ+MWCR+IT ILED   E+RL+G+ +FE KCF DLN+LAG+VR  LPKL R+ LCALIT++VHARDMVTE+V  KV  +  F+WQ+QLRYYWD   D CVVRM+++ Y+YGYEYLG SPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDL+KS+AKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKA+K+SRFMFEGREIKLV TCAAFITMNPGYAGRTELPDNLK+LFRPI+MMVPDYRLIAEVILYSEGFESSKTLA KMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAG LKR+NPDKPEDVVLIRALRDSNLPKFLKQD+ LF AILQDLFPGV LPEHDYGRF  EIE V+   GLQ+ P+QV KVIQFYETL VRHGVMLVGPTGGGKTTVY VL KVL+NL+ AGL+ E P+YQPVK Y+LNPK+ITMGELYGEVNKLTLEWHDGL+  +VR TCVDTS+DHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLT YVHMLFEVQDL+VASPATVSRCGMVYVD EELGWMP+VKTWL  +  KL   V+DYL  +F  Y+D  L+F  T+C   + QV IA++QTMC+LLE LL  P AP++  +  KLNP +A++FVF  +WG+ G   ++NWD  D FVRN F+D GD R+P  GDLWS Y D+ +R+MD WEK++  F + KE+PFF+MIVPTVDT+R+GYLL+KLL V QSVLFTG TGVGKSVVARGTLNNI+    YVP F+NFSAQTSSNRTQE+IE+KLEK++K V GAP +KRVI+F+DDLNMP+LDTYGSQPPIELLRQ +DFGGFYDRDKL WITI D+TLSAACGPPGGGRN V+ RL+RHF++F+IP PSE++L+QIF +IL GF  +FPQ VRG  + I+ AAVEIY RM  +LLPTPAKSHYVFNLRDLSKC+QGILQ DP+ +RDK+ + +LF HE+ RVFHDRLI+ EDK FF++++ EMA KYFGE++E ESF K PI+FGDF+KPGL + ERLYE LT   K +N+L+ YLD++N + SKEMKLVFF+DAI+H+ RIARMIRQDRGNALLVGVGGTGKQSLT+LAA++N Y CFQIEL RGYDY  FH DLKK+Y W G+ N+ TVFLFTDTQIVVEEFLEDINNILNSGEVP+LFE +EYER+IIGCR AAKE G+ EGNRD IF+FCINRVRNNLH+VLCMSPVGS+FR RCRMFPSLVNCCTIDWF  WPE+AL  VA SSFEHVD+G  E+K  ++ + TEIH SV++ ++RFY ELKR YYTTPTSYLEL+ LYLSML  K K+L   R++ +NGL KILETNEL+ +MEVEL A+RP LE KQ+DTE LM KLG DQEQADIVR +VKEDEA+AK KA+ETQAIADDAQRDLDEA+PALE A KALD+LDKNDI+EIRVFT PPQ+VQTVME+VCL+LGQK DWA+AKS+LGD  FL++L +YPKD I +ALLKKLK+YID+P+F  E VEK SKAC+S+                          +N ELD V+ KLRQKQAEL AVE KIA LQ  +D SV EKK LEH LALT+ARLKRA KLTTALADE++RW+ SV +F  ++ N+VGDVF+ AACVAYYGAFT+ YR  L+S W+ RCREL IPVSE  +L  VLGDAFELRQWN++GLPRDQVST+NAILVTR RRWPLMIDPQEQANRWIR  E  N L++IKL++ N LR+LE CIRLG P L+ED+GETLDPALEP+LL+QTF+ +GR LI LGDSD++Y  +F LY+TTK++NPHY+PE+ IKVT+INFTVTP GLEDQLLG+VT +ERPELEEQR+ LI+RIN D+NQL+ TE+RILKLLFESEGNILD+EDLINTLNESKV S E  KR+ EA  TEQKIT ARSKY PVA RGSVMYFV+  MAEID MYQFSLKYFK LF +TI++S +S  LEERI+ILL+ TT+ATYN+VAR LFE+DKLVFSFMLC QIMRQ G I+  EW +FL G G +E+ RP +P +   W+S   W  +VD++   P  FS+L  D+         G + +  +    D     P + S        L  E  +  +  Y+  L SFQKL+L+  F +E++V  +T+F++ NLG  F+E P   L LLF++M + +PLVF+LS GSDPM Q QRF+KE     +  S   G   G    K
Sbjct:   14 EKIKGRLCFRKPTIAQYKRTSIPARPFIEPLTQLKEYQEHNSVEAIHSRAVATLTERGFITPEDECKKRRLLSFATTKMDIPESYIGTGSFVSKGHLPASIQALNRGLEPAYQDAS---KQDKLLPNLVQLT---HPHALKFGKCEVSEMLDEVASYEGETDILKIIQALREKPEIKFFYLTHALPKSSTKYHYYNLKVAPFDKLNRNNYYTLSLHGCTHVVINDETEHISLERFETEYKTFMNICKIPTFARFRLWKGFTRWRKVIRYMKMDQCRRHLRDNLYIANSSLRPALLNVREMCYRISDMGLCKLEKGKTYTLLEFLTNQVNQLNEVCTRLCEFRELVKEVVRSACRTALLEAGFMPDDYFIEANANPMVMETQ-TLGTSYLSSGYDVELFSEATDKMTFTEMAAKRKYCQRLTCFIRLADYQIVSTLHTLTVNSVYTLLDCLCDHLRHTPPVEEIASYQIKVNPLTEAPNLTSSMKRPDSYRAGVEDTAGKPQPSFSVHSLTA-ESDVAQVTKPLFVLEFILEHDRLYMIPDEPLFRDGILEIISKFQEQVFGIKNLVPDPYFDAFTRPIINNKFEEKTCGSGPQLQHMFAEDTGLKTIIENVKMSLSRAFEAVRAYMNTFKEIHDFYHENNLITTEGIQQAQKQACDSMEHKDRLQTNMAFFRDNLLKHHREVVMTQLVPMQRSIGMFLIDTSTMRSLLLPSPNRCLELFHRLLPVDARAEVDRLVQETQEADYTLSLSPSTTVDFVKHLEFLVHMQTRIEPIEKEADVVKEIYDMIEAFNVPVPPEDYAVYQTLLPSIERAKNSIDRALSERDVIVDMFFASLDKDVAEMLHDMKEAKQNINNPVLLDATAERETVRYELQRMKDTIEDLQNRAALYREYLRSFKELVQTISGTSLEDQILSRASVRAASFVEFLQKWFPNVLRMEQPRIEELDLLVAEIKLKQLLWNSLEDWDEIYEQWLTADFLKLDTDELSATIQKYIKSVTMLEKGLPPNNVVPLLKAKVDGMKSKLPSIMDMRNPTLQPRHWQKLEELIGFHLAEMETPLSLGLLIELNAFSHAEAILEVSSQASSEASLEKLLKKVEDAWKSTEFTVLPYKDSKDIFIVGGTDEIQQLFDDSIINIATIASSRHVGPIKGRVEEWSALLDLFGKTLEEWLICQRSWLYLESIFSAPDIQRQLPSEAKSFMAVDKSYKDVMRKVQKVPLAMRAATQPGLLDTFRNNNQLLEQIQKCLEAYLESKRSVFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLEFA--------------QTPESKPDEPVYTNDILAMLSPEGERVALGKGLKARGNVEDWLGKVEEAMFANLKRLMKISINSFDSSDRDEWLKSHANQIILTVEQLMWCRDITHILEDPFPEDRLEGLEEFEKKCFADLNQLAGMVRSELPKLLRSLLCALITIDVHARDMVTELVASKVDSLTNFDWQRQLRYYWDQDQDICVVRMASACYSYGYEYLGASPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLSKSVAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKASKVSRFMFEGREIKLVPTCAAFITMNPGYAGRTELPDNLKSLFRPISMMVPDYRLIAEVILYSEGFESSKTLALKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGSLKRQNPDKPEDVVLIRALRDSNLPKFLKQDSVLFTAILQDLFPGVTLPEHDYGRFLAEIEAVLTKMGLQVVPAQVTKVIQFYETLLVRHGVMLVGPTGGGKTTVYRVLIKVLTNLHEAGLSSEVPEYQPVKTYVLNPKAITMGELYGEVNKLTLEWHDGLLASVVRKTCVDTSEDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTNYVHMLFEVQDLAVASPATVSRCGMVYVDSEELGWMPYVKTWLTGLLDKLTTPVVDYLMNLFVNYVDPCLEFVTTQCTDVIPQVPIARVQTMCKLLEVLLTNPNAPSMTQEKHKLNPILAMSFVFSLIWGLAGGTIDANWDQVDAFVRNLFDDVGDARLPQHGDLWSCYVDMDTRRMDSWEKMLVSFTYKKEIPFFDMIVPTVDTVRYGYLLDKLLEVDQSVLFTGLTGVGKSVVARGTLNNIAAARNYVPTFLNFSAQTSSNRTQEIIESKLEKRKKGVRGAPKDKRVILFVDDLNMPRLDTYGSQPPIELLRQLKDFGGFYDRDKLEWITILDVTLSAACGPPGGGRNSVTPRLIRHFSVFTIPPPSEVNLKQIFLTILKGFLREFPQGVRGAVDAIIGAAVEIYVRMAKELLPTPAKSHYVFNLRDLSKCVQGILQADPTVIRDKNAITRLFLHESLRVFHDRLISQEDKNFFYEMLVEMAGKYFGEDMEVESFSKTPILFGDFLKPGLPRSERLYEELTSTEKARNLLNEYLDEYNFSISKEMKLVFFVDAIEHVCRIARMIRQDRGNALLVGVGGTGKQSLTKLAAYINDYRCFQIELTRGYDYQAFHEDLKKLYFWAGVENKPTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFENEEYERIIIGCRPAAKEIGIPEGNRDAIFDFCINRVRNNLHVVLCMSPVGSNFRVRCRMFPSLVNCCTIDWFVEWPEDALYGVALSSFEHVDLGSAEVKECVSRLSTEIHLSVSEAADRFYLELKRPYYTTPTSYLELLNLYLSMLATKTKELSELRNKFRNGLDKILETNELVVSMEVELTAMRPTLEVKQRDTEKLMHKLGEDQEQADIVRTRVKEDEAIAKQKAQETQAIADDAQRDLDEAVPALEAANKALDSLDKNDISEIRVFTKPPQLVQTVMEAVCLMLGQKPDWATAKSLLGDSNFLRRLVEYPKDEISDALLKKLKKYIDNPDFVPEVVEKTSKACKSM--------------------------SNAELDVVVQKLRQKQAELAAVERKIAILQSEFDVSVAEKKKLEHRLALTTARLKRAAKLTTALADEQDRWSLSVDQFQAQIANIVGDVFVAAACVAYYGAFTADYRETLVSKWVTRCRELGIPVSEDPSLFNVLGDAFELRQWNTQGLPRDQVSTDNAILVTRTRRWPLMIDPQEQANRWIRTMEEENNLQVIKLTDMNLLRSLETCIRLGYPMLIEDVGETLDPALEPVLLRQTFMSSGRLLIRLGDSDVDYDNNFHLYLTTKMANPHYLPEVSIKVTLINFTVTPAGLEDQLLGDVTGIERPELEEQRSQLIVRINTDRNQLKATEDRILKLLFESEGNILDNEDLINTLNESKVKSGEINKRLTEATSTEQKITNARSKYSPVAARGSVMYFVITTMAEIDSMYQFSLKYFKHLFISTIQDSPESPILEERIQILLSATTLATYNSVARSLFERDKLVFSFMLCAQIMRQQGGITSQEWNYFLLGSGNLERARPPQPEETQGWLSAQQWRRLVDLAHYFPEQFSSLPKDLIN-------GTILLDFDPPTADKMGRRPSITSGRE-DYYLLTPEGTERRATRYNSELGSFQKLLLISNFSKEEVVRAVTDFIRFNLGPEFIEAPECSLSLLFKEMDRQTPLVFILSPGSDPMGQLQRFSKEHGFADRIHSVSLGQGQGPAAEK 3623          

HSP 2 Score: 856.67 bits (2212), Expect = 0.000e+0
Identity = 389/593 (65.60%), Postives = 478/593 (80.61%), Query Frame = -3
Query:   78 KKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALI 1856
            K+  + +R+ ++SLGQGQGP AEK+M+ AA+ GDWVFLQNCHLAASWM+RLEE+VKKRS++P   +  FRLFLSSMPAK+FPISVLQNSVKVTNEPPKGLRAN+ RA NE++ + FETH LG  WRKL+FGICFFH+I+L+RKKFGPLGWNI Y+F+DSDRECA+LNL MFC D  + W+ALTYIT+EITYGGRVTDFWDQRCLR IL  FF PKT+   Y YS SGIYYPPE   + +YKD+V SLPL   PE+FGMHENANL +QIQET  LI+T+L++QPR  A GTG+T D+IV++LA+ ILE++ D ++ + AKP+ F  D+KGR++SLTTV+ QEVDRFNKLL ++K+SL QL+KAIKGFVVMSE LE VYTAF +NQ+PN+WS  AYPSLKPLS+WV DLA+RC     WM +G P+SFW+ GFFFPQGFLTGTLQNYARKYDYPIDHLSF+F V   YR+QE V K M  L F + +EAD  L  P DGVL+HGL+MDG RW+D+  ++  SI GE L  +P++HM P+MD +P+  KY++PLYKT  RAGVLSTTG STNFVV + LP    +++WI  GAAL+
Sbjct: 3600 KEHGFADRIHSVSLGQGQGPAAEKLMEQAARNGDWVFLQNCHLAASWMIRLEELVKKRSDDPRPTNREFRLFLSSMPAKSFPISVLQNSVKVTNEPPKGLRANLSRALNELTAESFETHFLGETWRKLVFGICFFHAIVLERKKFGPLGWNISYDFNDSDRECALLNLDMFCQDRGVPWEALTYITSEITYGGRVTDFWDQRCLRTILERFFDPKTLEPTYTYSPSGIYYPPERPKLQDYKDYVLSLPLNASPELFGMHENANLVYQIQETNNLISTVLNIQPRTGAVGTGKTNDEIVHDLANTILERIPDGLDLKIAKPEFFLTDQKGRVDSLTTVMTQEVDRFNKLLHIVKDSLRQLQKAIKGFVVMSEGLEEVYTAFLHNQIPNMWSAAAYPSLKPLSSWVTDLALRCDFINCWMSRGRPRSFWISGFFFPQGFLTGTLQNYARKYDYPIDHLSFDFTVLPHYRDQEAVSKAMATLGFNQTLEADLALDDPEDGVLIHGLFMDGFRWNDKKMELADSILGETLAPMPVLHMKPEMDLKPDPRKYVAPLYKTSARAGVLSTTGHSTNFVVEICLPHSMTASYWIEKGAALL 4192          
BLAST of SMED30008756 vs. TrEMBL
Match: gnl|BL_ORD_ID|22934940 (tr|A0A4S2M2G6|A0A4S2M2G6_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004505 PE=4 SV=1)

HSP 1 Score: 4725.23 bits (12255), Expect = 0.000e+0
Identity = 2321/3666 (63.31%), Postives = 2825/3666 (77.06%), Query Frame = -2
Query: 1786 EAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDP---------IXXXXXXXXXXXXXXXXXXXXLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHI--YGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDY-EDLSRPE------EQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGK--------------YDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFK---------------------------------------VEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQ--PQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVV-EERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDP--WISLNVWNNVVDVSDIIP-VFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 12552
            E + G + F  PTIAQ K+ +IPA  F+EPLT LK++Q +NSV  I  R   T+  +     +   K+R++ +            I               +  +  ++P  QD      +     ++ Q T    PH   +GKC +++++D+  SYEGET+I KII  LRE+PEIKF YLTH L K  T YHYYNLKV  +  + + ++Y +SL+GCTH+V  DE +HISL+RFE EY+ +  + KIPTF +FR+WK F RWRKVI+Y K  QC + L ++L+I NSSLRPALLNVREMC+RISDMGLCK+EKG+TYTL++F+  Q+ QLNEV ++L EFRELV+EV+RSACRT+LLE GF PDDYFI+    P   E     G+SY+   YD+++++EA DKMT+TE A KR +CQRLT FIRLADY IV+T+H L VNSVYTLL+ + D L+ TP  EEI +Y+I V  +    +    + RP+      E    +P    S+  +   E + A V  PLF+ EF+L    L  +PD   F++GI E+I +FQ  V  ++NLVPD YFD+FT+P+INNKFEEKTCG GP +  MFAED  L  +I     ++  AF A   Y +TF E+  FY +N     + I+  +               ++ FFR+   ++HRE+ M +L+  Q+ IGM L+D + M+ L+LPSP RCL++ + +LPV AR EVD L++E+Q+A+YTL   P+ TVD+V  L FL  +Q R+EP+E+EADV+KE+YD+I+AFNVP PPED+AVYQTL PSI+RAKN+ID+AL++RD  +D F ASLDKD+AE+  ++K+ +Q INNP++LD  A +  V+ EL+++K+T+ +LQ RA  Y+ Y ++FK                                       +EQ R+E+L+ + AE+KLKQ+LW+SL++WD  Y +WL  +F+KL+ ++L     KY+K V  LEKGLPPN VVP+LK KV+ M+ K+  I ++ NP LQ RHWQ++E++I +  +E E  L+LG LIELN F + E + E+S QASSEASLE LLKKVE+AW+ TE+ VLP+KDSKD+FI+GGTDEIQQL+DDS IN+ATIASSRHVGPIK RV+EW   LDLFGKT+EEWL CQR+WLYLESIFSAPDIQRQLPSEAKSFM+VDKSYK++MRKVQKVPLAMRA T PGLLDTF+NNNQLL+QIQKCLEAYLESKR +FPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKL+FA              QTP+  P E  YTNDILAM+SPEGE+V+LGKGLKARGNVE+WLGKVEEAMF NL++L++ SI  FD+ +R+EWLK+HANQI+LTVEQ+MWCR+IT ILED   E+RL+G+ +FE KCF DLN+LAG+VR  LPKL R+ LCALIT++VHARDMVTE+V  KV  +  F+WQ+QLRYYWD   D CVVRM+++ Y+YGYEYLG SPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDL+KS+AKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKA+K+SRFMFEGREIKLV TCAAFITMNPGYAGRTELPDNLK+LFRPI+MMVPDYRLIAEVILYSEGFESSKTLA KMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAG LKR+NPDKPEDVVLIRALRDSNLPKFLKQD+ LF AILQDLFPGV LPEHDYGRF  EIE V+   GLQ+ P+QV KVIQFYETL VRHGVMLVGPTGGGKTTVY VL KVL+NL+ AGL+ E P+YQPVK Y+LNPK+ITMGELYGEVNKLTLEWHDGL+  +VR TCVDTS+DHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLT YVHMLFEVQDL+VASPATVSRCGMVYVD EELGWMP+VKTWL  +  KL   V+DYL  +F  Y+D  L+F  T+C   + QV IA++QTMC+LLE LL  P AP++  +  KLNP +A++FVF  +WG+ G   ++NWD  D FVRN F+D GD R+P  GDLWS Y D+ +R+MD WEK++  F + KE+PFF+MIVPTVDT+R+GYLL+KLL V QSVLFTG TGVGKSVVARGTLNNI+    YVP F+NFSAQTSSNRTQE+IE+KLEK++K V GAP +KRVI+F+DDLNMP+LDTYGSQPPIELLRQ +DFGGFYDRDKL WITI D+TLSAACGPPGGGRN V+ RL+RHF++F+IP PSE++L+QIF +IL GF  +FPQ VRG  + I+ AAVEIY RM  +LLPTPAKSHYVFNLRDLSKC+QGILQ DP+ +RDK+ + +LF HE+ RVFHDRLI+ EDK FF++++ EMA KYFGE++E ESF K PI+FGDF+KPGL + ERLYE LT   K +N+L+ YLD++N + SKEMKLVFF+DAI+H+ RIARMIRQDRGNALLVGVGGTGKQSLT+LAA++N Y CFQIEL RGYDY  FH DLKK+Y W G+ N+ TVFLFTDTQIVVEEFLEDINNILNSGEVP+LFE +EYER+IIGCR AAKE G+ EGNRD IF+FCINRVRNNLH+VLCMSPVGS+FR RCRMFPSLVNCCTIDWF  WPE+AL  VA SSFEHVD+G  E+K  ++ + TEIH SV++ ++RFY ELKR YYTTPTSYLEL+ LYLSML  K K+L   R++ +NGL KILETNEL+ +MEVEL A+RP LE KQ+DTE LM KLG DQEQADIVR +VKEDEA+AK KA+ETQAIADDAQRDLDEA+PALE A KALD+LDKNDI+EIRVFT PPQ+VQTVME+VCL+LGQK DWA+AKS+LGD  FL++L +YPKD I +ALLKKLK+YID+P+F  E VEK SKAC+S+                          +N ELD V+ KLRQKQAEL AVE KIA LQ  +D SV EKK LEH LALT+ARLKRA KLTTALADE++RW+ SV +F  ++ N+VGDVF+ AACVAYYGAFT+ YR  L+S W+ RCREL IPVSE  +L  VLGDAFELRQWN++GLPRDQVST+NAILVTR RRWPLMIDPQEQANRWIR  E  N L++IKL++ N LR+LE CIRLG P L+ED+GETLDPALEP+LL+QTF+ +GR LI LGDSD++Y  +F LY+TTK++NPHY+PE+ IKVT+INFTVTP GLEDQLLG+VT +ERPELEEQR+ LI+RIN D+NQL+ TE+RILKLLFESEGNILD+EDLINTLNESKV S E  KR+ EA  TEQKIT ARSKY PVA RGSVMYFV+  MAEID MYQFSLKYFK LF +TI++S +S  LEERI+ILL+ TT+ATYN+VAR LFE+DKLVFSFMLC QIMRQ G I+  EW +FL G G +E+ RP +P +   W+S   W  +VD++   P  FS+L  D+         G + +  +    D     P + S        L  E  +  +  Y+  L SFQKL+L+  F +E++V  +T+F++ NLG  F+E P   L LLF++M + +PLVF+LS GSDPM Q QRF+KE     +  S   G   G    K
Sbjct:   14 EKIKGRLCFRKPTIAQYKRTSIPARPFIEPLTQLKEYQEHNSVEAIHSRAVATLTERGFITPEDECKKRRLLSFATTKMDIPESYIGTGSFVSKGHLPASIQALNRGLEPAYQDAS---KQDKLLPNLVQLT---HPHALKFGKCEVSEMLDEVASYEGETDILKIIQALREKPEIKFFYLTHALPKSSTKYHYYNLKVAPFDKLNRNNYYTLSLHGCTHVVINDETEHISLERFETEYKTFMNICKIPTFARFRLWKGFTRWRKVIRYMKMDQCRRHLRDNLYIANSSLRPALLNVREMCYRISDMGLCKLEKGKTYTLLEFLTNQVNQLNEVCTRLCEFRELVKEVVRSACRTALLEAGFMPDDYFIEANANPMVMETQ-TLGTSYLSSGYDVELFSEATDKMTFTEMAAKRKYCQRLTCFIRLADYQIVSTLHTLTVNSVYTLLDCLCDHLRHTPPVEEIASYQIKVNPLTEAPNLTSSMKRPDSYRAGVEDTAGKPQPSFSVHSLTA-ESDVAQVTKPLFVLEFILEHDRLYMIPDEPLFRDGILEIISKFQEQVFGIKNLVPDPYFDAFTRPIINNKFEEKTCGSGPQLQHMFAEDTGLKTIIENVKMSLSRAFEAVRAYMNTFKEIHDFYHENNLITTEGIQQAQKQACDSMEHKDRLQTNMAFFRDNLLKHHREVVMTQLVPMQRSIGMFLIDTSTMRSLLLPSPNRCLELFHRLLPVDARAEVDRLVQETQEADYTLSLSPSTTVDFVKHLEFLVHMQTRIEPIEKEADVVKEIYDMIEAFNVPVPPEDYAVYQTLLPSIERAKNSIDRALSERDVIVDMFFASLDKDVAEMLHDMKEAKQNINNPVLLDATAERETVRYELQRMKDTIEDLQNRAALYREYLRSFKELVQTISGTSLEDQILSRASVRAASFVEFLQKWFPNVLRMEQPRIEELDLLVAEIKLKQLLWNSLEDWDEIYEQWLTADFLKLDTDELSATIQKYIKSVTMLEKGLPPNNVVPLLKAKVDGMKSKLPSIMDMRNPTLQPRHWQKLEELIGFHLAEMETPLSLGLLIELNAFSHAEAILEVSSQASSEASLEKLLKKVEDAWKSTEFTVLPYKDSKDIFIVGGTDEIQQLFDDSIINIATIASSRHVGPIKGRVEEWSALLDLFGKTLEEWLICQRSWLYLESIFSAPDIQRQLPSEAKSFMAVDKSYKDVMRKVQKVPLAMRAATQPGLLDTFRNNNQLLEQIQKCLEAYLESKRSVFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLEFA--------------QTPESKPDEPVYTNDILAMLSPEGERVALGKGLKARGNVEDWLGKVEEAMFANLKRLMKISINSFDSSDRDEWLKSHANQIILTVEQLMWCRDITHILEDPFPEDRLEGLEEFEKKCFADLNQLAGMVRSELPKLLRSLLCALITIDVHARDMVTELVASKVDSLTNFDWQRQLRYYWDQDQDICVVRMASACYSYGYEYLGASPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLSKSVAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKASKVSRFMFEGREIKLVPTCAAFITMNPGYAGRTELPDNLKSLFRPISMMVPDYRLIAEVILYSEGFESSKTLALKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGSLKRQNPDKPEDVVLIRALRDSNLPKFLKQDSVLFTAILQDLFPGVTLPEHDYGRFLAEIEAVLTKMGLQVVPAQVTKVIQFYETLLVRHGVMLVGPTGGGKTTVYRVLIKVLTNLHEAGLSSEVPEYQPVKTYVLNPKAITMGELYGEVNKLTLEWHDGLLASVVRKTCVDTSEDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTNYVHMLFEVQDLAVASPATVSRCGMVYVDSEELGWMPYVKTWLTGLLDKLTTPVVDYLMNLFVNYVDPCLEFVTTQCTDVIPQVPIARVQTMCKLLEVLLTNPNAPSMTQEKHKLNPILAMSFVFSLIWGLAGGTIDANWDQVDAFVRNLFDDVGDARLPQHGDLWSCYVDMDTRRMDSWEKMLVSFTYKKEIPFFDMIVPTVDTVRYGYLLDKLLEVDQSVLFTGLTGVGKSVVARGTLNNIAAARNYVPTFLNFSAQTSSNRTQEIIESKLEKRKKGVRGAPKDKRVILFVDDLNMPRLDTYGSQPPIELLRQLKDFGGFYDRDKLEWITILDVTLSAACGPPGGGRNSVTPRLIRHFSVFTIPPPSEVNLKQIFLTILKGFLREFPQGVRGAVDAIIGAAVEIYVRMAKELLPTPAKSHYVFNLRDLSKCVQGILQADPTVIRDKNAITRLFLHESLRVFHDRLISQEDKNFFYEMLVEMAGKYFGEDMEVESFSKTPILFGDFLKPGLPRSERLYEELTSTEKARNLLNEYLDEYNFSISKEMKLVFFVDAIEHVCRIARMIRQDRGNALLVGVGGTGKQSLTKLAAYINDYRCFQIELTRGYDYQAFHEDLKKLYFWAGVENKPTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFENEEYERIIIGCRPAAKEIGIPEGNRDAIFDFCINRVRNNLHVVLCMSPVGSNFRVRCRMFPSLVNCCTIDWFVEWPEDALYGVALSSFEHVDLGSAEVKECVSRLSTEIHLSVSEAADRFYLELKRPYYTTPTSYLELLNLYLSMLATKTKELSELRNKFRNGLDKILETNELVVSMEVELTAMRPTLEVKQRDTEKLMHKLGEDQEQADIVRTRVKEDEAIAKQKAQETQAIADDAQRDLDEAVPALEAANKALDSLDKNDISEIRVFTKPPQLVQTVMEAVCLMLGQKPDWATAKSLLGDSNFLRRLVEYPKDEISDALLKKLKKYIDNPDFVPEVVEKTSKACKSM--------------------------SNAELDVVVQKLRQKQAELAAVERKIAILQSEFDVSVAEKKKLEHRLALTTARLKRAAKLTTALADEQDRWSLSVDQFQAQIANIVGDVFVAAACVAYYGAFTADYRETLVSKWVTRCRELGIPVSEDPSLFNVLGDAFELRQWNTQGLPRDQVSTDNAILVTRTRRWPLMIDPQEQANRWIRTMEEENNLQVIKLTDMNLLRSLETCIRLGYPMLIEDVGETLDPALEPVLLRQTFMSSGRLLIRLGDSDVDYDNNFHLYLTTKMANPHYLPEVSIKVTLINFTVTPAGLEDQLLGDVTGIERPELEEQRSQLIVRINTDRNQLKATEDRILKLLFESEGNILDNEDLINTLNESKVKSGEINKRLTEATSTEQKITNARSKYSPVAARGSVMYFVITTMAEIDSMYQFSLKYFKHLFISTIQDSPESPILEERIQILLSATTLATYNSVARSLFERDKLVFSFMLCAQIMRQQGGITSQEWNYFLLGSGNLERARPPQPEETQGWLSAQQWRRLVDLAHYFPEQFSSLPKDLIN-------GTILLDFDPPTADKMGRRPSITSGRE-DYYLLTPEGTERRATRYNSELGSFQKLLLISNFSKEEVVRAVTDFIRFNLGPEFIEAPECSLSLLFKEMDRQTPLVFILSPGSDPMGQLQRFSKEHGFADRIHSVSLGQGQGPAAEK 3623          

HSP 2 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 393/595 (66.05%), Postives = 480/595 (80.67%), Query Frame = -3
Query:   72 KKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1856
            K+  + +R+ ++SLGQGQGP AEK+M+ AA+ GDWVFLQNCHLAASWM+RLEE+VKKRS++P   +  FRLFLSSMPAK+FPISVLQNSVKVTNEPPKGLRAN+ RA NE++ + FETH LG  WRKL+FGICFFH+I+L+RKKFGPLGWNI Y+F+DSDRECA+LNL MFC D  + W+ALTYIT+EITYGGRVTDFWDQRCLR IL  FF PKT+   Y YS SGIYYPPE   + +YKD+V SLPL   PE+FGMHENANL +QIQET  LI+T+L++QPR  A GTG+T D+IV++LA+ ILE++ D ++ + AKP+ F  D+KGR++SLTTV+ QEVDRFNKLL ++K+SL QL+KAIKGFVVMSE LE VYTAF +NQ+PN+WS  AYPSLKPLS+WV DLA+RC     WM +G P+SFW+ GFFFPQGFLTGTLQNYARKYDYPIDHLSF+F V   YR+QE V K M  L F + +EAD  L  P DGVL+HGL+MDG RW+D+  ++  SI GE L  +P++HM P+MD +P+  KY++PLYKT  RAGVLSTTGMSTNF+V +PL T     +WI MG ALICE
Sbjct: 3600 KEHGFADRIHSVSLGQGQGPAAEKLMEQAARNGDWVFLQNCHLAASWMIRLEELVKKRSDDPRPTNREFRLFLSSMPAKSFPISVLQNSVKVTNEPPKGLRANLSRALNELTAESFETHFLGETWRKLVFGICFFHAIVLERKKFGPLGWNISYDFNDSDRECALLNLDMFCQDRGVPWEALTYITSEITYGGRVTDFWDQRCLRTILERFFDPKTLEPTYTYSPSGIYYPPERPKLQDYKDYVLSLPLNASPELFGMHENANLVYQIQETNNLISTVLNIQPRTGAVGTGKTNDEIVHDLANTILERIPDGLDLKIAKPEFFLTDQKGRVDSLTTVMTQEVDRFNKLLHIVKDSLRQLQKAIKGFVVMSEGLEEVYTAFLHNQIPNMWSAAAYPSLKPLSSWVTDLALRCDFINCWMSRGRPRSFWISGFFFPQGFLTGTLQNYARKYDYPIDHLSFDFTVLPHYRDQEAVSKAMATLGFNQTLEADLALDDPEDGVLIHGLFMDGFRWNDKKMELADSILGETLAPMPVLHMKPEMDLKPDPRKYVAPLYKTSARAGVLSTTGMSTNFIVDIPLQTSSPPKYWIEMGTALICE 4194          
BLAST of SMED30008756 vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 2157.49 bits (5589), Expect = 0.000e+0
Identity = 1206/3093 (38.99%), Postives = 1807/3093 (58.42%), Query Frame = -2
Query: 1855 PLFITEFVL------SVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPD--TYFDSFTKPVINN-KFEEKTCGEGPSMAA-MFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRD----GNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQ--VVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFD--TLEREEWLKAHANQIVLTVEQMMWCREITAIL----EDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPV-FKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFG---ENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGE-DELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSG-WIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKK-RPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAK 11043
            PLF  + VL      S   + F P  ++  + +  +  +  +T+   Q L PD  T   S  KPV N  + +E+ C    ++AA M A  +HL                    Y  T+ + R+ +E N+ + +   +     V  F    +RY       +       +  +L+D + +K  ++           ++L ++A   +  L    QD  + L   P   V+ V  L  L  +Q  +  +E +   I E + +++ + V    E     Q L  +++       + + D D     + DKF + L     E +++++   Q  N+        +     E++  L+  +  L+    T +     FK EQ   +D++ +  ++     +W+   +WD+ ++EW   +F  L  E++ +      K + +L + L   Q  +V   K+++EQ +  + +I +L +P +++RHW QI+  +   F  +  + TL K++ L +  + E + EISG A  E S+E  L+ + + W+ T   + P+KD        GT+E+ Q  +D+ + ++T+ +SR V   +  VD W + L L  + IE  L  QR W+YLE IF   DI++QLP E+  F  ++ S+K IM ++ K   A+R T  PGLL+     N  L++IQK L+ YLE+KR IFPRFYFLSND+LLEIL Q+RNP AVQPHL+KCFD I  L        K E++                    M S +GE V     +   G VE WL  VE  M   L+  LR   T     T +R++W+K    Q+++T  Q+ W  ++T  L    E   +  L+ M   +V     L++ +  +RG L K+ R  + AL+TV VHARD++ ++ K    D+N F+W  QLR YW+  +D+C++R +N+ + YGYEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K L    +V NCSDGLDYK MGR +SGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A +A ++ F+FEGR+I LV +C  FITMNPGYAGRTELPDNLK++FRPI+M+VPD  LIAE+ L+ EGF + K LA+K+  +Y L  +QLS+QDHYDFG+RAL S+L  AG+ +R  PD  ++ +L+ +++D N+ K    D  LF  I+QDLFP VE P  DYG+ K  IE  +  SGLQ+ P  V KVIQ YET   RH  M+VG TG  K+  + +L K LS ++  G     P +  V  Y LNPK++++GELYGE +  T EW DG++  ++RI C D   D +W++ DGPVD LWIE+MN+V+DDNK+L L N ERI +   V +LFEV+DL+VASPATVSRCGMVY D  +LGW P+V++W++    + K+EV D+L  +F++YI   + F +T C + +    +  + ++CRL +SL       N   D +     + + F+F  +W I  ++ E      DNF+R       +   P++  ++  Y D  ++    +E  +P  +++    PF++++VPTVDT+R+ +L+  L+  +  VL TG  G GK+ VA+  L  + + A +  + IN S+QT+SN  Q +IE+++EK+ K        K+++ F+DDLNMP +D +GSQPP+ELLR + D+G +YDR         DM L A+ GPPGGGR  +S RL   F + ++  P+E  ++ IF +++     +F ++V+     +  A +E+Y  +    LPTPAK HY+FNLRD+SK  QG+L+        K  + +L+ HE  RVF DRL++  D   F  ++AE     F     NI P    K   IFGDF+K   E H  +YE L DF  +K  + S L+D+N+      M LV F DAI+H+ R+ R+I Q RGN LLVG+GG+G+QSL+RLAA++  Y  FQ+E+ + Y    F  D+KK+Y  TG++N+ TVFLF DTQI+ E FLEDINNIL+SGEVP+L++ DE+E +      +A++  V E   D +F + I RVRNNLHIVLCMSPVG  FR+R R +P+LVNC T+DWF+ WP++ALL VA+   + + +G  ++++ K+A +   +H SVA+ S+R   ELKRH Y TPT+YLEL++ Y  +L EK+ +L  +  +++NGL KI +T   +  M VEL   + ++ + QK  E  +  +   + +AD  +  V         +  + +A+A++AQRDLDEA+PALE A+KAL++L+K D+ EI+ +  PP +V+TVM++V +L G +  WA AK  LG+  F+K+L  + KDNI + +LKK+ +Y   P+F  E + +VS A +SL +WVRAM++Y +  + VEPK+ RL  A  +L E    L + + +   VE K+ +L+  YD  + +K+ L         +L RAGKL + LA E+ RW ++V    +++G +VGD  + AA ++Y G F S+YR ELL+  W+ + R+LE+P S        L     +R WN +GLP D  STEN ++VTRG RWPLM+DPQ QA +WI+N E+   LK+I L   +FLR LEN ++ G P LL+++ E LDP+L PIL K      GR L+ LGD ++EY+ DF+ YITTKLSNPHY PEI  K TI+NF V  QGLE QLLG V R ERPELEEQ+++L+I I + K +LQ  E+ IL+LL E+ G++LD   L+NTL  SK+T+ E + ++  +E TE KI  AR  Y P A R S+++FV+ +M  IDPMYQFSL  +  LFN +IE SQ+S  LEERI  L    T A Y    RGLFE+ KL+FSF +C +I+   G ++  E+ FFLRG   ++K+ + + P   W++ + W+N+ ++ D +  F  L++                S  +   D ++       E A             L G ++      QK+++V++  ++++  C+  F+  NLG+RFVEPP  D+  + +D +  +PL+FVLS G DP     + A+
Sbjct:  852 PLFKVQVVLRQYGPGSTAQVEFSPTLQKLAQIVNSINSQLISTISVFQRL-PDLLTRKRSQRKPVHNIIEQDEEICKIQAAIAAGMTANASHLQ------------------AYLKTWDKHREIWEINKDSFIRRYQHLNPPVSSFDSDIARYSEVANNVQKEETVLSVQFVLLDCSPLKFSLVQHCNEWQGKFTQLLSLMASTRLKELHSFLQDNAHRLSQPPQTLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVERE----VQDLLEALNGEWQGFQQVVIDSDIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDKQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDK-------GTEEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAA-------------------GMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSM---LHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKG----EPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDK---RQKMEV-DHLKRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPENGVN-PADNENYGRMVELWFIFSLIWSICASVDEDGRKKIDNFLREM-----EGTFPNKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSNAPFYKIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGL-DPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDRQ-----MKMDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTMINQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNICPN---KQQPIFGDFLK---EPH--VYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLE-TADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITEL-DKLANFHGLMS----------------SFEKYPKDWHQWYTSSEPENA------------PLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAE 3834          

HSP 2 Score: 400.979 bits (1029), Expect = 5.985e-111
Identity = 224/592 (37.84%), Postives = 338/592 (57.09%), Query Frame = -3
Query:   78 QAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTI-VEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRI---AAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKS-FWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK-YISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQES-NFWINMGAALI 1829
             A+SLGQGQ P+A +M+    K G WVFL NCHL+ SWM +L+++V++      + H +FRL+LSS P   FPI++LQ  +K+T EPPKG+++N+KR +  ++   F      +V+RKL+F +CFFHSI+L+RKKF  LGWNI Y F+DSD E +   + ++  +   I WDAL Y+ A + YGG VTD WD+R L   +  +F    +    +K S    YY P   + + Y++++  LP +E PE+FG H NA+++ QI ET+ L +T+L +QP++    A G G + +D V E++  + +K+ + ++ E  +  L   D+   LN    VL+QE+ R+N LL  I+ SL +L+K IKG VVMS  LE ++    + +VP LW   AYPSLKPL++W +DL  R      W     P   FWL GF FP GFLT  LQ+ AR+++  +D LS+EFIV                      ++ +  L  P DGV + GLY++G  WD +N  ++ +   +++  +P +H  P  + +  +   Y  P Y    R+G         +FVV V L +   S   WI  G AL+
Sbjct: 3843 HALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVE--DSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPELVDYESTQKLL--QDDPSPLN---VVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEK-AYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLSWEFIV--------------------STVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYSCPCYYFPVRSG----GAGRPSFVVGVDLKSGAVSYEHWIKRGTALL 4402          
BLAST of SMED30008756 vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 2056.57 bits (5327), Expect = 0.000e+0
Identity = 1136/2688 (42.26%), Postives = 1627/2688 (60.53%), Query Frame = -2
Query: 1837 DKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGL---KARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVL--KVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKI-EVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVR----NKFEDNG--------DCRMPSQGDLWSSYADLHSRKMDL-W-EKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLL---HVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA--DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPE-SFIKL------PIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMI---IGCRAAAKEAGVS-EGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLL-------------LGQKT--DWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLK-RYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRP----LPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYG 9732
            +++++ +E + +++ L NP ++ RHW+Q+ +I+N+  + +    TL K+++ N+  Y E  E IS  AS E SLE  L+ + E W I  +    H++S  V IL   DEIQ + DD  +   T+  S  + P +  +  W + L     TI+EWL  Q  WLYLE IFS+ DI +Q+P E + F +VDK ++E+MR   K P  + AT+  GLL+  + +N LL+QI K L AYLE KR+ FPRF+FLSNDE+LEIL++T++PL VQPHL+KCF+ I+KLDF             +P            DI AM S EGE+V L + +   +ARG VE+WL +VE+ M  ++R ++ +S   +   +R +W++    Q+VL   QM W +E+     + +   + G+ ++  +    L  +  LVRG LPK  R TL AL+T++VHARD+V EM+++ VS    F+W  QLRYYW++  DN  V + N    Y YEYLG SPRLVITPLTDRCY  L+GA  L+LGGAP GPAGTGKTETTKDLAK+LA QCVVFNCSDGLDY  MG+FF GLA SGAW CFDEFNRI++EVLSV+AQQ++ I+ A   K+  F FEG E++L   C   ITMNPGYAGR+ELPDNLK LFR +AMMVP+Y LIAE+ LYS GF ++K L+ K+   Y+LCSEQLS Q HYD+GMRA+K+VLV AG LK + PD+ ED++L+R+++D N PKFL  D  LF  I  DLFPG+ LP  DY  F    +   +   +Q  P +V   K+IQ YE + VRHG MLVG    GKT V +VLA  L+ +N  G  +E    + V+   +NPKSITMG+L+G+ + ++ EW DG++    R      + D +WV+ DGP+D LWIE+MNTVLDDNK LCL + E I+++  + ++FE  DLS ASPATVSRCGM+Y++P +LGW+P V +WLN++   L+  E    L  +F   I   L+  +  C + ++  +   + ++ RL E LL  P         + +   I  AF F  +W IGG+    + + FD F+R     K E++         +C    +G ++    +   +   + W E I  V   +K     ++IVPT+DTI F  L   L+      + +LF G TG GKSV  +  L N      Y+P FINFSA+TS+N++Q +I  +L+K+RK V G P  K+ IIF+DD+NMP ++ +G+QPPIELLRQY D G +YD    + IT+ D+ L +A GPPGGGRN V+ R LRHF + S+ A S+ ++ +IF++++  +    DFP         IV A +E+Y +   +LLPTPAKSHY FNLRD S+ +QG L      + +K  + +LF HE  RVF+DRL++ +D+ + ++++  +  ++F E+ +     +KL       ++FGD+M P +E  ERLY  +        ++ SYL ++N      M LV F   ++H++RI+R+++Q  GNALLVGVGG+G+QS+TRLA FM     FQ E+ + Y  N +  DLK + +  G+  Q TVFL TD QI  E FLED++++LN+GEVP+LF  DE + ++      R  A+    S E +   +F F +NR R NLH+V+  SP+G +FR+R R FPSL+NCCTI+WF  WPEEAL  VA    E +++ + E + ++ L+C   HTS    SE+F +EL RH Y TPTSYLELI  +  +LT K+  ++  + R  NGL K+      +  M+ ELV L+P+LEQ + D   ++Q +  +  Q +     V+ +E  A  KA E QA+ ++ + DL EA+PALE A+ ALD L  +D+  ++   NPP  V+ VM +VC++              GQK    W  +K +LGD  FL+ L  Y KDNIP  ++ K++  Y+ +P+F    V K S A   L  W+ AM++Y +  K V PKK  L +A + L   M  L QK+AEL  VE+++A L+K  +    E+  L+  + L + +L+RA KL   L  EK RW+++         N+ GDV + A  +AY GAFT+ +R      W   C+   IP S+  +L   LGD  ++R WN  GLP D  S +N ++V+  RRWPLMIDPQ QAN+W++N E  N L +IKL++ +++RTLENCI+ G P LLE++GE LDP+LEP+LLKQ F + G   I LG+S IE+S DF+ YITTKL NPHY+PE+  KV+++NF +TP+GLEDQLLG V   ERPELEE+RN LI++   +K QL+  E++IL+ L  SEGNIL+ E  I  L+ +K+ S E +K+   AE TE KI  +R  Y P+A   S+++F +A++A IDPMYQ+SL +F  L+ N+I++S KS+ LE+R++ L+   T   Y NV R LFEKDKL+FSF+LC  ++     I   E+ F L G  G++   P  P   W+    W+ +   SD +P    L                           Y P    LP   S+E          +   L   +  +L+ FQK+I+ +    +KI   I+ ++   LG +FVEPPP DL   + D +   PLVFVLS G+DPM    +FA +K + G
Sbjct:  722 EQIKEFKEHIPMVSILCNPGIRARHWEQMSEIVNHDLTPNS-GTTLRKVLKQNLSAYMEHFETISAAASKEFSLEKALQNMVETWDIISFSHHAHRES-GVSILTAVDEIQTMLDDQIVKTQTMRGSPFIKPFEKEIKAWEERLIRIQDTIDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGQLFQTVDKHWREVMRHCVKDPKVLPATSLTGLLEKLQESNNLLEQIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLDF-------------LPNL----------DIQAMYSSEGERVELIQLISTSEARGAVEKWLVQVEDVMLSSIRDVINRSRLAYPETKRSQWVREWPGQVVLCTSQMYWTQEV----HEAIRSGVGGLKNYYNQLQSQLKDIVELVRGKLPKQTRTTLGALVTIDVHARDVVMEMIEKGVSHETDFQWLAQLRYYWNN--DNVRVCIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMKLEFFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPDENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPAADYQLFLDCAQECCKKHNVQ--PVKVFLDKMIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNERGYNDE----EKVQYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREYASAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWLPLVTSWLNTLPQPLQTQENSTLLLELFNWLIPPALRMLRKNCREVVSTTNSNTVVSLTRLFEMLLTEPVTEEPG--NKNIRTWIMAAFAFSLVWSIGGSCDRDSRERFDQFLREILSGKLEEHPIPAAVSKWECPFNDKGLVYDYSYEFKGKGCWIHWNESIKNVTLGDKNTKVQDIIVPTIDTI-FCTLFTTLIIFFSPFRPLLFVGPTGTGKSVYVKEKLMNNLNKERYLPFFINFSARTSANQSQNIIMARLDKRRKGVFGPPMGKKCIIFVDDMNMPAMEVFGAQPPIELLRQYFDHGNWYDLKDTSKITLVDVQLISAMGPPGGGRNAVTPRFLRHFNICSMNAFSDDTMSRIFSNVVAFYLRNNDFPNDCFSIGNQIVAATLEVYKKAMENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLENKRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVFEHLKLCEEDMRSLLFGDYMTPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDAQIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVMHAVRPIAQAGNKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVANKFLETLEMSDHE-RQEVMLICKTFHTSAIHLSEKFLSELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLEQAKIDNIKMVQVIEVESVQVEAKSKVVRVEEEAASQKAAEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLKVYDKDNIPAPVMHKIRSEYMTNPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCTKEWTKLCKSKNIPSSDDFSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERENNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNKSKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYAEFMFLLTGGVGLQNNVP-NPDPNWLQDKSWDEICRASD-LPGLQGL--------------------------RYPPFCHFLPIYDSKEP---------YNTPLPKPWCDKLSDFQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSYNDSNSTIPLVFVLSPGADPMASLLKFANDKNMGG 3331          

HSP 2 Score: 458.373 bits (1178), Expect = 2.200e-128
Identity = 252/596 (42.28%), Postives = 355/596 (59.56%), Query Frame = -3
Query:   72 QAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNE---MSPQFFETHV-LGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVED--YKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAK---PDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1829
            ++ISLGQGQGP+A KM+ +A K G WV LQNCHLA SWM  LE+I +  S  P   H +FRL+L+S P+  FP+++LQN VK+TNEPP GLR N+ +++       PQFF       LVW KL++G+CFFH+++ +RKKFGPLGWNI Y F++SD   +I  L +F      + ++A+TY+T E  YGGRVTD WD+R L  IL  F++ K I+E+  Y +S SG YY P      +Y +F+ +LP  + PE+FGMHEN ++S  +Q+T+ L ++++  Q   + GG     D  + ++A+ I  KL +  N + A    P L+         S+ TVL+QE++R+N L + I+ SL  L KAIKG VVM  ELE++  +    +VP  W+  +YPSLKPL +++ D   R      W     P  FWL GFFF Q FLTG +QNYARKY  PID LSF++                      EV+  D   +SP DGV VHGL++DG RWD ++G +       +   +PI+ + PK         ++  L  T ER G LSTTG STNFV+++ LPT +    WI  G A++C+
Sbjct: 3335 KSISLGQGQGPIAVKMIQSAMKEGTWVCLQNCHLAVSWMSTLEKICEDFS--PETCHPDFRLWLTSYPSPMFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPVSDPQFFSACSNKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNSYEEVPFEAITYLTGECNYGGRVTDDWDRRLLLTILADFYN-KDIIENPRYMFSPSGKYYSPPKSIYEDYVEFIRNLPATQHPEVFGMHENVDISKDLQQTKLLFDSLILTQGGGSKGGASSGGDSTLMDIANDIRTKLPENFNIDSALNKFPVLYE-------ESMNTVLVQEMERYNNLCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDWYDTTKPNVFWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSFDY----------------------EVLPFDTSATSPEDGVYVHGLFLDGARWDKKSGVLAEQHPKVLFDSVPIIWIKPK-----HCCTFLL-LSCTSERKGTLSTTGHSTNFVISIMLPTSKRPQHWIKRGVAMLCQ 3892          
BLAST of SMED30008756 vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1715.28 bits (4441), Expect = 0.000e+0
Identity = 1025/2706 (37.88%), Postives = 1564/2706 (57.80%), Query Frame = -2
Query: 1837 NEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPH-KDSKDV-FILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEF-DTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVR-ITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKY-----------IDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRN-----KFEDNGDCRMPSQ-----GDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDK-LNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSF-EHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQK-TDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELL-SGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIP-VFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYG 9864
             EW +  ++ LN + L   T  ++K + +L K +    V   L+ ++++ +E + ++ +L N  L++R          Y F     +L L              L++ S   S +      +K+V + W++ ++ V  + K +++  +ILG  DEIQQ  DD+ +N+ ++A SR +GP    + +W KNL L  + IE W+  QR W+YLESIF   DI+ QLP EAK F  +DK +K+IM    + P   R    P  L   +N +  L++ QK L  YL+SKR  FPRF+F+S+DELL IL  +  P  VQ H+ K +D I+ L F      +  +                    A++S EGE + L + + A G VE+W+  V   M    R + +++I  +     R +W+  +   +VL   Q+ W  E+  + + +     Q M  +  K  Q ++ L   +   L K  R  L  ++ ++VHARD+V   V++ ++D   FEW+ QLR+YWD   D+  VR  ++ ++YGYEY+G + RLVITPLTDR YL L  AL + LGGAPAGPAGTGKTE+TKDLAK+L   CVV NC +G+DY  +G+ FSGLAQ GAW CFDEFNRID  VLSVI+ Q+ TIRNA   ++ RF FEG+EI L      FITMNPGYAGRTELP+++KALFRP+ ++VPD + I E++L+SEGF  +K LA+KMT +YKL  EQLS+Q HYDFG+RALKSVLVMAG+LKR +PD  EDVVL+RALRD NLPKF+ +D  LF  ++ DLFPG++ P   Y  F   +E ++E +   + P+QV KV+Q YET+  RH  M+VGPTGGGK+ V N L +  + L   GL          KMY LNPK++++ ELYG ++ +T +W DG++  I R I      ++ ++++ DG VDALW+ENMN+V+DDNK+L LAN ERI+L  +  +LFEV DL  ASPATVSRCGMV+VDP+ L + P+ + W+NS   K + +    L  +FEKY           I DG +  + K I  + Q  +  +  +  +L++LL     P  ++ +++L     I  ++C L   G  L E+    FD+ V+        +D      P +       L+  + D  ++K   W  +V  +  N +  F +++VPTVDT R  +LLE+++ VK+ V+  G +G  K+   +  LNN++ +   V + INFS++T+S   Q  +E  +EK+ K   G P  K +++F+DDLNMP++D YG+Q PI LL+   D GG YDR K LN   ++D+   AA G  GGGRN V +R +  F++F+IP P E +L  I++SIL G    F + +R   + +    +E+Y  +  DL PTP+K HY+FNLRDLS+   G+   +      ++   +++ +E  RVF+DRLIN  DK      +  +  ++FG   E +S ++ PI+FGD+     E   R+YE + D+   K +    L+++N   ++ M LV F DA+DH+ R+ R+IR DRG+ALLVGVGG+GKQSLT+LAAF  G + F+I L RGY  + F  DLK +Y   GI N+ TVFLFTD  +  E FLE INN+L SG VP+LF  DE E ++   R  A + G S  +++ ++++ IN+  +NLHIVL MSPVG   R+RCR FP LVN   IDWF  WP +AL  VA+S   E   I     +  +  +C  +H SV + S  F  +L+R  Y TP +YL+ I+ Y ++L +K + ++ +  R++ GL K+ E +  +A +  +L   +  L +K    E+L+Q++ T+   A+  +   +E     + + K       DA+  L EA+PALE A  AL  LDK+D+ EIR F  PP+ VQ V E + ++ G K  +W +AK ++ +  FL+ L +   D+I    +K ++ ++ + N ++E ++ +SKA   ++ +V A+  Y    + ++PK++++    K   +   +L + Q+EL A++ ++  L + Y  ++ EK+ L+    L   RL  A KL + L  E +RWTE + +  ++   ++GD  + AA ++Y GAF   +R+E++   W     E  IP+S+   +  +L D  E+ +W SE LP D++S +N IL TR  R+P+ IDPQ+QA  WI+ KE  N LKI   ++ +FL+ LE  I+ G P L +D+ E +DP ++ +L K      GR +I LGD +++Y  +FKLY+ TKL+NP Y P +  K  +IN+TVT +GLEDQLL  +   ER ELEEQR  LI   + +K  L+  E+ +L+ L  S GN+LD+ +L++TL E+K  + E  +++  AE T   I   R  Y P A RG++++FV+A MA ++ MYQ+SL  F  +F+ ++  S  +  L +R+  ++   T+  YN    GLFE+ KL+FSF + I+I +  G     E EFFL+G   +EK + +KP D W+    W ++V ++++ P  F  LI DI                  E+N           +E      LDS         Y   L  FQKL+L++ F  +++   ++++V   +G ++V+PP      +F+  +  SP+VF+LS G +P N   + A E+  +G
Sbjct: 1178 TEWSQTLWVNLNIQLLQEGTEGFIKSLRKLPKDVRAMPVAFFLEGRMKEFKESLPLLLDLKNEALRDR----------YLFLHCY-RLYL--------------LKDWSLIGSPQG-----VKEVVDTWEVMKFSVQRYFKGTQERGYILGSVDEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILGSS-EPACVQEHMIKMYDNIASLRFDSGTNGETVAG-------------------ALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLDYQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRL---GLL--------TKMYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQAD----LRKLFEKYVPSIIEMVVEGITDGKQGEKLKTI--VPQTDLNMVVQLSMMLDALL----EPE-DLSSEELE-CFFIEALYCSL---GAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGYLPTLFDFHFDGTTKKWMPWSSLVAKYIHNPDTKFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMV-LTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGHTRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGS--ELDSAMRDPILFGDYRTALSESEPRVYEDIQDYDACKALFQEILEEYNENKTR-MNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMG-SGHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAHSETVIGHVCM-VHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRGHKEINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKSKRKKPCD-WLPDQGWEDIVRLNELFPNEFGALIEDI------------------EKN----------PKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLA-ERSGFG 3771          

HSP 2 Score: 299.286 bits (765), Expect = 4.161e-80
Identity = 185/612 (30.23%), Postives = 309/612 (50.49%), Query Frame = -3
Query:   81 RVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLV------WRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECA--ILNLGMFCA----DGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTT--------------FFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYI-SPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAAL 1835
            R++ +++GQGQ  VA ++++ A   G W+ LQNCHL   W+  LE+ ++ R   P   H +FRL+L++ P + FPI +LQ S+KV  EPP GL+ N       M   +F+  +  L+      +R L++ + FFH+++ +R+K+G +GWN+ Y+F++SD      ILN  +  A    +G I W +L Y+  E+ YGGR  D +D+R L   +                FFH K +  DY+        PP+  +   Y + ++SLPL   PE+FG+H NA + +  Q  + +   ++++QP+    G G + D+ + ++A  I  KL    + +  +  L  PD    ++  + VL+QE++RFN+L+  +  SL +L++A+ G V MS EL+ V  A  N Q+P +W  +A  +LK L  W+     R      W+  G P   WL G   P+ +LT  +Q   R+  +P+D  +  +     YR+++EV ++                  P  G  V GLY++G  WD E G ++ S   E++  LPI+ ++P   +       + +P+Y T  R        M    V    L T +  + W+  G  L
Sbjct: 3774 RLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALE-RITKP---HPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLN-------MRATYFKIQLETLMSCPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQPFHFFHNKDV--DYRI-------PPD-GSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPSAFDLDVIRKKL-GPD----VSPTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTL-YTHVTHYRSEDEVTEK------------------PGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLRLQNTLRTPVYTTSMR-----RNAMGVGLVFEADLFTTEHHSHWVLQGVCL 4335          
BLAST of SMED30008756 vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1639.78 bits (4245), Expect = 0.000e+0
Identity = 1049/3136 (33.45%), Postives = 1656/3136 (52.81%), Query Frame = -2
Query: 1807 IPPLFITEFVLSVQNLLFLPDRE-RFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVE-----LRQFY--------EKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPI----GMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKE-SQDAEYTLCNEPTNTV-----DY---VNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKAL----------ADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIF-SAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNW-DSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA--DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLG------QKTDWASAKSVLGD-PYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSG-WIGRCRELE--IPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPH--DP--WISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSR 11049
            + PLF  +  L V +L+F P  E    +G  ++++   N V  + +LVP     S + P      E+    +   M  +  E   +H ++ Q  +      NA ++YA  +V+     +RQF         E+ E+   + +      +E FRE    Y R   M + + + +P+    G + VDA   K  +L       ++I +   +  +  +D +    S+  E+  C E    +     DY   V  +  L  ++ R    +   + ++   DL+  +    P     VY+ L    ++  N   +A+          A    N+ + CA+ D +  + R   +      N P   D+  N +E+ +   K    M  +  +          F+V     + L++   E+ + + LWD +         W    + ++N E++  +  ++ K +  L+K          L   V+     +  I  L NP ++ RHWQQ+      +FS  +E  TL  L+ LN+  +++E+  I  +A  E  +E +L +++  W   E+    H  +  V +L   +++ +  +D+ + +  + SS+HV      V  W K L +    I  W   QR W +LESIF  + DI+ QLP ++K F  +D  +KE+     K P  + AT  PGL    ++    L   +K L  YL++KR+ FPRFYF+S+ +LL+IL+   +P  VQ HL K FD  +K+ F   ET     +DG P          +   + M S E E V   +     G VE WL +V + M   +R  + +++  ++   RE+WL  +  Q+ LT  Q+ W  ++      + E     M ++  K    LN L  ++ G L    R  +  + T++VHARD+V +++ +KV +   F W  QLR+ WD    +C   + ++ + Y YEYLG +PRLVITPLTDRCY+ L  +L L + GAPAGPAGTGKTETTKDL ++L     VFNCS+ +DYK  G  + GLAQ+GAW CFDEFNRI +EVLSV+A Q+ +I++A   K  RF F G EI L  +   FITMNPGYAGRTELP+NLKALFRP AM+VPD+ LI E++L +EGF  ++ LA+K   +Y+LC E LS+QDHYD+G+RA+KSVLV+AG LKR +P++PED VL+RALRD N+PK +  D  +F  ++ DLFP +++P      F+  +   + +  LQ   + VLKV+Q  E LAVRH V +VG  G GK+ V   L K   N+      + RP +       LNPK++T  EL+G +N  T EW DGL   I+R     +    +W++ DG +D +WIE++NTV+DDNK+L LA++ERI L P + ++FE+  L  A+PATVSR G++Y++  +LGW P V +W++    +++ E  + L  +F+KY+   L   +++  + +     + +Q +C LLE LL     P    D  K      + FVF  +W  GG L +    D    F +    +    + PSQG ++  Y D  ++K + W K+VP F+ + E+P    +V T +TIR  Y +E+LL  ++ ++  G  G GKSV+  G L ++  +  Y    + F+  T+S   Q ++E  LEKK     G P +KR+I FIDD+NMP++D YG+  P  L+RQ+ D+  +YDR KL    I  +    +C  P  G   ++ RL RHF++F++  P   +L  I+ SIL    +   F   V+     +V  A++ + R+    LPT  K HY+FNLRDLS   QG+L C   C++    + K++ HE+ RV+ D+++  +D   F ++ +EM  K++ +  E     K+  ++  F    L   E  Y P+  +  +   L   LD +N  ++  M LV F DA+ HI RI R++   RGNALLVGVGG+GKQSLTRLAAF++    FQI L +GY      +DL  +    G+ N  TVFL TD Q+  E+FL  +N++L SGE+P L+  DE E +I   R   +  G+ + +R+  ++F I RVR  L + LC SPVGS  R R R FP++VNC  IDWF  WP+EAL +V+    + V+  E E+K  ++     +H SV K S+ + A  +R+ YTTP S+LE I LY ++L  K+K L  + +R++NGL K+  T+  +  ++ +L A    L+QK +D + L+Q +G + E+    +    E+E      A        D + DL +A PAL  A +AL+ L+KN++ E++ F +P   V  V  +V +L+       +   W +AK ++     FL  L ++ K+NI E  LK ++ Y+ DP F  E V   S A   L  WV  +  + +    VEPK++ L  AN EL     KL   +A++  +   +A+L   ++ +  +K   +     T+  +  A +L   LA E  RW E+V+ F ++   + GDV +  A V+Y G FT  YRHEL+   W     +L+  IPV+  +  + +L D  ++  W +EGLP D++STENA ++T   RWPLM+DPQ Q  +WI+NK   N L++I++ +  +L ++E  +  G   L+E++ E +DP L P+L ++T +K GR  I +GD + EY+  F+L + TKL+NPHY PE+  + T++NFTVT  GLEDQLL  V  +ERP+LEE ++NL  + N  K  L+  E+ +L  L  + GN L   +L+  L  +K T+AE  +++ EA++TE KI  AR  Y P A R S++YF++ ++ +I PMYQFSLK F  +F   +  +   + L++R+  L+   T + +    RGLFE DKL ++  L  QI+  N  I+  E +F LR         P +P    P  ++S + W  +  +   +  F NL  DI                      S +        E  +K +   E+             S QKL +++    +++   I +FV+  LG+++V     D  + F++    +P+ F+LS G DP+   ++       +G++  Y F ++
Sbjct:  755 LAPLFEAQLDLQVHDLVFHPSLEFGASDGFYDLVESLINDVYRISSLVPRLAEHS-SFPHYQADMED--MADLADMRQLLME--RVHRVMAQCCEH----RNAFERYAYLYVDDRKEFMRQFLLYGHVLTTEEIEAHADEGVPEDPPTLERFREQVDSYER---MYEEVQKLEPVHVFEGWMRVDARAFKSALL-------NIIKKWSLMFKQHLIDHVTNSLSELEEFIKCTEGGLGIKVEEGDYAGLVKVMGHLMAVKERQGATDEMFEPLQHTIDLLKTYEQELPD---VVYKQLEELPEKWINMKKQAVVVKQHVAPLQASEVANLRRKCATFDVEQFKFREHFRK-----NGPFRFDI-VNPYEMLDTTHKQIQEMESIMAKLIESAGL---FEVNIPDYKQLKQCRKEVSILKELWDVVSVVRFNLEAWRTTPWREINVEEMELECKRFSKELRLLDKEARAWDAFCGLDSTVKNTLTSLRAIAELQNPAIRPRHWQQLMTATGVRFS-MDEDTTLTDLLNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTS-VPLLKSDEDLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKF---ET----DADGKP----------SKTGIGMFSKEEEYVPFNEPCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYEDKPREQWLFDYPAQVALTCTQIWWTSDVGLAFSRLEEGYENAMKEYYKKQVSQLNTLITMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFMGEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQVLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLKSLNKTYQNM------KRRPVWAD-----LNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWIDKR--EIQSEKAN-LTILFDKYLPACLDTLRSRFKKIIPIPEQSMVQMLCHLLECLLTPEHTPP---DCHK--ELYELYFVFAAIWAFGGALFQDQLVDYRVEFSKWWVTEFKTIKFPSQGTVFDYYIDPETKKFEPWSKMVPRFEMDPEIPLQACLVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSVLVGGKLGSLDPDK-YTIKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKLQLKEIHSVQY-VSCMNPTSGSFTINPRLQRHFSVFALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKDFSTFDKLQSEMVGKFYEDMEEALEEAKVMNMYCHF---ALGIGEPRYMPVQSWESLNKTLLEALDSYNEVNAA-MNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQGLLD-SRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIEPEVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMAPGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKNKYGDN-LQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQET-IKKGR-YIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLR--------YPVQPGVTSPVDFLSHHSWGGIKALCS-MDEFRNLDRDI--------------------ESSAKRWKKFVECECPEKEKFPQEWKNK---------TSLQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEK-------HGRTMGYTFDNQ 3766          

HSP 2 Score: 332.798 bits (852), Expect = 2.988e-90
Identity = 199/595 (33.45%), Postives = 315/595 (52.94%), Query Frame = -3
Query:   72 ISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKT-----FPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFC-ADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTT--DDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQ-GAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPP-DGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMP-KMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1823
            +SLGQGQ  VAE+ +D AA+ G WV LQN HL A W+  LE+ +++  E      +NFR+F+S+ P+ +      P  +L+NS+K+TNEPP G+ AN+ +A +  +    E       ++ ++F +C+FH+++ +R+KFGP GWN  Y F+  D   ++  L  +  A+  + +D L Y+  EI YGG +TD WD+R  R  L  F  P+ ++E   Y   G   P   +  N Y  ++D     E P ++G+H NA + F  Q ++KL  T+L++QPR A  G G  T  D+ V  + ++ LEKL ++ N  E    +   +E+   +    V +QE +R N L   IK SL +L   +KG + M+ ++E++  A   +QVP+ W+  AYPS+  L+ W  DL  R      W      P + WL GFF PQ FLT  +Q+ AR+ ++P+D +S           Q +VLK+ +E             SSPP +G  VHGL+M+G RWD + G I+ +   E+   +P++ +    +D +     Y  P+YKT +R            +V    L T +  + W   G AL+ +
Sbjct: 3771 VSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLEQHGEGS---SQNFRVFISAEPSSSPEGHIIPQGILENSIKITNEPPLGMHANLHKALDNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPE-MMEGELYLAPGFPLPGNMD-YNGYHQYIDDALPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDAGSGEGSGTSRDEKVKAVLEETLEKLPEEFNMVELMGKV---EER---SPYVVVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKRAYPSMCGLALWFTDLLNRIRELESWSSDFNLPPAVWLAGFFNPQSFLTAIMQSTARRNEWPLDKMSL----------QCDVLKKNRE-----------DFSSPPREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKAVPVDKQETRNVYQCPVYKTRQRG---------PTYVWTFNLKTKENPSKWTLAGVALLLQ 4324          
BLAST of SMED30008756 vs. Ensembl Cavefish
Match: dnah9l (dynein, axonemal, heavy polypeptide 9 like [Source:ZFIN;Acc:ZDB-GENE-050506-1])

HSP 1 Score: 1439.48 bits (3725), Expect = 0.000e+0
Identity = 887/2493 (35.58%), Postives = 1379/2493 (55.31%), Query Frame = -2
Query: 1852 IEEWLNCQRNWLYLESIFS-APDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKC-IQTMAQV-SIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNW-DSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFF--ADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLG------QKTDWASAKSVLGD-PYFLKKLADYPKDNIPEALLKKLK-RYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSG-WIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQI-MRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKE 9282
            I  WL  QR W +L+SIF+ + DI+ QL  +A+ F                            ++  F      L   +K L  YLE+KR+ FPRFYF+S  +LLEI+++   P  V  HL K FD ++ L F   E  + E                T   + M S EGE V   +     G  E WLG +E AM   +R  + ++++ ++   R++WL  +  Q+ LT  Q+ W  ++    E V E     + D+  K    LN L  ++ G L    R  +  L T++VHARD+V +++ +KV +   F W  QLR+ WD    +C V + ++ + + YEYLG + RLVITPLTDRCY+ L  +L L + GAP+GPAGTGKTETTKDL +SL     VFNCS+ +DYK +G  + GLAQ+G W CFDEFNRI +EVLSV+A Q+ TI++A   K  RF F G EI+L  T   FIT+NPGYAGRTELP+NLKALFRP AM++PD+ LI E++L +EGF  ++ LA+K   +Y LC E LS+QDHYD+G+RA+KSVLV+AG LKRE+ + PE+ VL+RALRD NLPK +  D  +F  ++ DLFP +++P     + +  +   +    LQ   + +LKV Q  E LAVRH V +VG  G GK+ +   L K  SN+            +PV   I NPK++T  EL+G ++  T EW DGL    +R     +    +W++ DG +D +WIE++NTV+DDNK+L LA++ERI LT  + +LFE+  L  A+PATVSR G++YV+P++LGW  +V +W++  T K + E  + L  +F+KY+   L+  Q +C ++T+  +   + +QT+C LL+ LL     P     A        I FVF  +W  GG L + +  D    F R   ++    + PSQG ++  Y D +++K   W +  P F+   +VP   ++V + +TI   Y +E LL   + V+  G  GVGK+++   T++   E      V  N+   TS+   ++  E  LEKK       P  K++I F+DDLNMP++DTYG+  P  L+RQ+ D+  +YDR +L    I +      C  P  G   V+ RL RHF++F++  P   +L  I++SIL+G F    +   V      +V AA+ ++ +M  + LPT  + HY+FNLRD+S   QGIL   P  VR    +  L+ HE  RV+ D+L+  +D   F++I+ +   +YF E I+   FI  P+I+  F     E     Y  ++D+ K++  L   L+ +N   +  M LV F +A+ HI RI+R++    GNALL+GVGG+GKQSL RLAAF++    FQI L +GY  +   +D+  +Y   G+ N  TVFL TD QI  E FL  IN++L SG++P LF  +E + MI+               R+  + F I+R+R  L +VLC SPVG + R+R R FP+LVNC  IDWF  WP+ AL +V+++   ++   E  +K+ ++   +  HTSV + S ++    K   YTTP S+LE + LY ++L  K+++L  + +R++NGL K+L T   +  ++ +L     +L Q+  DTEAL+ K+G   ++ +  +    E+E        E      +++ DL +A PAL+ A  AL+ L++ ++ E+R F NPP +V  V+ +V +L+       +   W +AK ++     FL+ L ++ K++IP+A ++ L+  Y+ DP+F  E V   S A   L  WV  +  + +    VE K+  L  AN +L E   KL   + +L  ++N +  L   ++ + +EK   +  +  T+  ++ A +L   L          +S++ E+   + GDV + AA ++Y G+F+  YR ELL   W+   R  ++ +   +  + +L D   + +WN+EGLP D++ST+NA ++    RWPL+IDPQ Q  +W++++   + L++I L +  ++  +E  +  G P L+E++ ET+DP ++P+L + T +K GR  I +GD +  Y+ +F+L + TKL+NPHY PEI  + T+INFTVT  GLEDQLL E  ++    L +Q+N   I       +L+  E+ +L  L  +E N L    L+  L  +K T+AE   ++ EA++ E KI  AR  Y PVA R S++YF++ ++ +I+PMYQFSLK F  +F   ++N++   D+  R+  L+   T +T+N + RGLFE+DKL F+  L  Q+ +  +  I+  E +F LR    I+      P D ++S + W+ +  +S     F  L  DI                      S +    V   E  +K +L  E+            +S QKLIL++    +++   +  FV+  LG ++ E    +    F++    SP+ F+LS G DP+   +   K+
Sbjct:    7 IGTWLAVQRTWAHLQSIFTNSEDIRNQLAQDAERFQDT------------------------VIICLFSICTLRLSVCEKALAEYLETKRLTFPRFYFVSAADLLEIVSKGTQPRQVTRHLLKLFDNLADLKFRDEEEQEDEGR--------------TEVAVGMYSREGEYVPFSEPCVCEGQAECWLGGLELAMRSTVRHEISEAVSAYEDKPRDQWLLDYPAQVALTGSQIWWATDVGIAFERVEEGFETALKDYNKKQVSQLNSLINMLLGELTPGDRQKIMTLCTIDVHARDVVAKLISQKVMNGQAFAWLSQLRHRWDEQQKHCYVNICDAQFQFSYEYLGNTNRLVITPLTDRCYITLTQSLHLTMSGAPSGPAGTGKTETTKDLGRSLGIMVYVFNCSEQMDYKSIGNIYKGLAQTGVWGCFDEFNRISVEVLSVVAVQVKTIQDAVRNKKHRFHFLGEEIELRPTVGIFITLNPGYAGRTELPENLKALFRPCAMVIPDFELICEIMLVAEGFIDARLLARKFISLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKREDRNHPEEQVLMRALRDFNLPKIVTSDVPIFLGLISDLFPLLDVPRKRDLQLEQHVRQAVTELRLQPEENFILKVTQLEELLAVRHSVFVVGGPGTGKSQILKTLHKTYSNMK----------LKPVWTDI-NPKAVTTDELFGFLHPATREWKDGLFSSTMRELSALSHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERISLTSSMRLLFEISHLKAATPATVSRAGILYVNPQDLGWSSYVTSWID--TRKAQSERAN-LTILFDKYVPYCLE--QVRCNLKTITPIPETSMVQTLCCLLDCLLTDENTP-----ADSPRELYEIYFVFACVWAFGGALFQDHLIDYRAEFSRWWCKEMRAVKFPSQGTVFDYYIDPNTKKFTPWSERTPPFELEPDVPMQMVLVHSAETISLAYFMELLLEKGKPVMLVGNAGVGKTILVWDTISKRKEEYMVAKVPFNYYT-TSAMLQRKCGEKSLEKKAGRNFAPPGTKKLIYFVDDLNMPEVDTYGTVQPHTLIRQHLDYSHWYDRQRLVLKEIHNCQY-ITCMNPTAGSFSVNPRLQRHFSVFAVHFPGAEALSTIYSSILSGHFLQGGYSYGVSRSVGTLVQAAICLHQKMTQNFLPTAIRFHYIFNLRDISNIFQGILFAQPESVRYPIDLVYLWLHECSRVYSDKLMEEKDVELFNKILLDTGKRYF-EGIDESIFIHQPLIYSHFAHGVGEPR---YAQVSDWEKLQKTLTEALEHYNELHAN-MNLVLFEEAMQHICRISRILEAPVGNALLIGVGGSGKQSLCRLAAFLSMLEVFQITLRKGYGISDLRSDIAALYIKVGVKNIGTVFLHTDAQIPDERFLVLINDMLASGDIPDLFSEEEVD-MIVASIRLELRGLGLLDTRENCWNFFIDRIRKQLKVVLCFSPVGFTLRTRARKFPALVNCTAIDWFHPWPQHALQSVSRTFINNISGLEPAVKLSISDFISFAHTSVNEVSVKYQQNEKHFNYTTPKSFLEFMKLYGNLLGAKQRELTQKMERLENGLQKLLSTASQVEDLKAKLALQEVELHQRNTDTEALIAKIGQQTDKLNQEKSVADEEEQKVAAIQAEVTKQQQESEDDLAKAEPALQAANAALNTLNRLNLTELRTFANPPVIVANVLAAVLVLMAPGGRIPKDRSWKTAKVIMSKVDDFLQALVNFDKEHIPDATVRVLREEYLSDPDFNPEFVRLKSSAAAGLCAWVINIIHFHEVTCEVEMKRMCLSQANADLIEAAEKLEVIRKKLSELDNSLDTLTAAFEKATSEKLRCQDEVNRTNKTIQLANRLVKGLE-------VRLSQYREQEATLCGDVLLTAAFISYAGSFSKRYRLELLHKLWMPYLRTQKVCLC-GLDPISMLTDDATVAKWNNEGLPGDKMSTQNATILLNCERWPLLIDPQLQGIKWLKSRYG-SSLRVINLGQKGYVDVIEQAVVTGEPVLIENLEETIDPVIDPLLGRHT-IKKGR-FIKVGDKECTYNPNFRLILHTKLANPHYKPEIQAQTTLINFTVTRDGLEDQLLAEHLKV---CLTKQQNTFKI-------ELKQLEDELLTRLSAAESNFLGDNMLVEKLETTKHTAAEIEMKVLEAKVNEVKINEAREHYRPVAVRASLLYFIINDLNKINPMYQFSLKAFNVVFRKAVQNAELCVDVNTRVNTLIDCITFSTFNYINRGLFERDKLTFTSQLAFQVLLLMSKEINVRELDFLLR--FSIDHSYI-SPVD-FLSNSSWSAIKTMS-FTDEFRGLDRDI--------------------EGSPKRWKKVVESECPEKEKLPQEWKSK---------SSLQKLILMRALRPDRMTYAVRNFVEEKLGVQYTEGRKMEFARSFKESGPASPVFFILSPGVDPLKDVESLGKK 2377          

HSP 2 Score: 314.309 bits (804), Expect = 9.472e-85
Identity = 186/598 (31.10%), Postives = 303/598 (50.67%), Query Frame = -3
Query:   78 RVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKT-----FPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFC-ADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTG--RTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQ-GAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPP-DGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHM--MPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALI 1835
            ++  +SLGQGQ  VAE  M+ A++ G WV LQN HL A W+  LE+++++  EN    H ++R+F+S+ P+ T      P  +L+NS+K+TNEPP G+ AN+  A +       +       ++ ++F +C+FH+ + +R+KFGP GWN +Y F+  D   ++  L  +  A+  + W+ L Y+  EI YGG +TD WD+R  R  L  +  P     D K + +  +  P       Y +++D +   E P  +G+H NA + F    +  L +T+L++Q R +  G G  ++T++ V  + D ILEKL ++ N  +         +         V  QE +R N L++ I+ SL +L   +KG + +S E+E + TA   + V + W+ +AYPS   L+ W  D+ +RC     W      P   WL G F PQ FLT  +Q+ ARK ++P+D ++    V K ++ +                      + P  DG  V+GLYM+G RWD +NG I  +   E+   +P++ +  +P  D +     Y  P+YKT+ RA            V    L T +    W+  G AL+
Sbjct: 2386 KLHNVSLGQGQEAVAELAMEKASEEGHWVILQNIHLVAKWLGSLEKLLERCCENS---HPDYRVFMSAEPSPTPQEHIIPQGILENSIKITNEPPTGMLANVHAALDNFDQDILDQCSREQEFKTILFSLCYFHACVAERRKFGPQGWNRKYPFNTGDLTISVSVLYNYLEANSQVPWEDLRYLFGEIMYGGHITDDWDRRLCRTYLEEYMQPNQF--DRKLALAPGFIVPSNLDYQGYHNYIDEMLPHESPVHYGLHPNAEIEFLTVTSDNLFHTLLELQSRDSLLGEGAPQSTEEKVKTVLDDILEKLPEEYNMSDIT------SKTAERTPYILVCFQECERMNMLINEIRRSLKELDLGLKGELAISSEMEQIQTALFFDNVADSWTRLAYPSTYSLAQWYNDVLLRCRELDSWTQDLSLPSVIWLSGLFNPQSFLTAVMQSLARKNEWPLDKMTLTVDVTKKFKEE---------------------FNQPARDGAYVYGLYMEGARWDIQNGTITEARLKELTPSMPVIAVRAVPN-DRQETRNIYECPVYKTKLRAN---------THVWTFNLKTRERPAKWVLAGVALL 2941          
BLAST of SMED30008756 vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 4373.16 bits (11341), Expect = 0.000e+0
Identity = 2143/3442 (62.26%), Postives = 2647/3442 (76.90%), Query Frame = -2
Query: 1786 IISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQS-YDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWL-KAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDM-----TLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 12090
            I  ++RE  E+ ++Y+     +    Y  +NLKVV+Y  + K+++  +S  G      GD +D   LDR+E EY  + ++  IPTF+ FR WKAF  WRK ++  K + C + L  +LFI+N+SLRPALLNV++MCHR+ +M LC +E GRTYTL +FM  Q+  L EV   L+EFREL +EV+RSACRT+LLE GF PDDYF D   + +  E     GSS + QS YD+D + +AP+KM+YTEQANKR HC +LT FIRLADY+IVNT+H+LAVN+V TLLN ++ QL+KTP+ E I  +                  P E    EPI +   E +   EE + V   PLF+TEF+L  ++L+F P +  FQ+G++ VI  F++TVLSV NLV D YFD+FT+P+IN K EEK+CGEGPS+  +F +D HLH +I    + I  AFNA   YA TF + R FY++NES DL+A++  ++DV FF E+ ++YH + +    I E++ +GM+LVDATK+K+ ++PSP RC + IN++LPV++RK+ DA+I E++D ++ L   P+ T ++VN+L FL EIQ R++ LE E  ++ +MY LI+ F VPTPPED  VY TL  SI   +N IDKA+ +RDGN++KFC  LDKDI EL  EVK ++Q   +P+ILD+ ++K +V+E L++     +E Q +A  Y++YQKNFKVE    + L EV  ELK KQ++WDSLDEW+    EWL  +F  L+PE L ++ AKY KIV QLEKGLPPN VVP+LK KVE +REK+ V+  L NP L+ RHW+ +E+II     + E  LTL  LIEL VF Y E+++++SGQAS EASLE++LKKVE+ W+  E+VVLPH+DSKDVFIL GTDEIQ L DDS IN++TI SSR+VGPIK RVDEW + L LF +T+EEW+ CQRNWLYLESIFSAPDIQRQLP+EAK FM VDKS+K+IMRK+ ++P A+RA T PGLLDTFKNNN LL+QIQKCLEAYLESKRV+FPRFYFLSNDELLEILAQTRNP AVQPHLRKCFDAI++L+FA+A       ++G       QE  +TNDILAM+SPEGEKVSLGKGLKARGNVE+WLGKVEEAMF +LR+L + +I E+ ++ R EW+     +Q+VLTV Q+MWCR++T  LE    + LQ + +FE + F+ LN LA LVRG LPK+ R  + ALITV+VHARD+VT+MV+EKV   N FEWQ+QLRYYWD  LDNCV RM+ S Y YGYEYLG  PRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LA QCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAK+ RFMFEGREIKL+ TCAAFITMNPGYAGRTELPDNLKALFRPIAMMVP+Y LIAEVILYSEGFESS+ LA+KMTQMYKLCSEQLSQQDHYDFGMRA+KSVLVMAG LKRENP   EDVVLIRALRDSNLPKFL  DA LF  IL DLFPGVE+P HDYG  +  IE  ++   LQ  PS V KVIQ YET+ VRHGVMLVGPTGGGKTTVY  L+  L +L+ AG ++  P YQ V   +LNPKSI+MGELYGEVN LTLEW DGLM   VR+   D S+DH+W++CDGPVDALWIEN+NTVLDDNKMLCLANSERIKLTP +HM+FEVQDL VASPATVSRCGMVY+D EEL WMP+V+TW+N +  K   +   Y+  +FE Y++DGL+F   KC Q M QV I+K+ T+  LLESLL+G G P+L ++  +L   +   FVFCYLW +GGNL E+ WD FD FV+++FE+N D ++PS GDLWS Y D  S+++D WE+IVP F++NKEVPFFEM+VPT DT+RFGYL+EKLL VK SVLFTG TGVGKSVVARG L+ I E A YVP++INFSAQTSS RTQE+IE+KLEKKRK ++GAP  KRVIIF+DDLNMPKLD YGSQPPIELLRQYQDFGGFYDR+K+ W  IQD       +   C PPGGGRNPV+ R +RHF+M  +P+PSE SL+QIF +ILTGF  DFP  V+    NIV AAVE+Y RM T+LLPTPAKSHY+FNLRDLSKC+QGILQCD   VRD++ +F+LFCHE QRVFHDRLIN+EDK +F+ ++AEMASK FG  +E E F+K PI+FGDFMK G+++ +R+YE LTD  K+K +L  YLDD+N++S+KEMKLVFF DAI+H+ RI RMIRQ+RGNALLVGVGGTGKQSLTRLA  M GY CFQIEL RGY Y+ FH DL+K+Y   G+ ++ TVFLFTDTQIV+EEFLEDINNILNSGEVP+LFE DE E+++   R  AKEAG+ EGNRD + +F INRVR  LHIVLCMSPVG +FR+RCRMFPS+VNCCTIDWF  WP EALL+V+K+ F  VD+G DELK  L+ MC EIH SV + +E +YAEL+R YYTTPTSYLELI LYLSML EK+ QL   RDR+KNGLTK+LETNEL+  +++EL AL P L+QK +D EALM+KL TDQE AD VR  V EDEAVAKVKA+ETQA+A DAQRDLDEA+PAL+ A +ALD+LD++DI+E+RVFTNPP+ V+TVME++C++L +K DWASAK +LGD  FLK+L DY K+NI E +++KLK YI++ +F  E VE+VSKAC+S+ +WVRAMD+YS+ +K V PK++RL  A  ELD  M  L  KQ  L  VE++I  LQ  +D SV EK++L  N+ALT AR+ RAGKLT+AL DE+ RW ESV++F  E+ NV+G+VF+ +ACVAYYGAFTS YR  L+  WI RC+EL IP++ + +L+G+LGD FE+RQWN++GLPRD VSTEN ILVTRGRRWPLMIDPQ+QANRWIRNKE  N LKIIKL++GNFLRTLEN IRLGMP LLE++ ETLDPALEPILLKQTFV  GR LI LGDSD++Y K+F+ Y+TTK++NPHY+PE+CIKVTIINFTVT  GLEDQLL +V RLE+PELEEQRN LI+RIN DKNQL++ E+RILKLLF SEGNILD+E+LI TL ESKVTS     R+ EAE TE+ I  AR KY PVA RGSVMYFV+A+++EIDPMYQ+SLKYFK LFN TIE S+K  DL ER+++LL +T +ATY N++RGLFE+ KL+FSFMLCI+I+RQ+G +SD EW  FLRG  G++K+RP KP   W++ + WN   D+ D +P F  L  +I  + I VT+G L I +N E  +     P   +EE  +           + GH++ RL+ FQKL+LVK+F EEK+V  +T+FV  NLG  F+E PP DL  L+QDMS  +PLVFVLSTGSDPM  FQRFA+E     +  +   G   G    K
Sbjct:  143 IAHVIRENKELGYVYVVPAAPRSSIKYDAFNLKVVTYEKINKDNYLTISEQGVLLTRDGD-VDFTPLDRWEEEYRYHRRLLSIPTFSHFRKWKAFSVWRKNVRSKKINACRRALEENLFIVNASLRPALLNVKDMCHRVGNMRLCMIESGRTYTLEEFMITQVDHLKEVLVHLSEFRELAKEVVRSACRTALLEAGFTPDDYFNDPELSGD--EKAETGGSSILFQSQYDLDPFGDAPEKMSYTEQANKRKHCGKLTCFIRLADYVIVNTLHILAVNTVSTLLNQLTKQLQKTPSKELIEAWA---------------CEPRE----EPITKK--EAVIAQEETEQVF--PLFLTEFMLEPESLMFAPSQNEFQDGLSVVIDSFKDTVLSVDNLVTDIYFDAFTQPIINKKHEEKSCGEGPSLETIFQDDKHLHKIIGGVQEVIRTAFNAAGLYADTFEQFRLFYKENESLDLEALKNKEHDVAFFEESLAKYHEQHKDAVAIKERRDLGMLLVDATKLKKKLIPSPLRCQNAINDLLPVLSRKKTDAIISEARDGQFKLEIVPSTTFEFVNSLTFLDEIQDRIQVLEEEMQIVVQMYQLIEQFKVPTPPEDLVVYSTLEQSIISVQNTIDKAVGERDGNLEKFCQHLDKDILELNMEVKIVKQRAQDPMILDITSDKTKVREILKEQMIATDEFQQQALQYRAYQKNFKVEVTNFDALNEVCDELKRKQMMWDSLDEWEVFTKEWLECQFETLDPEQLNSEVAKYAKIVNQLEKGLPPNNVVPLLKKKVEFIREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDKETPLTLAGLIELEVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPHRDSKDVFILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALA------PAEG------EQERTFTNDILAMVSPEGEKVSLGKGLKARGNVEDWLGKVEEAMFQSLRRLTKMAIGEYQSMPRTEWVVSGLPSQVVLTVAQLMWCRDLTQCLEGGDHDHLQSVANFEKENFERLNSLACLVRGNLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLELDNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKLIQTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPHLREDVVLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSIENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTVLNPKSISMGELYGEVNNLTLEWRDGLMALSVRVAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWMNGIIDKFGEDTGQYIMALFENYVEDGLRFVNKKCTQAMPQVDISKVTTLSCLLESLLLGKGGPDLKMEHSRLTSIVCQTFVFCYLWAVGGNLVENCWDQFDTFVKHQFEENHDAKLPSSGDLWSYYMDYDSKRLDPWERIVPNFRYNKEVPFFEMLVPTTDTMRFGYLMEKLLAVKHSVLFTGTTGVGKSVVARGLLDKIQEEAQYVPLYINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDAREDRGAMQPFCAPPGGGRNPVTPRFIRHFSMLCLPSPSEHSLKQIFQAILTGFLVDFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRDQNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAEYFVKHPILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDELEKVLAATRPKAKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFTPVDLGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVLSKKPDWASAKQLLGDSNFLKRLTDYDKENISEDVIQKLKVYINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDRWISRCQELGIPINANFSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSDAEWNLFLRGAAGMDKERPTKPEIGWLAESTWNLCCDLEDHLPCFKGLKREIVAIPILVTLGRLEIRLNPEAWEGCMKEPLHFTEEVSE---------NEIQGHWNERLSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTGSDPMGAFQRFAREMGYSERVHAISLGQGQGPIAEK 3537          

HSP 2 Score: 791.571 bits (2043), Expect = 0.000e+0
Identity = 372/600 (62.00%), Postives = 461/600 (76.83%), Query Frame = -3
Query:   72 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1871
            F+   ++  Y ERV AISLGQGQGP+AEK+++ A K GDWVFLQNCHLAASWM+ +EEI+K  SE    +H N+RLFLSSMP + FP++VLQNSVKVTNEPPKGLRANI+RAF E++P FFE +VLG  WRK+IFGICFFH+II +RKKFGPLGWNI YEF+DSDRECA+LNL +FC DG I WDAL YIT EITYGGRVTD WDQRCLR IL  FF PKT+   Y YS SGIYY  E +T+ ++KD++++LPL ++PEIFGMHENANL+FQ QET  L+ TIL+VQPR +  G G + D+IV ELAD IL KL + ++ E A   LF  DEKGR+NSLTTVL QEVDRFN LL VI++SL  LKKAI GFVVMSEE+E +Y +F N+QVP LWS+ AYPSLKPL  WVKDLA+R +    W+  G PKSFW+ GFFFPQGFLTGTLQN+ARKY+ PID L F +     YR+Q  V + M+  +FG+ +EAD  L +  DGVLVHGL+MD  RWDDE+  +  ++  +M   LP++H  P  +Y+P+ + Y +PLYKT  RAG LSTTG STNFVV V +P+ ++S++WI+ GAAL+C+
Sbjct: 3509 FQRFAREMGYSERVHAISLGQGQGPIAEKLIEEAVKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRNFPVTVLQNSVKVTNEPPKGLRANIRRAFTEITPAFFEKNVLGQNWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECALLNLNLFCQDGRIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPKTLEPGYLYSTSGIYYASEEKTLQDHKDYIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPRSSGQGAGTSNDEIVKELADSILAKLPEILDMEGAMESLFTRDEKGRINSLTTVLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAWIKTGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQNYQPDPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKRDSDYWISKGAALLCQ 4108          
BLAST of SMED30008756 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1528.46 bits (3956), Expect = 0.000e+0
Identity = 876/2204 (39.75%), Postives = 1289/2204 (58.48%), Query Frame = -2
Query: 3514 LWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQ----VVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGL---KARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLN-------VDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVR------------NKFEDNGDCR---------MPSQGDLWS-SYADLHSRKMDLW-EKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSV-VARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSIL----TGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGEN--------------IEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAG---VSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD---------------WASAKSVLGDPYFLKKLADYPKDNIPEALLKKLK-RYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRH 9900
            L++   E+ S++  W+      +NP+ +      Y + + +LE+ L  +     +   LK  VE  R  + +   L NP L+ RHW  + +++ +    ++E++ L K +E+N+  +  +  +IS  AS E SLE  L+K+   W   ++ ++ ++DS    IL   D+IQ L DD  +   T+  S  + P +  + EW + L L  + ++EWL  Q  WLYLE IFS+PDI  Q+P E + F +VDK++++++++       +   +   +L+  + + +LL+ I K L  YLE KR+ FPRF+FLSNDELLEIL++T++P  VQPHL+KCF+ IS+++F  A                        DI  M S EGE V L + +   KARG VE+WL ++E  M  ++  ++ +++  + +  R EW++A   Q VL V Q  W  E+     + +    Q +  +  +C   ++++ GLVRG L +  R TL AL+ ++VHARD++  ++K  ++  + F+W  QLRYYW+    +   RM N+   YGYEYLG +PRLVITPLTDRCY  L GAL L LGGAP GPAGTGKTETTKDLAK++AKQCVVFNCSDGLDY  +G+FF GL   GAW CFDEFNRID+EVLSV+AQQ++TI+          MFEG E+KL  TCA FITMNPGYAGR+ELPDNLKALFR +AMMVPDY +IAE++LYS GF S++ L+ K+   Y+LCSEQLS Q HYD+GMRA+KSVL  AG LK + P + ED++++R++ D NLPKFL  D  LF  I  DLFPGV+LP+ DY      I+   E   LQ+      K++Q YE + VRHG M+VG   GGKT  Y VLA  L ++    L  E      V++ +LNPK+ITMG+LYG+ + ++ EW DG++    R     TS D +W++ DGPVDA+WIENMNTVLDDNK LCL + E I+L    +++FE  DL VASPATVSRCGM+Y++P  LGW P + +WLN+    L       +  +FE+ +   L+F + K  + ++  S   +  +C L+   L+     + +       +D + ++  I   F+F  +W +G +        FD  +R             +F  + +            P+ G ++   +      + +LW E +       +++ F ++IVPT+DTIRF  L+E L+  ++ VLF G TG GKSV +    L ++ +N  Y P+ INFSAQT++ +TQ +I  KL+++RK V G    KR+++F+DD+NMP  + YG+QPP+ELLRQ+ D   +YD    + I ++++ +  A GPPGGGRN V+AR LRHF   +I    + S+  IF+ I+    T  FA FP      TE +V + +E+Y     +LLPTP KSHY+FNLRD S+ IQG+    P      + + +L+ HE  RVF+DRL++  D+ +    + +    Y  E+              +E +    L  +F DF     +   + Y  ++D  +++ ++  +L++FN  S K M LV F  AI+H+ RI+R+++Q R +ALLVGVGG+G+QSLTRLAA M     FQ+E+ +GY  N +  DLK+I   +    Q+ VFLFTDTQI  E FLEDINN+LNSGE+P+LF PDE + +    R   ++      ++G+   +    ++R R+ LH+VL MSP+G +FR+R R FPSLVNCCTIDWF +WP +AL  VA    E V++ E+ L   +  MC   HTS    S++F AE +R+ Y TPTSYLELI+ +  +L +K+ +++  + R + GL K+      +A M+ EL AL+PQL +        M  +  + E+       VK DEAVA  +A   + I D+   DL EA+P L +A+ ALD L + DI  ++   +PP  V+ VME++ +L G K D               W  AK +LGD  FL+ L D+ KDNIP A++K ++ +YI +  F  + +   S A   L  WV AM+ Y K  K V PKK +L  A  EL   MG LR+KQ  L  V++K+A LQ+  + +  +K  LE+ + + + +L RA +L   L  E+ RW E+         ++ GD  + +  VAY GAF SS+R 
Sbjct:  648 LYEMAVEFTSKHKAWMEGPLADVNPDVVEQDVGNYWRGLYKLERSLQASPQALLIQQQLKSNVEAFRTHLPMAQVLCNPGLRGRHWDALSEVVGFPLL-TQEQVCLEKFLEMNLESFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDS-GTSILSAVDDIQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLERLQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVEFTEAL-----------------------DITHMKSSEGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAYPSTPRAEWVRAWPGQTVLCVSQAFWTSEV----HEAIRGGQQVLERYLAQCNGQIDEVVGLVRGQLSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYWED--GHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSDTLMFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPSENEDILMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVKLPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAALGDICEKALMAE----NKVQITVLNPKAITMGQLYGQFDAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWLNARPPPLSAPHKALICALFERLVPCCLQFVR-KSTKELSPTSDTNL--VCSLMN--LMDCQMDDFHDETKIKAMDDRDVSAWIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSGPLSADTSKRFHLSENVEPPAEPFSVPFPAAGSVYEYRFIQEGKGRWELWTEALSLAPPIPRDMNFNDIIVPTLDTIRFTALMEMLVTHQKPVLFVGPTGTGKSVYITNFLLKHLDKNT-YKPLTINFSAQTTAAQTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGAQPPVELLRQWLDHSNWYDLKDCSMIKLENVQILGAMGPPGGGRNAVTARFLRHFNTVTINEFDDKSMFTIFSRIMGWHFTARFA-FPTDFSVLTEQLVQSTMEVYKAATQNLLPTPTKSHYLFNLRDFSRVIQGVCLSLPETCPVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQVEDDDLRSL--MFCDFSDS--KDDAKRYVEVSDVERLRLVVEGHLEEFNNLSKKPMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYLEDVEVSEETLASCID-MCKLFHTSTIALSQKFQAEQQRYNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLEAGIQVVNTMAVIERESEEVSRTERVVKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYLGAFISSFRQ 2804          
BLAST of SMED30008756 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1193.33 bits (3086), Expect = 0.000e+0
Identity = 749/2184 (34.29%), Postives = 1162/2184 (53.21%), Query Frame = -2
Query: 3634 NELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILW---DSLDEWDSRYNE--WLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQ--LWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVP-LAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKAR----GNVEEWLGKVEEAMFLNLRKLLRQS--ITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMF-EGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKE-VPFFEMI-VPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLN-WITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA---DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLE-----------KHERLYEPLTDFAKVKNILHSYLDDFNMA-SSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIG-CRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDI-GEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD--------------WASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKK-------KRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEK 10017
            ++L  +  TY   ++ F +      +L+ +  EL L Q L+   +++ E    Y E  W   +  K+N E L  Q         +L K L   Q    LK K++   E   ++  + N  +  RHW++I ++  + F    +   L  ++E  +  +K+++E+I   A+ E  ++A LK V   W    +   P K S+   +L G+D  ++  L +DS + +A++ S+R+  P KP + +WV+ L    + IE W+  Q  W+YLE++F   DI +QLP EAK F ++DKS+++IM++  ++P + +       L     +  + L+  QK L  YLE KR++FPRF+F+S+  LLEIL Q  +P  +Q HL   FD ++++ F                     E  Y   IL++ S EGE V+L + + A+    GNVE WLG +   +   +  ++RQ+  I E    +  E+  +   Q+ L + QM+W R+    L +   +R + M     K    LN+L  +    L K  R     LIT++VH +D+  ++V+  +     FEW KQ R+Y+    D C++++++  + Y  EYLGC+ RLVITPLTDRCY+ L  AL + +GGAPAGPAGTGKTETTKD+ K L K  VVFNCSD +DY+ +GR + GLAQSGAW CFDEFNRI++ VLSV AQQ+  +   K  K ++F+F +G  +++      F+TMNPGYAGR ELP+NLK  FR +AMMVPD  +I  V L S GF  ++ L++K   +YKLC EQLS+Q HYDFG+R + SVL   G +KR NP++PE  V++R LRD NL K + +D  LF +++ DLFPG+ L +  Y   +  I    + +GL  +P  VLK+IQ YET  VRHG+M +GP+G GKT   ++L K +++             +P +   +NPK+IT  +++G ++  T +W DG+   + R T      +H W++ DGPVDA+WIEN+N+VLDDNK L LAN +RI + P   ++FE  ++  ASPATVSR GMV++    L W P V+ WL      L  E    L+   +    D + F  T     M  +    I+    LL+ LL  P A    ++   L   +    VF  +W +G  L   +    + F+R     + D    +  D    Y    S   + W   VP F + ++ VP +  I VP VD +R  +L++ ++  +++VL  G  G  K+V+ +G +N       ++   +NFS+ T+ N  Q  +E+ ++K+     G P  +++ IFIDD+NMP ++ +G Q   E++RQ  +  GFY+ +K   + TI D+   AA   PGGGRN +  RL R F +F+   PS  S+ +IF +   G F     FP++V      +V     ++      +LPTPAK HY+FNLRDLS+  QG+L  +    R    +  LF HE  RV  DR    +DK +F+  ++++     G      + ++  + F DFM+   E           +  ++YEP+  F ++   L ++L  +N +     M LVFF DA+ H+ +I+R+IR  RGNALLVGVGG+GKQSLTRLA+F+ GY+ FQI L R Y+ +    DLK++Y  TG   +   F+FTD +I  E FLE +NN+L SGEV +LF  DE + +         KE        + ++++ ++RVR NLH+VLC SPVG  FR+R   FP+L++ CT+DWF +WP +AL  VA        +    E+K  +          VA+    ++   +R  Y TP SYL  I  Y S+ +EK   +    +R++ GL+K+ E  + ++ +  EL     +L    +  + ++ ++ +  + A+ V+ +V++ +  A+    E  A    A++ L+ A PALE A  AL  +   DI  +R  + PP ++  +M+ V LL  ++ D              W+ A+ ++    FL  L  + KD I E ++  L  Y++  ++  E    V      L  W +AM  +    K V P K        RL +A  ELD    +L +KQ EL AV       Q +YD +V EK+ L  +      ++  A  L   L  EK
Sbjct: 1346 DDLWRKFTTYSGGEELFGLPVTDYPELQRIRRELALLQKLYGLYNTVIESVDGYYEILWSDLDIEKINNELLDFQNK-----CRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFK-SRGELLLKGSDTAEKVALMEDSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGF--------------------HEKNY-EQILSIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGL-LAQMIWTRDSEVALNNAKNDR-KIMPATNQKFLDLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVDFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPEEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCG-----------EPHREMRMNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWLQG----LPTEQAQVLWSTMDSVFQDLINFVFTAVNPKMDILECMYIKQAIELLKGLL--PEADERRLEHSHLQRLL----VFSLMWSVGALLELEDRARMEAFLR-AHPSHLDLPGSANDDSIFEYVVGDSGGWEHWNTRVPEFAYPRDTVPEYSAILVPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAEL-HLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDDHG--TAAAASMEAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEYRVECTPEVKRGVVDAMAVFQDMVAERCVEYFERFRRQTYVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSRELEVKEKELAVASRRADEVLCEVTSKAQAAESVKQQVQKVKDKAQAIVDEIAADKAVAEKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQKLMNFAGFLNSLLTFSKDTINEEMVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAV-------QAMYDTAVREKQILVDDAEACRRKMNNATALIDGLGGEK 3468          
BLAST of SMED30008756 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003955.1 (pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1186.02 bits (3067), Expect = 0.000e+0
Identity = 680/1675 (40.60%), Postives = 1003/1675 (59.88%), Query Frame = -2
Query: 5098 FKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTA-------KYVKIVAQLEK-GLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQ---ERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGL---KARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIE-NSGLQINPSQVL--KVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGL-AEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIE-VIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPN--LNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVR----NKFEDNG--------DCRMPSQGDLWSSYADLHSRKMDL-WEKIVPVFKF-NKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA--DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEP--------------ESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLK 9969
            +K E     +++ +  +L   Q L+  +  W     +W+   F++LN E + T+         K++K   Q +K      Q     K + +    +M       +P +Q   +RHW Q+ +++    +  +   TL K+++ N+  Y ++ E+IS  AS E SLE  L  + E W    +  L ++++  V IL   DEIQ   DD  +   T+  S  + P +  +  W + L    +T++EWL  Q  WLYLE IFS+ DI +Q+P E + F +VD++++E+M+   + P  + AT+  GLL+  +N N LLD+I K L AYLE KR+ FPRF+FLSNDE+LEIL++T++PL VQPHL+KCF+ I++L F             +P            DI AM S EGE+V L + +   +ARG VE+WL +VE+ M  ++R ++ ++ T +   +R++W++    Q+V+ V QM W  E+   ++   +   QG+ ++  +    L  +  LVRG L K  R TL AL+T++VHARD+V +M+ + VS+   F+W  QLRYYW+S  +   VR+ N    Y YEYLG SPRLVITPLTDRCY  L+GA  L+LGGAP GPAGTGKTETTKDLAK+LA QCVVFNCSDGLDY  M +FF GLA SGAW CFDEFNRI++EVLSV+AQQ++ I+ A   K+  F FEG E+ L   C   ITMNPGYAGR+ELPDNLK LFR +AMMVP+Y LIAE+ LYS GF ++K L+ K+   Y+LCSEQLS Q HYD+GMRA+K+VL+ AG LK + P++ ED++L+R+++D N PKFL  D  LF  I  DLFPG+ LP  DY  F   +E   E  S   + P +V   K+IQ YE + VRHG MLVG    GKT V  VLA  L+ ++  G   EER     V++  +NPK+ITMG+L+G+ + ++ EW DG++    R      + D +WV+ DGP+D LWIE+MNTVLDD   LCL + E I+++  + ++FE  DLS ASPATVSRCGM+Y++P +LGW P V++WL ++   L+ E   D L  +F   +   L+  + +C   M ++ +     +C    +      AP   + + A  +  ++  +F F  +W +G +        FD+F+R     K +D+         +C +  +G ++    +L  R   + W +++      +K     ++IVPT+DT R+ YL++  +   + +LF G TG GKSV  +  L N  +   Y+P F+NFSAQTS+N+TQ +I +KL+K+RK V G P  KR +IF+DD+NMP L+ +G+QPPIELLRQ+ D G +YD    + I ++D+ L AA GPPGGGRN V+AR LRHF + +I + S+ ++  IF+S++  +    DFP +       IV A +E+Y +   +LLPTP KSHY FNLRD S+ IQG+L         +  + +LF HE  RVFHDRL++ +D+ + + +  ++   +F E+ +               E   KL  +FGD+M P L   ERLY  +    +  +++   L+++N      M LV F   ++H++RI+R+++Q  G+ALLVGVGG+G+QSLTRLA  M+G   FQ E+ + Y +  +  D+K
Sbjct:  666 YKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQKKAEQERQRDAPRKKRGDSAEAEMEEAQEQSDPSVQMCRDRHWVQMSEVVENDIT-PDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRET-GVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGF-------------LPNL----------DIGAMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQ---QGLREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWES--EQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLF---LEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEER-----VQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKMLMLKLWLNTRTQLCPSDITKERYSNAPESCIFMHANSIY-SLQASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKDHPLPPTVGKWECPLEERGLVYDYMYELKGRGHWVHWNELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKL--MFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2299          
BLAST of SMED30008756 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003959.1 (pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1181.78 bits (3056), Expect = 0.000e+0
Identity = 682/1682 (40.55%), Postives = 1004/1682 (59.69%), Query Frame = -2
Query: 5098 FKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTA-------KYVKIVAQLEK-GLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQ-----ERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGL---KARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIE-NSGLQINPSQVL--KVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGL-AEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIE-VIDYLYGMFEKYIDDGLKFAQTKCI---QTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIA----IAFVFCYLWGIGGNLHESNWDSFDNFVR----NKFEDNG--------DCRMPSQGDLWSSYADLHSRKMDL-WEKIVPVFKF-NKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA--DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEP--------------ESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLK 9969
            +K E     +++ +  +L   Q L+  +  W     +W+   F++LN E + T+         K++K   Q +K      Q     K + +    +M       +P +Q     +RHW Q+ +++    +  +   TL K+++ N+  Y ++ E+IS  AS E SLE  L  + E W    +  L ++++  V IL   DEIQ   DD  +   T+  S  + P +  +  W + L    +T++EWL  Q  WLYLE IFS+ DI +Q+P E + F +VD++++E+M+   + P  + AT+  GLL+  +N N LLD+I K L AYLE KR+ FPRF+FLSNDE+LEIL++T++PL VQPHL+KCF+ I++L F             +P            DI AM S EGE+V L + +   +ARG VE+WL +VE+ M  ++R ++ ++ T +   +R++W++    Q+V+ V QM W  E+   ++   +   QG+ ++  +    L  +  LVRG L K  R TL AL+T++VHARD+V +M+ + VS+   F+W  QLRYYW+S  +   VR+ N    Y YEYLG SPRLVITPLTDRCY  L+GA  L+LGGAP GPAGTGKTETTKDLAK+LA QCVVFNCSDGLDY  M +FF GLA SGAW CFDEFNRI++EVLSV+AQQ++ I+ A   K+  F FEG E+ L   C   ITMNPGYAGR+ELPDNLK LFR +AMMVP+Y LIAE+ LYS GF ++K L+ K+   Y+LCSEQLS Q HYD+GMRA+K+VL+ AG LK + P++ ED++L+R+++D N PKFL  D  LF  I  DLFPG+ LP  DY  F   +E   E  S   + P +V   K+IQ YE + VRHG MLVG    GKT V  VLA  L+ ++  G   EER     V++  +NPK+ITMG+L+G+ + ++ EW DG++    R      + D +WV+ DGP+D LWIE+MNTVLDD   LCL + E I+++  + ++FE  DLS ASPATVSRCGM+Y++P +LGW P V++WL ++   L+ E   D L  +F   +   L+  + +C    +   ++S A  + +   ++  L G     L V  + L   +      +F F  +W +G +        FD+F+R     K +D+         +C +  +G ++    +L  R   + W +++      +K     ++IVPT+DT R+ YL++  +   + +LF G TG GKSV  +  L N  +   Y+P F+NFSAQTS+N+TQ +I +KL+K+RK V G P  KR +IF+DD+NMP L+ +G+QPPIELLRQ+ D G +YD    + I ++D+ L AA GPPGGGRN V+AR LRHF + +I + S+ ++  IF+S++  +    DFP +       IV A +E+Y +   +LLPTP KSHY FNLRD S+ IQG+L         +  + +LF HE  RVFHDRL++ +D+ + + +  ++   +F E+ +               E   KL  +FGD+M P L   ERLY  +    +  +++   L+++N      M LV F   ++H++RI+R+++Q  G+ALLVGVGG+G+QSLTRLA  M+G   FQ E+ + Y +  +  D+K
Sbjct:  664 YKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQKKAEQERQRDAPRKKRGDSAEAEMEEAQEQSDPSVQMCSIRDRHWVQMSEVVENDIT-PDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRET-GVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGF-------------LPNL----------DIGAMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQ---QGLREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWES--EQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLF---LEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEER-----VQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKDIHEKELRLSEAFTKALIVSVDCRLSGLCLKGLWVSVEALLVLLMLKLWASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKDHPLPPTVGKWECPLEERGLVYDYMYELKGRGHWVHWNELIKNPHLGDKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKL--MFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2305          
BLAST of SMED30008756 vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 655/2588 (25.31%), Postives = 1184/2588 (45.75%), Query Frame = -2
Query: 2431 EDLEEVAAELKLKQILWDSLDE-WD--SRYNE--WLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQI-EDIINYKFSES---EEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAP-DIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEF-DTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQD-LNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYW-DSTLDN---CVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQ----WVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFE-----KYIDDGLKFAQTKCIQT--------MAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKF-------EDNGDCRMPSQGDLWSSY-ADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLE----KKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGG-GRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDK-SGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKV-KNILHSYLDD-FNMASSKEMK--LVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDEL---KVKLALMCTEIHTSVAKESERFYAELKRHYYT---------TPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTK----ILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLG-QKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKL--KRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQ-------KIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTEN-AILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICI--KVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYF-VVANMAEIDPMYQFSLKYFKTLFNNT-IENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSF-MLCI 9945
            + L  V  E+K   ++W S+   W+   R  E  W R + + L  +      A +++   +L + +   ++   L  +V  +     ++  L +  L+ RHW  I  DI   +  ++   + + +L  ++ LN+   +  L +I  +A  E  +E  L ++++ W+  +Y V+ H  S  + ++   D ++Q   +    + ++ +S +    +    +    L    +    W+  Q  WL L  I     DIQ  LP E   F S+   YK I  +  ++   +     P    T K     L  I+  L  +LE +R  FPRFYFL ND+LL+I+   ++   V   ++K F +I  + F       V S +G              ++L +     EK+ L   ++A    +EWL  ++  + L++    R  + +  D  + E  +  +  Q +L   Q+MW   +   L+     +    +D ++K   D LNK +  V+  +         AL+   +H  +++ ++      +     W K  ++Y  + TLD+     +  S  L  Y +EY+G   RL+ TPL    +  L  +L    GG   GPAGTGKTET K   ++L +  VVFNC D  DY+++ R   G+ Q GAW CFDEFNR+D +VLS ++  +  I+N      S       E  L    A FIT+NPGY GR+ELP+NLK  FR  +M  P    IAE+IL   GFE SK+LA K+    +L S + S  +HY FG+R LK VL     L  E  +  + VV   +L+   LP     D  +F+  L  +F     P +     +  ++   + SG  ++   + K +QFY     +  ++LVG  G GKT  +  +   ++  +               +Y+++ K +T   LYG + K TLEW DGL   I+R    D +   +    WV+ D  +D  ++E MN+VLDDNK+L L N ER+ + P   +LFE  +L   +PAT++RCG+++   +       +   LN        E +D    MFE       I D    A    I T        +   +  K++T  +L   L+        N+D + L   I +      L+ + G+    +  +F   +   F        D     + +    +SS+ +++ S  ++  E + P           ++++PT+DTI+   +   LL+ K+ ++  G  G GK+++    L N   ++ Y  V INFS  T++      +          K   +L     K +++F D++N+PKLD YGSQ  +  LRQ  +  GF+   +  W+TI+ + +  AC PP   GR P+S R  RH A+  +  PS  SL QI+       F   P + R  TE    A+V +YN        T  +SHY+F+ R+L++ ++G+     +  R     + +L+ +EA R+F DRL+  ++K  F Q++ E   KY                  D                 DF +V K  L +++++ F     +E++  +V     +DHI RI R ++Q +G+ +L+G   TGK  LTR  A++NG    Q ++ R  + + F   LKK      +    T  +  ++ I+   FLE +N +L + ++P LF+ +EY++++   R   +  G+       ++++ +  +  NLH+V  +    ++  S     P+L N C I+W   W  + +  VA +  + + +   +    +V   L+ TE   ++            R++Y          +P  +++ +   + ++T K + L   +  V  GL K    +L+ NEL  T+  +      +L +K+K+  + + K+  +Q +++  ++  +E + + KV+ ++ +   +   + + +  P +  A + +  + K  + EIR   NPP  V+ VME+VC +LG Q ++W   +  +    F+  +  Y      +  ++K   + ++ DPNFT E + + SKAC  L  WV A   +SK ++ V+P +       +E+  +  +  + +A LLA E    +L+       + Y   + + +A++  ++   A L R+  L  +L  EKERW  +  +F++    ++G+  + +    Y+G      R ++L        +  +    +   +  L    E  +W   GL ++    EN +I++      P ++DP       I N    N+  ++   E  F++ LEN IR G   +++D GE  DP +  ++ ++      R  + +GD +++ S DFKL+I +   +P     I +  +V +++F    + +E ++       E  E++ +R +LI      K +L+  E R+L+ L  S+GN+L++++L+ TLN  K  +    K+++E+E    +      +Y  + G+ SV  F ++    +    Y  S+  F + F    I+ S++++    R+  +L       Y   +  L +K K++ +  M C+
Sbjct: 1219 DQLTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQSD-----LANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEH--SSGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDFITGVRSVEG--------------EVLNL----NEKIELKDSIQA----QEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGLLDKLNKSSDNVKKKIE--------ALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFGEGEKTVV--ESLKRVILPSLGDTDELVFKDELSKIFDSAGTPLNSKAIVQC-LKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANV----------VYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNK-----SYEALDNKLSMFELDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSYRQWFQNLDDKSLKDVITLLIKRSLLYALAGDSTGESQRAFIQTINTYFGHDSQELSDYSTIVIANDKLSFSSFCSEIPSVSLEAHEVMRP-----------DIVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNALRN---SSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEIYYKAIFKLVP-EFRSYTEPFARASVHLYNECKAR-YSTGLQSHYLFSPRELTRLVRGVYTAINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQ--------------DLGNISSTSLLFSGLLSLDFKEVNKTDLVNFIEERFKTFCDEELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKK----STELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSNWRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLR-------QEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYG-NKTVLLSFLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHS--CDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEY-SIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMAMTMFCL 3705          

HSP 2 Score: 64.6994 bits (156), Expect = 3.661e-10
Identity = 56/224 (25.00%), Postives = 99/224 (44.20%), Query Frame = -3
Query: 1221 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKI-GDWVFLQNCHLAASWMVRLEEIVKKRSE--NPYEVHENFRLFLSS-MPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGV---IQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFF 1871
            FK +   K   E ++ I LG  +     +   + +KI G W+ LQN  ++ SW+   +  + K  E     E HE F++F++  +     P  +LQ + +   E   G+   +K  +     QFF   + G+      F + +FH++I  R +  P G++ +Y F+D D + A + L    A      I W  +    A I YGG++ +  D   +  +    F
Sbjct: 3798 FKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWV---KTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLW---GSQFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVF 4015          
BLAST of SMED30008756 vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 4178.63 bits (10836), Expect = 0.000e+0
Identity = 2100/3445 (60.96%), Postives = 2579/3445 (74.86%), Query Frame = -2
Query: 1786 IISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDF-AIAETPKVESSDGMPQTPQPQEVKY-TNDILAMISPEGEKVSLGKGLKARGNVE------EWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLV-GPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQV-STENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 12090
            +++++R+ P + FLYLT  +D+    Y  YNLK+V + ++   D+  +S  G TH V  +E +  SL+R+E EY  Y ++ KIPTF  FR+WKAF+ WRK ++  K  QC   L  +LFI+N+                                             VA +L EFR+LV+EV+RSACRT+LLE GF PDDYF+D  ++P    G P  G        +MD+Y +APDKMTYTEQANKR HC+RLT+FIRLADYLIVNTMHVLAVNSV TLLNY+ +QL+  P    +   K         ED E+    +++  VE                    + PLF TE ++  Q LLF P  E F EG+ EV KRFQ+ VLSV NLVPD+YFD+FT+P+IN K EEKT GEGPS+A MF +D HL  +I    DAI  AF+   KYA+TF   R+FY++NES DL+AIR G++DVEFF  +  +Y+ E      I  +KPIGMIL D  K+K++++PSP +CL+VIN++LP +A+K  D L+K  QDA++ L   P++T DYV +L FL EIQ +++ +E E+  IKE+YDLID + VPTPPED AVYQTL P++   +N IDK+LA+RD NIDKFC  +DKDI +L ++VK+++Q   +P ILD  +    +   L++L+  M+ L   AFTYKSYQKNFKVE  + E+LEEV AEL+LKQ LW+SL EWD    +W    F +LNPE L     KY K V QLEKGLPPN VVP+LK+K+E MR K+ VITNL NP L++RHW QI+ I NY F + EE LTLG L ++  F++ E +EE+SGQASSEASLE +LKKVE+AW+ TE++VLPH+DSKDVFILGG D+IQ + DDS INV+TIA SRHVGPI+PRV+EW + L LF +T++EW+ CQRNWLYLESIFSAPDIQRQLP+EAK FM+VDKS+KEIMRKV ++P A+RA T PGLL+TF+NNN LLDQIQKCLEAYLESK VIFPRFYFLSNDELLEIL+QTRNP AVQPHL+KCFDAI+KL+F +  + P       +  T + ++++Y TNDIL MISPEGEKVSLGK +    ++E       WL  +     LNL K     I+ F +L    W  + + Q ++T          +  +  +        I F +    +LN LA LVRGVLPKL R  L ALIT++VHARD+VT MV  KV   N FEW KQLRYYWD  LDNCVVRMSNS+Y YGYEYLG S RLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAK+LAKQCVVFNCS+GLD+KMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQL+TIRNAK AK SRFMFEGREIKLV +CAAFITMNPGYAGRTELPDNLKALFRP+AMMVP+Y LIAEVILYSEGFESSK LA+KMTQMY+LCSEQLSQQDHYDFGMRA+KSVLVMAG LKR NPD  EDVVLIRALRDSNLPKFL  DA LFRAIL DLFPG E+P+HDYG+ +  IE  +   GLQ  P+ V KVIQ YET+ VRHGVMLVGPTG GKTT Y +L   L++L+    AE+ P Y PV+ +ILNPKS+TMGELYGEVNKLT+EW DGLM   VR    +T+ DH+W++CDGPVDALWIENMNTVLDDNKMLCLANSERIKL   +HMLFEVQDL+VASPATVSRCGMVY+DP ELGW PFV++W+   + K+K E  +YL+ +F+ Y+D GLKFA  KC Q M QV I+K+ TMC L +S      G P+ N+D  KL+P I  AF+F +LW IGGNL E+  +SFD F R+ F D  D R+P  GDL+S Y D  +R+M+ WEKI+P FK++ EVP+F+++VPTVDT+RFG+L++KLL V +SVL+TG TGVGKSV+A+  L++IS+ + Y+ + +NFSAQTSS RTQEMIE KLEKKRK +LGAP  KR++IF+DDLNMPKLDTYGSQPPIELLRQYQDF GFYDR+KL W  I DMT+ +AC PPGGGRNPV+ R LRHF+MF IP+ +E +L  IF SI++GF  DFP +VR C + IV A+VEIY RM TDLLPTPAKSHYVFNLRDLSKCIQG+LQ DP  +RDK  +F+LFCHEA RVF DRLIN EDK FF+ I++EMA K+F +   PE F   PI+FGDFMK G +  ++LYE LTD  KVKN+L  YLDD+NM SSKEMKLVFFMDAI+HI+RIARM+RQ RGNALLVGVGGTGKQSLTRLA  M+ Y CFQIEL RGYDY+ F  DLKK+Y+  G+  ++TVFLFTDTQIVVEEFLEDINNILNSGEVP+LFEP+EYE ++ G R  AKEAG+ EG+RDG+F++ I+RVRNNLHIVLCMSPVG +FR+RCRMFPSLVNCCTIDWFT WP EALL+V+ + FE VD+G + +K K+A MC EIHTSV+  ++RFYAEL+R YYTTPTSYLELITLYLSML EK+KQL+  RDRVKNGL K+LETN+L+ TM+VELVAL PQL+QK  D E LM+KL  DQE+AD VR+ V+ +EAVAK KA ET AIA +AQ+DLDEA+PALE A KALD+LDK+DI+E+RVFT PP++V TVMES+C+LLG K DW SAK++LGD  FLKKL DY KD IP++ L+KLK+YID+P F  E VEKVSKACRS+V+WVRAMD+Y++  +TVEPK+ +L  A  EL+ VM  LR+KQA L  VE+KIAELQ  YD+S+ EK+ L  N+A T+ARLKRA KLTTAL DE+ RWTE+V+ F  E+GNVVG+VF+ AACVAY+GAFTS YRHEL++ WI +C+EL +PVS+  +L+ VL D +E+RQWNS+GLPRD + + E+ IL     R  L +    +ANRWIR KE  N LKIIKL++ NFLRTLENCIR+GMP LLE++GE+LDPALEPILLKQTFV+ GR LI LGDSDI+Y K+F+ Y+TTKL+NPHY+PE+CIKVTIINFTVT  GLEDQLL +V RLERP+LE+QRN LI+RIN+DKNQL+  E+RILKLLF SEGNILD E LINTLNESKVTS   + R+ EAE TE+KIT+AR KY PVA RGSVMYFVVA++AE+DPMYQ+SLKYFK LFN  IE+S+K+ DL+ R++ILL   T + Y NVARGLFEKDKLVFSFMLC  IMRQ  +I+D EW FFLRG GG++K+RP KP  PW++  +WN   D+ D++  F     D  +  I +++G L  S   + + + +P           +S  D             RL SF++LI +K F EEK+V    +FV  NLG  FVE P  DLP+LF+++S + PL+F+LSTGSDPMN F RFA++     +  +   G   G    K
Sbjct:    1 MLALIRQNPRLGFLYLTPAVDRSSIEYSPYNLKIVRHSDINHSDYSTISTEGVTH-VRDNEAEFTSLERWEKEYVDYKRLVKIPTFANFRMWKAFVVWRKNVRTKKILQCRNSLQENLFIVNA---------------------------------------------VAGRLAEFRDLVKEVVRSACRTALLEAGFTPDDYFLD-MESPTGMYGKPVVGYG------EMDMYGDAPDKMTYTEQANKRTHCRRLTSFIRLADYLIVNTMHVLAVNSVATLLNYLEEQLQNAPPLATLLGTKKEGAAETDEEDKEEGEEEKKEEHVE--------------------LDPLFTTELLMEPQALLFYPGLEDFDEGLGEVTKRFQDAVLSVSNLVPDSYFDAFTRPIINGKVEEKTAGEGPSLATMFEDDRHLQGVIQSIRDAISNAFDMAWKYANTFEPYRKFYQENESLDLEAIREGEHDVEFFATSLEKYNSEHEQAVGIMAKKPIGMILADLRKLKEVLIPSPLKCLEVINDILPKLAKKRTDDLMKFCQDAQFELEVVPSSTNDYVKSLTFLDEIQEKIDDIEAESMTIKELYDLIDNYKVPTPPEDLAVYQTLRPTVTAVRNVIDKSLAERDSNIDKFCTCMDKDIVQLGKDVKEVKQKAQDPKILDSSSKSESIIAYLKELQGKMDRLHDTAFTYKSYQKNFKVEVTKFEELEEVHAELRLKQSLWNSLVEWDQSQQDWTETLFEELNPETLSNNVMKYAKTVMQLEKGLPPNSVVPILKEKLENMRHKLPVITNLRNPALKQRHWDQIQQIFNYHFKD-EEPLTLGLLDKIEAFEHTESIEEVSGQASSEASLEGILKKVEDAWKSTEFIVLPHRDSKDVFILGGVDDIQAVLDDSMINVSTIAGSRHVGPIRPRVEEWQRQLYLFSETMDEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMTVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKCVIFPRFYFLSNDELLEILSQTRNPHAVQPHLQKCFDAIAKLEFGSTVQAPSTPQDQPVTPTGERRKMRYATNDILGMISPEGEKVSLGK-VSYSHSIETLTLCFSWLKDMSNHP-LNLHK----KISLFSSLMYITW--SRSPQYIITS---------STTINALFPSHYSLCIVFPM----NLNNLAALVRGVLPKLTRNILGALITIDVHARDIVTGMVNAKVDSENNFEWIKQLRYYWDPDLDNCVVRMSNSMYIYGYEYLGASARLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSEGLDFKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLLTIRNAKVAKASRFMFEGREIKLVPSCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKNLARKMTQMYRLCSEQLSQQDHYDFGMRAVKSVLVMAGALKRSNPDLEEDVVLIRALRDSNLPKFLAADAILFRAILTDLFPGKEIPDHDYGKLQSTIEDCMVAKGLQAIPALVKKVIQLYETMIVRHGVMLVGPTGSGKTTNYMMLQDTLTSLHEQ--AEDSPYYLPVQTHILNPKSVTMGELYGEVNKLTMEWRDGLMALKVRQCVQETTPDHKWIVCDGPVDALWIENMNTVLDDNKMLCLANSERIKLNNTIHMLFEVQDLAVASPATVSRCGMVYMDPNELGWRPFVRSWMQKHSDKMKEETREYLWNLFDHYVDAGLKFASKKCTQAMQQVDISKVTTMCCLFDSFFFPAKGGPDFNLDPTKLHPLICTAFLFVFLWSIGGNLVETCNESFDTFTRDLFADTHDVRIPGSGDLYSYYVDFDTRRMEPWEKIIPAFKYSSEVPYFDLLVPTVDTVRFGFLMDKLLSVNKSVLYTGTTGVGKSVIAKAILDDISQKSNYMAIMMNFSAQTSSQRTQEMIETKLEKKRKNILGAPAGKRMVIFVDDLNMPKLDTYGSQPPIELLRQYQDFRGFYDREKLFWKEIHDMTICSACAPPGGGRNPVTPRFLRHFSMFCIPSSAEHTLGHIFKSIVSGFLLDFPAEVRECADAIVGASVEIYARMSTDLLPTPAKSHYVFNLRDLSKCIQGVLQADPGVIRDKGQIFRLFCHEASRVFQDRLINKEDKTFFNTIMSEMAHKHFQQARSPEKFESNPILFGDFMKMGADPADKLYEELTDLKKVKNLLTDYLDDYNMNSSKEMKLVFFMDAIEHISRIARMVRQPRGNALLVGVGGTGKQSLTRLACHMSAYKCFQIELTRGYDYSAFREDLKKLYDVAGVKGENTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEPEEYEAVLNGTRPLAKEAGIPEGDRDGVFDYFISRVRNNLHIVLCMSPVGDAFRTRCRMFPSLVNCCTIDWFTEWPREALLSVSSNFFEEVDLGAEGVKDKVAEMCVEIHTSVSTMADRFYAELRRRYYTTPTSYLELITLYLSMLDEKRKQLIGARDRVKNGLKKLLETNDLVDTMQVELVALEPQLKQKSLDVEKLMEKLQVDQEEADKVRNVVQAEEAVAKEKADETSAIAAEAQKDLDEALPALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILLGVKPDWPSAKTMLGDAGFLKKLMDYDKDKIPDSTLRKLKKYIDNPKFVVEVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASLAEVESKIAELQAAYDHSIAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELINSWIEQCKELGVPVSDDFSLINVLADPYEIRQWNSDGLPRDSLKAIEDRILKLLNMRSTLFL----KANRWIRTKEAKNGLKIIKLTDNNFLRTLENCIRIGMPVLLEEVGESLDPALEPILLKQTFVQGGRLLIRLGDSDIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLERPDLEDQRNQLIVRINSDKNQLKAIEDRILKLLFHSEGNILDDEVLINTLNESKVTSGVISTRLKEAERTEEKITIAREKYRPVATRGSVMYFVVASLAEVDPMYQYSLKYFKQLFNACIESSEKTDDLDRRLEILLNNCTESVYVNVARGLFEKDKLVFSFMLCGDIMRQQEIITDEEWNFFLRGTGGLDKERPAKPDVPWLTDFMWNTCCDLEDVLHSFKGFKGDFVKAPITISMGNLQQSEVGDDDQAEKP-----------RSWQD-------------RLTSFERLIFIKAFKEEKVVFAAVDFVCENLGKTFVESPSIDLPVLFENVSNMIPLIFILSTGSDPMNAFLRFARDMNYTERIQAISLGQGQGPVAEK 3320          

HSP 2 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 383/600 (63.83%), Postives = 475/600 (79.17%), Query Frame = -3
Query:   72 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1871
            F    +  NY ER+QAISLGQGQGPVAEK++  A+K GDWVFLQNCHLAASWM+ +E  +K  + N  EVHE+FRLFLSSMP K FP++VLQNSVKVTNEPPKGLRAN KRAF E+    FE+HVLG+ WRKL+FGICFFH+II +RKKFGPLGWNI+YEF+DSDR CA+ NL MF  D  I WDALT+IT +ITYGGRVTD WDQRCL  IL  FF PK + ++YK+S+SGIY+PP FE++++Y+++VD+LPL +EPE+FGMHENAN++FQ QET +LI T+L+VQPR+A+ G G+T D+IVYELAD IL KL+D ++ E+A+  LF  D KGR NSLTTVL QEVDRFN LL VIKNSL QL+KAIKG VVMS EL+ VYT+F NNQVP++W+N +YPSLKPL +WVKDL +R      W++ G PKSFW+ GFFFPQGFLTGTLQN+ARKY+ PID L+F + V   YRNQEEV ++  +L++G+ +  D+ L  P DGVLVHGLY+DG RWDD++  +  +  GEM   LPI+HM P+M+  P+ ++Y+SPLYKT  RAGVLSTTG STNFVV+V LPTD    FWI  G AL+C+
Sbjct: 3292 FLRFARDMNYTERIQAISLGQGQGPVAEKLIANASKNGDWVFLQNCHLAASWMLAMETTIKDLTNNEAEVHEDFRLFLSSMPTKAFPVTVLQNSVKVTNEPPKGLRANTKRAFGELMADPFESHVLGVRWRKLVFGICFFHAIIQERKKFGPLGWNIKYEFNDSDRMCALENLKMFLVDENIPWDALTFITGQITYGGRVTDEWDQRCLTTILGRFFSPKILEDNYKFSESGIYFPPGFESLHDYREYVDNLPLTDEPEVFGMHENANIAFQTQETHQLIYTVLEVQPRLASSGGGKTNDEIVYELADSILGKLMDVLDMEKAEKSLFETDAKGRYNSLTTVLGQEVDRFNNLLKVIKNSLTQLQKAIKGLVVMSLELDKVYTSFLNNQVPDMWANSSYPSLKPLGSWVKDLVLRTMFVEQWIIHGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDQLTFSYNVLPQYRNQEEVAEETAKLEYGQALPLDEELDCPDDGVLVHGLYLDGARWDDDSMMLGDARYGEMNPPLPILHMEPQMNLVPDPSQYMSPLYKTSARAGVLSTTGHSTNFVVSVYLPTDLPQAFWIEKGTALLCQ 3891          
BLAST of SMED30008756 vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 2171.74 bits (5626), Expect = 0.000e+0
Identity = 1171/2925 (40.03%), Postives = 1759/2925 (60.14%), Query Frame = -2
Query: 1855 IGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRD----GNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPN--QVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTND---ILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEF--DTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQD--LNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWE-KIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSK-EMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRD---GIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHEL-LSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKK-RPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAK 10569
            I  +L+D + +K  +L       +    +L  +A +++  L    +     L   P    +  ++L+ L ++Q  +  +E +   + + + +++ + V  P E     Q +  ++        + L D D     + +KF   L     E ++ V  +     +           E  E++ +    +  L+++  + +     FK+EQA  +DL+ +  +L+  + +W    EW+  ++ W   +F++L   D+ TQ     K + ++ + +     ++   +K ++EQ +  M +I +L N  +++RHW QI+  +   F  + +  TL K+IEL +  + E++ EISG AS E S+E  +  +   W      + P+KD +  F L  TDE+ Q  +D+ + ++T+ +SR+V   +  VD+W + L L  + +E  L  QR W+YLE+IF   DI++QLP E+  F  V+ ++K IM+++ K P A+R T  PGLL+T  + N  L++IQK L+ YLE+KR IFPRFYFLSND+LLEIL Q++NP AVQPHL+KCFD I  L  A                     V  T D    + M S EGE V  G  +   G VE WL  VE +M   L++LL+           +R++W+K    Q+ +T  QM W  +    L    +ER        +K  Q   LNK + ++RG L K+ R  + AL+T+ VH RD++ +++K   +D+  FEW  QLR YWD  +D+CVVR +N+ + YGYEYLG S RLVITPLTDRCY+ L  AL L  GG+P GPAGTGKTET KDL K+L    +V NCS+GLD+K MGR +SGLAQ+GAW CFDEFNRI+IEVLSV+AQQ+++I +A +A  +RF+FEGREI LV +C  FITMNPGYAGRTELPDNLK++FRPI+M VPD  +IAE+IL++EGF ++K LA+K+  +Y L  +QLS+QDHYDFG+RAL SVL  AG+ KR NPD  ++ +L+ +++D N+ K   QDA LF  I+ DLFPG+E P  DYG+ +  I   +++ G Q  P+ +LK+IQ YET   RH  ++VG TG GK+  + VL   ++ L   G     P +  V+ + +NPK++++GELYGE +  T EW DG++  ++R TC D   + +W++ D PVD LWIE+MN+V+DDNK+L L N ERI +   V +LFEV+DL+VASPATVSRCGMVY D  +LGW P+V +WL+    K  +E   +L  +FEK++   L+F +  C + +    +  + ++C L ++L        ++ + +     + + F+FC +W +  ++ E +    DNF+R       + + P++  ++  + D+  +    WE K+   +++N  VPF+++++PTVDT+R+ +L+  L+  K+ VL TG  G GK+ VA+  L  +     Y  + IN SAQTSSN  QE+IE+K+EK+ K V      K++I F+DD NMP  DT+GSQPP+EL+R + D+G +YDR K     ++DM L A+ GPPGGGR  +S RL   F + ++  P E  +++IF +++     DF + V+   + +  A +EIYN +   +LPTP + HY+FNLRD+SK  QG+L+ +      K+ + +L+ HE  RVF DRLI++ D+  F  ++++     F          K   IFG+FMK      + +YE L DF  +K  +   ++D+NM      + LV F DAI+H+ RI R+I Q RGN LLVG+GG+G+QSLTRLA+++  Y  FQIE+ + Y    F  DLK++Y   G++N+ TVFLF DTQ + E FLED+NNIL+SGEVP+L++PDE+E +    R A  +    E  +D    +F F I RVR+NLHIVLCMSPVG  FR+R RM+P+ VNC TIDWF+ WP +ALL VA+   E++++G++E K  +A +   +H SV   S R   ELKRH Y TPT+YLEL++ Y S+L EKKK+L     +++NGL KI +T   +  M VEL     ++ + QK  E  +  +   + +AD  +  V+       ++  + + +A++AQ DLDEA+PAL+ A+KAL++L+K D+ EI+ +  PP +V+ VME+V +L   +  WA AK  LGD  F+K+L +Y KDN+ + +LKK+  Y   P+F  E + +VS A +SL +WVRAM++Y +  + VEPKK+RL  A  +L+E    L + +A+L  V +++ EL++ YD    +K+ L     L   +L RAGKL + LA E++RW  SV+   E +G +VGD  + AA ++Y G F S+YR EL L  W+ + R+L +  + + +  G L     +R+WN +GLP D  STEN ++VTRG RWPLMIDPQ QA +WI+N E  + LKII L + ++LRTLEN ++ G P LL+++ E LDP+L PIL K      GR LI LGD ++EYS DF+ YITTKLSNPHY PEI  K TI+NF V  QGLE QLLG V R ERPELEEQ++ L+I I   K +L+  E+ IL+LL  ++G++LD E L+NTLN SK TS E  +++  +E TE KI  AR  Y P A R S+++FV+ +M  IDPMYQFSL  +  LFNN+IE SQ+S +L+ RI+ L    T A Y    RGLFE+ KL+FSF +C +I+   G ++  E+ FFLRG   ++++ + + P   W++   W+NV ++ D +P F  ++    Q                + N  Y    P  +                L G ++      Q++++V++   +++    T F+  NLG++FVEPP  D+  +  D S  +PL+FVLS G DP +   + A+
Sbjct:  830 IDFVLLDCSPLKFALLSHCNEWQNKFTTLLREMASQKLTELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQNDLPNIEAKFAPLHQQFAILEKYEVAIPEE----VQGMLDALSGEWLLFQQCLIDSDVMLKKSKEKFKTGLIHSSEEFKKTVNGLFDDFQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWTVTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKIIREVKDKNWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKD-RGHFRLKQTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMA--------------------RVGLTFDKTEAVGMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSS-KERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDG----EPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDKQSVE---HLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDALATEENGVRMS-NGESYARMLELWFLFCLIWSVCASVDEDSRKKMDNFLREL-----EGQFPAKDTVYEYHVDIKQKTWASWEDKLRSGWRYNPSVPFYKIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKT-YGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTMINQKLQDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQSPIFGNFMK-----DDTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEV----RTALSDIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIELGDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQSEPTWAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTEL-DKLPNFHGIVTSFEQYP-------------RDWNQWYTSSEPENT---------------PLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAE 3676          

HSP 2 Score: 205.682 bits (522), Expect = 2.509e-52
Identity = 109/257 (42.41%), Postives = 162/257 (63.04%), Query Frame = -3
Query: 1074 RVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKK-RSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVED-YKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHEN 1835
            R  A+SLGQGQ P+A +M+    K G+WVFL NCHL+ SWM +L+++V++ + E+P   H +FRL+LSS P   FPIS+LQ  +K+T EPPKGL+AN+KR +  ++ Q F        ++KL+FG+CFFHS++L+R+KF  LGWNI Y F+DSD E +   L ++  +     WDAL Y+ A + YGG VTD +D+R L + +   F+ + I    YK S    YY P+   ++ Y+  V  L  ++   +F  H +
Sbjct: 3683 RFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDP---HPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQLITEQQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYEETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPYYKLSSLPTYYVPKDGPLSTYRVSVILLMYIQASPLFARHSS 3936          
BLAST of SMED30008756 vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 2004.18 bits (5191), Expect = 0.000e+0
Identity = 1139/2766 (41.18%), Postives = 1651/2766 (59.69%), Query Frame = -2
Query: 1849 LWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLP----PNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGL---KARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAK-IQTMCRLLESLL--VGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGD---------------------CRMPSQGDLWS-SYADLHSRKMDLW-EKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSV-VARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILT----------GFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKL---------------PIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVS---EGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD---------------WASAKSVLGDPYFLKKLADYPKDNIPEALLKKLK-RYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIP---VSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTI-SVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEK 9900
            L+++  E+ ++Y EW+   +  ++P+ + ++T  Y + + +LEK L       ++   +K KVE+ +E + ++  + NP L++RHW+Q+ +I+ +   + +E + L K+ E+N+  Y  + E IS  AS E SLE  ++K+   W   E+V++P++++    IL   D+IQ L DD  +   T+  S  + P +  + EW   L L  + I+EWL  Q  WLYLE IFS+PDI  Q+P E + F +VDK+++E M+        +       +L   K +N+LL+ I K L  YLE KR+ FPRF+FLSNDELLEIL++T++P  VQPHL+KCF+ I+ L F                         T DI  M S EGE V L   +   KARG VE+WL +++E M  ++RK++ +++  +   ER +W++    Q VL V Q  W    TA +   +    + +  +  +    ++ +  LVRG L K  RATL AL+ ++VHARD++T++ +  +S  + FEW  QLRYY++   +N + RM ++   YGYEYLG S RLVITPLTDRCY  L GALQL LGGAP GPAGTGKTETTKDLAK++AKQCVVFNCSDGLDY  +G+FF GLA  GAW CFDEFNRID+EVLSV+AQQ++TI+    +     +FEG EIKL  TCA FITMNPGYAGR+ELPDNLKALFR +AMMVP+Y +IAE+ LYS GF ++++LA K+   Y LCSEQLS Q HYD+GMRA+KSVL  AG LK + PD+ ED++++R++ D NLPKFL  D  LF  I  DLFPGV+LP+ DY         V ++  LQ+    + K++Q YE + VRHG M+VG   GGKT  Y VLAK LS++   GL EE      V++ ++NPKSITMG+LYG+ + ++ EW DG++    R     T+ D +W+I DGPVDA+WIENMNTVLDDNK LCL + E I+L    +++FE  DL VASPATVSRCGM+Y++P  LGW P + +WL+++   L  E  + +  +F++  +  L+F +    + ++  +    + +   ++++L+           ++ +++   +   ++F  +W +G  L      SFD  +R   E                         C  PS+  ++   +      K +LW E+I       K++ F E+I+PTVDT+R+ YL+E+L+   +  LF G TG GKSV +    L  + E   Y P+ INFSAQT++ +TQ++I +KL+K+RK V G P  K+ ++F+DDLNMP  + YG+QPPIELLRQ+ D   +YD    + I + D+ + AA GPPGGGRNP++ R LRHF   SI    + ++ +IF+ I+           GF  DF        + +V   +EIY     +LLPTPAKSHY+FNLRD ++ IQG L   P  + +   + +L+ HE  RVF+DRL++  D+ + +  + E+   +   N+E ++  +                 ++F DF     +   + Y  + D  K++ ++ +YLD+FN  S K M LV F  AI+H++RI+R+I+Q RG+ LLVGVGG+G+QSLTRLAA M  ++ FQ+E+ +GY    +  D+K I   T     + VFLFTDTQI  E FLEDINN+LN+GEVP+LF  DE + +    R   ++   S   +G+   +F + I RVR+ LHIVL MSP+G +FR+R R FPSLVNCCTIDWF +WP +AL  VA+   E  +I E ++K     MC   HTS    S R+ +ELKRH Y TPTSYLELI+ + ++L +K++++V  + R + GL K+      +A+M+ EL AL+PQL Q  K+ + +M  +  D  +       VK DEAVA  +A   +AI D+  +DL EA+P LE+A+ AL+ L   DI  ++   +PP  V+ VME++C+L G K D               WA +K +LGD  FL+ L  Y KDNIP   +K+++ +Y  +P F  + ++  S A   L  WV AMD Y K        K    +    L +  G L +K+A L  V++K+A LQ+ Y+ +V +K  LE  + L S +L RA KL   L  EK RWTE  +       N++GDV + +  VAY GAFT+++R        G CR        V     L+ ++    ++R W   GLP D  S EN I++    RWPLMIDPQ QAN+WI+N E  N L +IKL++ +++RTLENCI+ G P LLE++GE LDP LEP+LLKQTF + G   I +GDS IEYSKDF+ YITTKL NPHY+PE  +KVT++NF +TP+GLEDQLLG V   ERPELEE++N LI++   +K QL+  E++IL++L  SEGNIL+ E  IN L+ SKV + E +++ A AE TE+KI   R  Y P+A   ++++F +A++A I+PMYQ+SL +F  LF  +I+NS+KS++L++R++ L    T + Y NV R LFEKDKL+FSF+LC+ I+  +G +   EW F L   GG+    P      W+    W+ +  + D+     +      Q       G   I   NE Q     PLP                      G ++ +   FQK++L++    +KI  C+  FV + LG +++EPPP DL   F D +  +PL+FVLS GSDP     +FA ++
Sbjct:  688 LYETTVEFQNKYKEWMEGPWGTIDPDKVESETGNYWRSLYKLEKQLTEVPLAQRIAGRMKTKVEEFKEYLPLVQVVFNPGLRDRHWEQMSEILGFPL-KPDEDMNLAKMAEMNLEPYLAQFETISEAASKEFSLEKAMEKMVGEWDAVEFVMIPYRET-GTHILSSIDDIQTLLDDQIVKTQTMRGSPFIKPFENEIKEWEGKLILTQEIIDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKNWRETMKVAVLDKHVLTVIGIEKMLGKLKKSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLQFTD-----------------------TLDITHMKSSEGELVLLKDVISTSKARGQVEKWLLELQEDMVASVRKVIMEAMEAYLKEERVKWVRDWPGQTVLCVTQYYW----TAEVHKAIRGGQKQLDQYLQQNNSQIDDIVTLVRGKLSKQNRATLGALVVLDVHARDVLTKLCELGISSEDDFEWLAQLRYYFEE--ENVMTRMISAHLAYGYEYLGNSGRLVITPLTDRCYRTLFGALQLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQMGIKSGGDTLLFEGTEIKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPNYAMIAEISLYSYGFVNARSLAVKIVTTYTLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPDENEDILMLRSINDVNLPKFLAHDLPLFAGITSDLFPGVQLPKPDYTVLTAAAAEVCKSMNLQMVDEFLTKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAKALSDVAEKGLMEE----NKVQIVVINPKSITMGQLYGQFDPVSHEWSDGVLAVNYRAFASSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLNSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWKPLLTSWLHTLPKTLNEENKELIKDLFDRMEEALLQFIRKGGFKELSPTNDTNLVNSHMNMMDTLMDEFHDEQRFKELNEREVAAWLECIYLFSCVWSLGATLDGEGRKSFDKLLREIVEGPLSLESKSKYHILEIVDPPPRPFLCPFPSKATVYDYRFIKEGMGKWELWTEEIKDAPPIPKDMAFNEIIIPTVDTVRYTYLMEQLVTHGKPSLFVGPTGTGKSVYITNFLLKKLEET--YKPLLINFSAQTTAKQTQDIIMSKLDKRRKGVYGPPLGKKTVVFVDDLNMPAREVYGAQPPIELLRQWLDHWQWYDLKDTSPIHLVDIQILAAMGPPGGGRNPITPRFLRHFNTISITKFDDGTMVKIFSRIMNWHLTTNASCRGFSKDFGP----IGDMLVNGTLEIYRNAIVNLLPTPAKSHYLFNLRDFARVIQGTLLSAPDRITEHDMLKRLWSHEVFRVFYDRLVDGGDRDWLYNNLREVCKSHL--NVEFDTLFQRLDFDGDGKVKEDDLRSLVFCDFTDAKADP--KPYVEVEDLDKLRGVVENYLDEFNNMSKKPMTLVLFRFAIEHVSRISRVIKQPRGHCLLVGVGGSGRQSLTRLAAHMADFDLFQVEIGKGYTSTEWREDIKAILRKTAEGETNGVFLFTDTQIKEESFLEDINNLLNAGEVPNLFPLDEKQEICEKMRQFDRQRDKSKQTDGSPVALFNYFIERVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPADALQVVAQRFLEECEI-EADVKEGCVEMCKSFHTSTRDLSLRYQSELKRHNYVTPTSYLELISTFKALLNKKQQEVVKAKRRYEVGLEKLNSAQSQVASMQEELEALQPQLIQAGKEVDDIMVIIERDSIEVAKTEKIVKADEAVANEQAMAAKAIKDECDKDLGEAIPILESALAALNTLTPADITVVKTMKSPPAGVKLVMEAICILKGVKPDRIPDPSGSGKKIEDFWAPSKRILGDMKFLQGLQTYDKDNIPAPAIKQIRQKYTSNPEFDPDKIKVASTAAEGLCRWVIAMDSYEKYDHLTTTFKSIDLLLMSVLCDFQG-LNKKRAALKEVQDKLARLQEKYEANVKKKSDLEKQVDLCSKKLDRAEKLIGGLGGEKTRWTEVANALGVRYTNLIGDVLVSSGVVAYLGAFTAAFRQ-------GTCRAYSSSGRLVEYGRVLVALIAQPVKIRDWTIFGLPTDSFSIENGIIINNANRWPLMIDPQGQANKWIKNMEKKNNLHVIKLTDADYVRTLENCIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGSICIKVGDSVIEYSKDFRFYITTKLRNPHYLPETAVKVTLLNFMITPEGLEDQLLGIVVARERPELEEEKNALILQSAENKRQLKEIEDKILEVLSSSEGNILEDETAINVLSSSKVLANEISEKQAIAEETEEKIDKTRMGYTPIAVHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSEKSEELDKRLENLRNHFTYSLYCNVCRSLFEKDKLLFSFLLCVNILMHDGEVCRDEWRFLL--TGGVGLDNPHSNPASWLPSRSWDEICRLDDM-----SKFKGFRQKFPRTLEGWKKIYDSNEPQT---MPLP----------------------GEWEEKFDFFQKMVLLRCLRPDKITPCVQNFVTVKLGKKYIEPPPFDLGKAFADSNSCAPLIFVLSPGSDPTAALLKFADDQ 3367          

HSP 2 Score: 474.167 bits (1219), Expect = 1.310e-133
Identity = 258/596 (43.29%), Postives = 363/596 (60.91%), Query Frame = -3
Query:   72 QGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAF--NEMS-PQFFE-THVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVED-YKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILD---VQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGR------LNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMP-KMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1811
            QGQGP+A +M++ A K G WV LQNCHLA SWM  LE++ ++   NP   H +FRL+L+S P+  FP++VLQN VK+TNEPPKG+RANI R++  + +S P+FF  T      ++K++FG+CFFH+++ +R++FGPLGWNI YEF+++D   ++  L MF      +Q++AL Y+T E  YGGRVTD  D+R L  IL  F+ P  I +D YK+S SG YY P+      Y ++  SLPL+  PEIF MH N    F ++ + + I+ +      Q  + +GG GR+ D+IV  +++ IL K+          P  F  D   R        S+ TVL+QE+ RFN+L+ V+++SLV ++KAIKG VVMS ELE V +     ++P LW   +YPSLKPL ++V DL  R      W   GAP  FW+ GFFF Q FLTG+ QN+ARKY  PID L+F+F                      EV+E  K+ + P DGV V+GL+M+G RWD +   I  S    +   LP+M + P K +   +   Y++P+YKT ER G LSTTG STNFV+ + LP+DQ    W+  G AL+C+
Sbjct: 3381 QGQGPIALRMIEKAVKDGTWVVLQNCHLATSWMPTLEKLCEEL--NPDTTHPDFRLWLTSYPSPNFPVTVLQNGVKMTNEPPKGIRANIIRSYLGDPISDPEFFTGTGQKSPQFKKMLFGLCFFHALVQERRQFGPLGWNIPYEFNETDLRISVQQLHMFMNKYDEVQYEALKYLTGECNYGGRVTDDRDRRTLLTILNKFYTPGVIKDDRYKFSPSGNYYAPDDGDYETYIEYARSLPLINHPEIFDMHANV---FSLRTSMRHISVLTHQTCTQCVLLSGG-GRSDDEIVASVSEDILSKM----------PQEFDTDAALRKFPTTYTQSMNTVLVQEMVRFNRLIKVVRSSLVNIQKAIKGLVVMSSELEEVVSGILKGKIPGLWMKKSYPSLKPLGSYVNDLLARLKFLQDWYDNGAPSVFWISGFFFTQAFLTGSKQNFARKYTIPIDLLTFDF----------------------EVLEDKKYETPPEDGVYVNGLFMEGARWDRDTKAIGESQAKVLFDSLPVMWLCPCKTEDIKKRPHYVTPVYKTSERRGTLSTTGHSTNFVMEMRLPSDQPQEHWVMRGVALLCQ 3938          
BLAST of SMED30008756 vs. Ensembl Nematostella
Match: EDO34727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG1])

HSP 1 Score: 1965.27 bits (5090), Expect = 0.000e+0
Identity = 1167/3004 (38.85%), Postives = 1706/3004 (56.79%), Query Frame = -2
Query: 1837 QLMLPSPQRCLDV--INEMLPVIARKEVDALIK----ESQDAEYTLCNE-----------PTNTVDYVNALNFLSEIQ-VRMEPLEREADVIKE-MYDLIDAFNVPTPPEDFAVYQTLYP-----------SIDRAKNAIDKALADRDGNIDKFCASLD---KDIAELRR-EVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGL----PPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGL---KARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLL-------VGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVR---------------------NKFEDNGDCR----MPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA-DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYF--------------GENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVS-EGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD---------------WASAKSVLGDPYFLKKLADYPKDNIPEALLKKLK-RYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYG 10533
             L +P    CL+   +N+ L + A K  D +I     +++D    +C +           P NT D V    FL +   V +  L+   D   E +  L+D   +P   ED  +  T++            S +R  +  D A+ D    +  +   L+   K++   R+ E+    +   N   LD      +   +     NT  EL              + E  +   L+ + A  +  + LW +   + +++  WL   F+++N ED+  +     + V +L K       P +V   ++ K+++ +  + ++  + NP ++ERHW Q+ +++ +   + E   +L  ++E N+  + + LEEISG AS E  LE  ++K++  W    +  +P++D+  V IL   D+IQ L DD  +   T++ S  + P +  +  W + L L    I+ WL CQ  WLYLE IFS+ DI  Q+P E + F  VD  +K+IM +  K    + AT  P +L   + +NQLL++IQK L AYLE K++ FPRF+FLSNDELLEIL++T++PL VQPHL+KCF+ I++L+F                  + QEV      + M+S E E V     +   KA+G VE+WL +VEE M  +L+K+   ++  +    R +W++    Q  L                               K  + ++++  LVRG L    R TL AL  ++VHARD+  +M  + V  +  F+W  QLRYY++      +VRM  +   YGYEYLG S RLVITPLTDRCY    GA +        GPAGTGKTET+KDLAK++AKQCVVFNCSDGLD+K MG+FF GLAQ+GAW CFDEFNRI++EVLSV+AQQ+ TI+ A A    +F+FEG E+ L  TC  FITMNPGYAGR ELPDNLK LFR +AMMVPDY LI+E+ LYS GF ++++LAQK+   Y LCSEQLS Q HYD+GMRA+KSVL  AG LK   PD  E  +++RA+ + NL KFL QD  LF  I+ DLFPG + P  DYG     +        LQ     + K+IQ YE + VRHG M+VG   GGKT  + VL++ +++LN AG       +Q V   I+NPKSITMG+LYG  + ++ EW DG++    R     T++D +W+I DGPVDA+WIENMNTVLDDNK LCL + E I+++    ++FE  DL  ASPATVSRCGM+Y++P +LGW P ++++LN++   L  E  + +  +F+  ++  L F +  C   +    +  +    RL   L+          GA  ++  +Q++   +   ++F  +W IGG L+  +   FD F R                     N F D G       +      W ++ +L  +     + ++P     K     E+ + T DT R  + LE  L  +  +LF G TG GKS +    L  + +   Y+PV INFSA+TS+ +TQ++I  KL+++RK V G P  K+ ++F+DDLNMP  + YG+QPPIELLRQ  D G +YD    + + + D+   +A GPPGGGRN ++ R +RH  + SI +  + ++ +IFTSI    FA  F    +   + +V+A +++Y       LPTP+KSHYVFNLRD ++ + G L    + + +   + +L+ HE  RVF+DRLI+  D+  F +++ +   + F              G+ ++ E    L   FGD+M P  E  +++Y+ ++D   +   + +YLD++N  S   M LV F  AI+HI+R++R+++QD G+ LLVG+GG+G+QS TRLA FM  Y+ FQIE+ + Y    +  DLKK+    G++ + TVFLF+D QI  E F+EDIN ILN+G+VP++F  DE   +I   +  A+  G   +     ++ F I+RVR NLH+VL MSP+G +FR+R RMFPSL+NCCTIDWF AWPE+AL  VA    E VDI   E+K +   MC   H SV   SER+Y  L+RH Y TPTSYLELI  + ++L  K+ +++  ++R   GL K+      ++ M+ EL  L+P+L Q   +TE LM K+  D  + +  ++ V  DEAVA   A   Q I ++ + DL EA+PALE A+KALD L  +DI+ ++   NPP  V+ VME+VC++   K +               W S++ +LGD  FL  L  Y KDNIP  ++KK++ +Y+ +P F  +N+  VS AC  L  WVRAM++Y +  K V PKK++L  A  EL   M KL  K+AEL  V +K+  L   +D   T+KK LE N+ L   +L RA KL   L  EKERWTE+     +    V GDV + +  VAY G FT  +R+E + GW+  C   +IP SE  +L   LGDA ++R WN  GLP D  S +N I+V   RRWPLMIDPQ QAN+WI+N E  N+L +IKLS+ N++RTLEN I  G P LLE+IGE LDP LEP+LLKQTF + G   + LG++ IEYS+DFK Y+TT+L NPHY+PEI +KVT++NF +TP GLEDQLLG V   E+PELEE++N LI+   ++K QL+  E++IL++L  SEGNIL+ E  I  L+ SKV S E + +   A  TE++I   R+ Y PVA   SV++F ++++A I+PMYQ+SL +F  L+  +I NS++S +L ERI+ L    T + Y+NV R LFEKDKL+FSF+L I I++    + D  W F L G   ++   P  P   W+    W+ +V  SD +P    L +D+                N      Y    P                ++S+   +DL L+   ++++++    +KIV  + +F+  N+G  ++EPP  +L L + D    +PL+FVLS G+DPM    +FA +K   G
Sbjct:  589 HLTVPLNMLCLNCQEVNQELSLRASKLADTMIHYVVDQNRDKNRGICRQYDEVSDKVQEMPDNTKDLVTLTQFLEKASTVMVVQLQSHVDDAGERLLFLLDYATLPY--EDIKLNSTVFHWPEHIQKIFELSKNRIGHRKDLAMDDLKHRVKMYEEKLNGYNKEVEAFRKKEIMAAEEMKKNVEKLDELGTALDAARDELMDLNTEEEL-------------LQWEPTQFPILQSMMAYKEPYEKLWRTALNFQNKHEAWLNGPFVEINAEDVEEEIGGMFRTVIKLSKTFGDSPAPRRVAESVRSKIDKFKVHLPLLQVICNPGIRERHWTQMSEVVGFDI-KPEASTSLCNMLEYNLHKHLDRLEEISGSASKEFGLEKAMEKMKVEWNDMFFEFVPYRDT-GVSILSAVDDIQMLLDDHIVKAQTMSGSPFIKPFEAEIKSWCEKLILMQDIIDAWLKCQATWLYLEPIFSSEDIMAQMPEEGRKFGIVDSYWKDIMTESVKDTKVLVATGQPNMLGRLQESNQLLEEIQKGLNAYLEKKQLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIARLEFT-----------------EEQEV------VGMVSAENETVPFSTKIVPAKAKGMVEKWLIQVEEVMMDSLKKVAGDAVAAYVNTVRGKWVQEWPGQEYLE------------------------------KSNKQIDEIVALVRGKLDPGVRVTLGALTVIDVHARDVTAQMAHDGVHSLEDFQWLSQLRYYFEEK--RVIVRMITTSINYGYEYLGNSGRLVITPLTDRCYR--HGAPE--------GPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDFKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQIHTIQKAIAEHKKKFIFEGTELVLNPTCTMFITMNPGYAGRQELPDNLKVLFRTVAMMVPDYALISEISLYSMGFLNARSLAQKIVATYTLCSEQLSSQSHYDYGMRAVKSVLTAAGNLKLRYPDDDEAELMLRAVLEVNLAKFLSQDVPLFEGIISDLFPGTKWPNPDYGVLMDSLRENCSRRNLQATDWYMKKIIQVYEMMIVRHGFMIVGDPLGGKTMAFKVLSEAMTDLNKAGYP-----FQKVIYKIINPKSITMGQLYGCFDPVSHEWSDGVLANSFRDFASSTTEDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKQSLIFEPADLEQASPATVSRCGMIYMEPYQLGWKPLMESYLNTLPESLSKEHRETVRLLFDWLMEPCLNFIRHDCKFFLTSSDMHLVTCFQRLYSCLMDEIRAQDHAEGADRMS--SQQITNWLMGLYIFSMVWSIGGTLNGDSRKKFDAFFRLLISGTDKDHPKPKEIKMSKQNVFPDRGTVYDYYFVKQASGSWGNWIELTHKG----KSVIP-----KTAKASELTIETDDTARQIFFLETFLTHEVPMLFVGPTGTGKSAITNSYLVKLPKEK-YLPVNINFSARTSAGQTQDIIMGKLDRRRKGVYGPPPGKKCVMFVDDLNMPAKEKYGAQPPIELLRQLLDHGHWYDPKDTSKLELLDLLFVSAMGPPGGGRNDITGRFVRHANVISIDSFDDNTMNKIFTSIADWHFAKGFDATFQRLGKIVVMATMQVYKSAVDKFLPTPSKSHYVFNLRDFARVMFGTLLVPSTHLNEGDKLIRLWIHEVYRVFYDRLIDDTDRQMFFEVIKDTIKQQFKLEMDRLVGHLVPTGQKLKDEHIRNL--FFGDYMAP--ESPDKIYDEVSDLKALTTQMEAYLDEYNQMSKTPMSLVMFKFAIEHISRVSRVLKQDNGHCLLVGIGGSGRQSATRLATFMADYDLFQIEITKNYTKTEWRDDLKKMLIKAGVDGKPTVFLFSDNQIKEESFVEDINMILNTGDVPNIFAADEKADVIEKMQTVARVEGKKIDATPLAMYNFFIDRVRCNLHVVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEEVDISL-EVKKQCVFMCKYFHESVRMLSERYYETLRRHNYVTPTSYLELIMTFKTLLDIKRNEILALKNRYLTGLEKLEFAASQVSVMQKELSDLQPELIQTSAETEKLMVKIEQDTVEVEAKKEIVAADEAVANEAAGVAQGIKEECEGDLAEALPALEAALKALDTLKPSDISMVKSMKNPPGAVKLVMEAVCIMKSVKPERKPDPSGSGRMIEDYWGSSQKILGDMKFLDSLKAYDKDNIPVPVMKKIREKYVTNPEFNPDNIRTVSSACEGLCKWVRAMEVYDRVAKVVAPKKEKLAAAEAELAIQMEKLNLKRAELKEVADKLQALNDEFDAMTTKKKELEANIDLCEKKLDRAEKLIGGLGGEKERWTETARLLEDRFFKVTGDVLLSSGEVAYLGPFTVDFRNECIDGWVKECTTRKIPCSESFSLNATLGDAVKIRAWNICGLPVDAFSVDNGIIVDNARRWPLMIDPQGQANKWIKNMEKENKLSVIKLSDANYVRTLENSITFGTPVLLENIGEDLDPILEPLLLKQTFKQGGVEYLKLGENSIEYSRDFKFYMTTRLRNPHYLPEISVKVTLLNFMITPLGLEDQLLGIVAAKEKPELEEKKNELILESAHNKKQLKEIEDKILEVLSSSEGNILEDETAIKVLSSSKVLSEEISAKQEIATATEKEIDETRNGYKPVATHSSVLFFCISDLASIEPMYQYSLTWFINLYLQSILNSERSPELSERIEFLNDHFTQSIYSNVCRSLFEKDKLLFSFILTIGILKGRNKVDDQVWRFLLTGGVALDNPYP-NPCPEWLGDKNWSEIVRASD-LPNLKGLKDDL---------------ANPGWKKFYDSSTPQ---------------SESMPDPWDL-LSGLDRMVVLRCLRPDKIVPAVQDFIVENMGRSYIEPPTFNLQLSYDDSHCCAPLIFVLSPGADPMAGLLKFANDKGFGG 3455          

HSP 2 Score: 425.631 bits (1093), Expect = 7.254e-119
Identity = 244/596 (40.94%), Postives = 339/596 (56.88%), Query Frame = -3
Query:   72 RVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAF-NE--MSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEK---LIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPEST-KYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1835
            R+Q ISLGQGQGP+A  M+D A K G WV LQNCHLA SWM +LE+I ++   NP + H++FRL+L+S P+  FP+S+LQN VK+TNEPPKGLR+NI R++ N+     +FF        W KL+FG+CFFH+++ +R+KFGPLGWNI YEF++SD   ++  L MF  D   I  DALTY+  +  YGGRVTD  D+R L  +L+                           I   +D VD+                      ++ + L + IL   PR  +GG G++  +++ ELA  IL K   L D     +  P ++        +S+ TVL QE+ RFN+L +V+ ++L  L+KAIKG VVMS ELE V+      +VP +W+  +YPSLKPL ++V DL  R      W+  G P  FW+ GF+F Q FLTG  QN+ARKY  PIDH+ FEF V K+ R+ +                       P DGV V+GL+++G RWD E   +  S+   +   LP+M ++P    + +S   Y  P+YKT  R G LSTTG STNFV+ V LP+D+    W+N G AL+C+
Sbjct: 3457 RIQTISLGQGQGPIAAGMIDQALKKGTWVVLQNCHLATSWMPKLEKICEEVI-NPDDTHQDFRLWLTSYPSPDFPVSILQNGVKMTNEPPKGLRSNILRSYLNDPISDSEFFTACNKPAAWEKLLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISMRQLQMFLNDYDEIPLDALTYLIGQCNYGGRVTDDKDRRLLVCLLS---------------------------ICVCRDIVDN----------------------EKHKNLFDCILLTLPR-QSGGGGKSPAEMIEELAADILSKFPPLFDLEMVIKKYPVIY-------TDSMNTVLRQELIRFNRLTAVVISTLRNLQKAIKGLVVMSGELEDVFNNMLLGKVPAVWAAKSYPSLKPLGSYVTDLLDRLKFFQDWIDHGPPNVFWMSGFYFTQSFLTGARQNFARKYTIPIDHVGFEFNVMKEERDMDH---------------------KPEDGVYVNGLFLEGARWDRETMLVAESLPKILFDTLPVMWIIPGEKSKFKSKPNYPCPVYKTSARRGTLSTTGHSTNFVMFVDLPSDKTERHWVNRGVALLCQ 3973          
BLAST of SMED30008756 vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 1735.31 bits (4493), Expect = 0.000e+0
Identity = 1017/2738 (37.14%), Postives = 1571/2738 (57.38%), Query Frame = -2
Query: 1819 DLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPH-KDSKDV-FILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEF-DTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVR-ITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYID-----------DGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIA-FVFCYLWGIGGNLHESNWDSFDNFVR-------NKFEDN--GDCRMPS-QGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDK-LNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQK-TDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELL-SGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIP-VFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYI 9942
            +L+++  ELK  + ++   ++     +EW    +  L+   L      Y+K + +L + +    +  VL++K+++ +  + + ++L N  L+ERHW+++ D+   KF  + E  TL  +  + + ++ + + +I+  A+ E  +E  + +V + W   ++ V  + K +++  F+LG  DEI Q+ DD+ +N+ ++++SR VGP    V++W K+L   G+ +E W+  QR W+YLESIF   DI+ QLP EA+ F  +DK++K+IM    K P  + A   P  LD  +     L++ QK L  YL+SKR  FPRF+F+S+DELL IL  + +P  VQ H+ K FD I+ L F               Q    +E   T    AMIS EGE +   + + A G VE+W+  V + M    R + +++I  + + + R EW+  +   + L   Q+ W  E+  +   V +    GM ++  KC + ++ L   VR  L K  R     ++ + VHARD++   V++ + D   FEW+ QLR+YWD   D  ++R     + YGYEY+G + RLVITPLTDR YL +  AL + LGGAPAGPAGTGKTETTKDLAK+L   CVV NC +G+D+K +G+ FSGLAQ GAW CFDEFNRID+ VLSV++ Q+ T++N+ ++ + R  FEG EI L      FITMNPGYAGRTELP+++KALFRP+  +VPD + I E++L+SEGF  +K LA+KMT +YKL S QLS+Q HYDFG+RALK+VLVMAG+LKR +P+  EDVVL+RALRD NLPKF+ +D  LF  ++ DLFPG++ P   Y  F   +E  + ++   + P Q  KV+Q YET+  RH  M+VGPTGGGKT V N LA   + L               K+Y++N K+ T+ ELYG ++ +T +W DGL+  I R I       + ++++ DG VDALW+ENMN+V+DDNK+L LAN ERI+L  +  +LFEV DL  ASPATVSRCGMVYVDP+ LG+ P+ + W N+ +   + E +D L   FEKY+            DG +  + K I  +  +++  ++ +  +L++LL  P A + N     L P +  A F+   +W  G  L E     +D  ++       N  E    G   +PS Q  L+  Y D        W  +VP +  N ++ + E++VPTVDT+R  +LL+ ++++ + VL  G TG  K+      L  + ++   + + INFS++T+S   Q  +E  +EK+ K   G P  KR+++F+DD+NMP++D YG+Q PI LL+   + GG YDR K L W  ++D+   AA G PGGGRN V  R +  F++F++  PSE SLR+I++SILTG    FP+ ++   E+I  + +E+Y  +  DL PTP+K HY+FNLRDLS+  QG+    P      +   +++ +E  RVF DRL N  D+      ++ +  + F E+ +    ++ P +FGD+ +  L +  RLYE + D+   K I    L+++NM  +  M LV F DA++H+ RI R+IR D+G+ALLVGVGG+GKQSLT+LAAF  G   F+I L RGYD N F  DLK++Y   G+ N+  VFLFTD  +  E FLE INN+L SG VP+L+  DE E +I   R  A +AGV    R+ I+++ +N+  NNLHIVL MSPVG   R+RCR FP L                            D   D+ +  +      +H +V   S+ F  +L+R  YTTP +YL+ I+ Y  +L  K K ++ +  R++ GL K+L  +E +A +  +L   +  + +K +  E L+ ++    +QA+  ++     +     + K       +A+  L  A+PALE A  AL  LDK+D+ EIR F  PP+ VQ V E +  L G K   W SAK+++ +  FLK L +   D I    +KK +  + + N T E +++VSKA   L  +V A+  Y    + ++PK++++    +       +L + + EL A+E ++  L K YD+++ EK +L+    +   RL  A KL + L  EK RWT+ +    ++   ++GD  +GAA ++Y GAFT  +R ++L   W     + EIP+S+   +  +L +  E+ +W SEGLP D +S EN IL T+  R+PL IDPQ+QA  WI+ KE  N LK++  ++ +FL+ LE  I+ G P L +D+ E +DP ++ +L K    + GR  + LGD +++Y   F+LY+ TKLSNP Y P    +  ++N+TVT +GLEDQLL  +  +ER ELEEQR  LI   + +K  L+  E+ +L+ L  S+GN+LD+ +L+ TL ++K  + E ++++     T   I   R  Y P A  G+V++FV++ M+ ++ MYQ+SL  +  +F+ ++  S     L +R+K ++   T+  YN    GLFE+ KL+FSF + I+IM  +G +   E +FFL+G   +EK   +KP+  W+    W +V+ +  + P VF +L +DI                 E     +R           + S LD+  +    G Y+  L+ FQ+L+L++ F  +++ L IT FV   +G ++V PP      + +  +  SP++F+LS GSDP +   + A+     G    ++
Sbjct: 1109 ELQQMEKELKGLEQVFGIYEKQKEARDEWANTLWANLDVSVLSDGIDGYIKQLKRLPREVKALPLCHVLEEKMKEFKNSIPLFSDLKNEALRERHWKKLMDMTGMKFDLNPETFTLQNMFAMELHNFSDVIADITASATKELGIEKGIAEVSDTWNAMKFTVAKYMKGTQERGFVLGTVDEILQILDDNAMNLQSMSASRFVGPFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNRLDQLQFIVNGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SHDPTCVQEHMIKMFDNIASLRF---------------QEGSNKETLAT----AMISSEGESMDFRQAVPAEGRVEDWMTSVLKEMRRTNRLITKEAIYNYCNQITRIEWMMQYQGMVALAGNQVWWTWEVEDVFRKVKKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKNDRKKFNTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRFYWDQAPDELMIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTITQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVSTQIKTLQNSLSSGLKRLQFEGTEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVCIVPDLQQICEIMLFSEGFLYAKVLAKKMTVLYKLASGQLSKQSHYDFGLRALKAVLVMAGELKRGSPELSEDVVLMRALRDMNLPKFVFEDVPLFLGLIADLFPGLDCPRVRYPNFNDAVESSLTDNKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVINTLAMAQTRLGMH-----------TKLYVMNAKACTVIELYGTLDPVTRDWTDGLLSNIFREINKPTDKNERKYIVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGYRPYWQKWCNARSNAKEREELDRL---FEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNM--VEQLSHMLDALL--PPAESSNF----LGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLIKRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDSKKLLWVPWLDVVPEYVHNPDLKYNEILVPTVDTVRTTWLLQLMVNIHRPVLLVGETGTSKTATTANYLRGMDQDTTLL-LNINFSSRTTSINVQHNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPQVDEYGTQQPIALLKLLLEKGGMYDRGKELIWKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHLQPFPKNIQDLVEHITTSTLELYTNIIRDLPPTPSKFHYIFNLRDLSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEADRETVSGYISSLVDQNFSEHTDIA--MRDPCLFGDY-RNTLTEDPRLYEDVVDYDATKAIFEEILEEYNMDHAP-MNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANKAGVPPA-RESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPGL---------------------------NDKIPDQYRETVVDHVVFVHQTVGTYSQSFLQKLRRVNYTTPKNYLDFISTYNRLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAELNEKLAVQKIAVTEKSEACEKLLVEIQRATQQANEKKEMAIGKKKEIAEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSECIVALRGYKEISWKSAKAMMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWENDVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQALNWIKKKEEKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYIDPVIDNVLDKNIKGEPGREFVVLGDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKNIMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLKGNIALEKSSRQKPYS-WMPDQGWEDVIRLCQVTPEVFGSLADDI-----------------ERNEKGWR-----------EWSDLDAPESHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKYVTPPVLSFESILEQSTPFSPVIFILSPGSDPASDLMKLAERSGFGGNKLKFL 3742          

HSP 2 Score: 294.278 bits (752), Expect = 4.996e-79
Identity = 181/609 (29.72%), Postives = 306/609 (50.25%), Query Frame = -3
Query:   81 RVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSD-REC-----AILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRN---------ILTTF--FHPKTIVE-DYKYSQSG-IYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDE-KGRLNSLT---TVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPE-STKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAAL 1835
            +++ +++GQGQ  +A ++++ A   G W+ LQNCHL   W+  LE+++++ S+     H +FRL+L++ P   FPI +LQ S+KV  EPP GL+ N++  ++++S Q          +  L+F + FFH+++ +R+K+G +GWNI Y+F++SD R C       L   +   D  I W +L Y+  E+ YGGRV D +D+R ++          I  TF  FH     E DY   ++G   Y P  +    Y D+++ LPL   P++FG+H NA + +     + +   ++++QP+ A    G + ++ + ++A  I  KL          P LF  D  +  L+ +T    VL+QE+DRFN L+  +  SL+ L++A+ G V MS EL+ V  +  N  +PN+W  +A  +LK L  W++    R      W+  G P   WL G   P  +LT  +Q   RK+ +P+D  +    V K Y N +EV ++                     G  V GLY++G  WD     +       ++  LP++ ++P   +  +    + +P+Y T +R        M    V    L T + ++ W+  G  L
Sbjct: 3738 KLKFLAMGQGQEKLALQLLETAISRGQWLMLQNCHLLVKWLRTLEKVLERISKP----HPDFRLWLTTDPTPEFPIGILQRSLKVVTEPPNGLKLNLRSTYHKISNQML-ADCPHQSFSPLVFVLGFFHAVVQERRKYGKIGWNIAYDFNESDFRVCMTLLNTYLTKSLQNTDVKIPWASLKYLIGEVMYGGRVIDDFDRRVVKTYMDEYMGDFIFDTFQPFHFYNNEEVDYCIPKNGENKYDPGRDV---YVDYIEELPLANTPDVFGLHPNAEIGYYTNAAKDMWLHLVELQPQTAGDSGGISREEFITKIASDIQGKL----------PPLFDVDRVRKNLSEITPTAVVLLQELDRFNVLIRRMSTSLINLQRALAGEVGMSSELDEVSRSLFNGMIPNIWRKLAPATLKSLGNWMEHFQKRLDQYNKWVNDGEPAVIWLSGLHIPDSYLTALVQATCRKHGWPLDRSTLYTTVTK-YHNADEVTERAH------------------SGCFVSGLYLEGASWDLAESCLRRPKPKVLVEELPVLKVIPIESHRLKLQNTFRTPVYTTSQRRN-----AMGVGLVFEADLATTEHTSHWVLQGVCL 4304          
BLAST of SMED30008756 vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 1709.5 bits (4426), Expect = 0.000e+0
Identity = 1002/2418 (41.44%), Postives = 1429/2418 (59.10%), Query Frame = -2
Query: 1747 ILAMISPEGEKVSLGKGL---KARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQ-INPSQVL--KVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKI-EVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFE------------DNGDCRMPSQGDLWSSYADLHSR-KMDLWEKIVPVFKFNK-EVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFAD--FPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYF-------------GENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKK-IYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVS-EGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDK-NDIAEIRVFTNPPQMVQTVMESVCLLLGQKTD---------------WASAKSVLGDPYFLKKLADYPKDNIPEALLKKLK-RYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKR--IAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYG-KSSSYIFGSRTG--------TCCRKNDGRCCENWRLGI 8802
               M S EGE+V L + +   +A G VE+WL ++E+ M  ++R ++ +S   ++   R +W+K    Q+VL   Q+ W  E+   L         G+  +  +    LN++  LVRG LPK  R TL AL+T++VHARD+V +++ EKVSD   FEW  QLRYYW +  DN  V + N    Y YEYLG SPRLVITPLTDRCY  L+GA  L+LGGAP GPAGTGKTETTKDLAK+LA QCVVFNCSDGLDY  MG+FF GLA SGAW CFDEFNRI++EVLSV+AQQ++ I+ A   K+  F FEG  +KL   C   ITMNPGYAGR+ELPDNLK LFR +AMMVP+Y LIAE+ LYS GF ++K L+ K+   Y+LCSEQLS Q HYD+GMRA+K+VL+ AG LK + P++ ED++L+R+++D N PKFL  D  LF  I  DLFPGV LP  DY   KL +E   E   +  + P++V   K+IQ YE + VRH  MLVG +  GKT V +VLA  LS +N  G  EE    + V    LNPKSITMG+L+G+ + ++ EW DG++    R   +  + D +WV+ DGP+D LWIE+MNTVLDDNK LCL + E I+++  + ++FE  DLS ASPATVSRCGM+Y++P +LGW P V +W+N++   L+  +    +  +F   I   L+  +  C + +   +   +  +CRL + +L  P       D + +   I  AF    +W +GG     + + F++F+R                +  +C +  +G ++  + +   + +   W   +      +      E+IVPT+DT+R+ YL++ L   +  +LF G TG GKSV  +  L N  +   Y+P FINFSA TS+N+TQ +I +K++K+RK V G P  KR ++F+DDLNMP  + +G+QPP+ELLRQ+ D  G YD    + I++ D+   AA GPPGGGRN V++R LRH  + SI   S+ ++  IF+SI+        F  +       IV A +E+Y +   +LLPTPAKSHY FNLRD S+ IQG L      +  K  + +LF HE  RV+HDRL++ ED+ + +Q++  +   +F             G+ +E +    L  +FGD+M P LE  ERLY  +        ++ S L+++N      M LV F   ++H++RI+R+++Q  GNALLVGVGG+G+QS+TRLA  M     FQ E+ + Y    +  DLK+ +    G+  Q TVFL TDTQI  E FLEDI+++LN+GEVP+LF  DE + +I   R  A+    S E +   +F F + R + NLH+V+  SP+G +FR R R FPSL+NCCTIDWF  WPEEAL  VA S  E +++ E+E + ++  +C   HTS  + S+ F AEL R+ Y TPTSYLELI  +  ++++K++ ++  + R  NGL ++      +A M+ ELV L+P+LEQ + D   +M+ +  +  + +     V  DE  A +KA E QA+  + + DL EA+PALE A+ ALD L + +DI+ ++   NPP  V+ VM +VC++   K D               W  +K +LGD  FL+ L +Y KDNIP  +++ ++  ++ +P+F    V   S A   L  W+ AM++Y K  K V PKK +L  A + L      L QK+AEL  VE+++  LQK ++    EK  LE  +   + +L+RA KL   L+ EK  W+++         N+ GDV + A  +AY G FTS +R      W   C+   IP S+  +L   LG+  E+R WN  GLP D  S +N ++V   RR PLMIDPQ QAN+W++N E  N L +IKL++G+++RTLENCI+ G P LLE++GE LDP+LEP+LLKQTF K G   I LG+  IEYS DF+ Y+TT+L NPHY+PE+  KV+++NF +TP+GLEDQLLG V   E PELEE+R  LI++  N+K QL+  E+ IL+ L  S+GNIL+ E  I  L+ +K+ S E TK+  I  AE TE KI  +R  Y  VA   S+++F +A++  IDPMYQ+SL +F  L+ N+I++  KS+ L++R++ L    T   Y NV R LFEKDKL+FSF+LC  ++ +   I   +  F L G  G++      P   W+    W+ +   S+ +P F  L              E  I   E+    Y    P                +  L   +  +L   QK+I+ +      +V  +T+FV  NLG +FV+PP  DL   F D +   PLVFVLS G+DPM    +FA +KK+ G +  S   G   G        T  +     C +N  L +
Sbjct:  803 FFPMYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRS-RAYEKTARNQWVKEWPGQVVLCTSQIFWTLEVHKAL---------GLKKYYQQLQNQLNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLI-EKVSDETDFEWLAQLRYYWMN--DNVRVHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDFEGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADY---KLFLEAAEECCKIHNVQPTKVFTDKLIQTYEMMIVRH-FMLVGESFAGKTKVLHVLADTLSLMNERGHGEE----EKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILDEP--VKTGPDDESIRTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWNDTIENINLGEINTKGQEIIVPTIDTVRYTYLMD-LCISQGPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLDH-GHYDLKDTSKISLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKLEEKDMQNL--LFGDYMNPDLEGDERLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEMSENE-RQEVITICKTFHTSANQLSD-FQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEK-IWSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIVRNSRR-PLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTF-KQGVESIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKE-PELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSIQDI-KSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLARKE-IEHSDLMFLLTGGIGLQNTVA-NPDPSWLQDKSWDEICRASE-LPGFQGL--------------EAFIKNPEDFKLIYDSREPC---------------SIDLPAPWCEKLTDLQKMIIFRCL-RPDMVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPM-ALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAV 3151          

HSP 2 Score: 454.136 bits (1167), Expect = 4.705e-127
Identity = 254/607 (41.85%), Postives = 359/607 (59.14%), Query Frame = -3
Query:   72 KKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNE---MSPQFFE-THVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD-GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKY--SQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEA----KPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEML-GVLPIMHMMP-KMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1853
            KK    R Q+ISLGQGQGP+A KM+  A + G WV LQNCHLA SWM  LE+I +  S      H++FRL+L+S P+  FP+ +LQN VK+TNE P GLR N+ +++       P FF        VW KL+FG+CFFH+++ +RKKFGPLGWNI Y F++SD   ++  L  F  +   + ++A+TY+T E  YGGRVTD WD+R L   L  F+  + I++ ++Y  S SG Y+ P   +  +Y  F+++LP+ ++PE+FG+HEN ++S  +Q+T+ L +++L  Q   A GG     D+ +Y++A+ IL + +      EA     P L+         S+ TVL+QE++R+N L S I  SL  L KA+KG VVM  ELE+V       +VP  W+  +YPSLKPL +++ D   R      W   G PK FWL GFFF Q FLTG +QN+ARKY  PID L+F+F                      EV+  DK  + P DGV V+GL++DG RWD E   ++T     +L   +PI+ + P K +     + Y+ PLYKT ER G LSTTG STNFV+A+ L T +    WI  G A++ +
Sbjct: 3108 KKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTT--CHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDKVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYC-EDIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYE-------ESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDF----------------------EVLPIDKSETPPEDGVYVNGLFLDGARWDKEG--VLTEQHPRILFDSMPIIWVKPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQ 3679          

HSP 3 Score: 168.318 bits (425), Expect = 1.308e-40
Identity = 88/255 (34.51%), Postives = 150/255 (58.82%), Query Frame = -2
Query: 8998 PPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRF 9762
            P   +  ++ +++++ ++ + V++ L NP L+ RHW+++  I  +  + +    +L KL++L +  + EE E IS  AS E SLE  ++ + + W    +   PHKD+  V I    D+IQ + DD  +   T+  S  V P +  + +W + L    ++I+EWL  Q  WLYLE IFS+ DI +Q+P E + F +VD++++EIM    K    ++AT+ PGLL+  +++N LL++I K L AYLE KR+ FP +
Sbjct:  555 PTVNLCSIVIEQIQKFKDYIPVVSILCNPGLRGRHWEKMSQIAGFDLTPNF-GTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDT-GVSIFTALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKIMKGLNAYLEKKRLFFPMY 807          
BLAST of SMED30008756 vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1467.98 bits (3799), Expect = 0.000e+0
Identity = 944/2921 (32.32%), Postives = 1537/2921 (52.62%), Query Frame = -2
Query: 1843 NEPTNTVDYVN-ALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILG-GTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTT--------PGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSI--TEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDL-NKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMF-EGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESN------WDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVP--FFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWIT-IQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA---DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMK-----PGLEKHE------RLYEPLTDFAKVKNILHSYLDDFNMA-SSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAK-EAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIG-EDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQK--------------TDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKK-------KRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTL-IHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKR-PEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKS--LSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKL 10410
            N P   +D +  A+  + +I+     +E +   I+E Y +++ +  P   E+    +TL    D+      +  ++ +    KF   L+ ++  L+ E ++  Q  +    + V     +V + L   +N  + L  +  TY    K F +   +   L ++  EL L Q L+   +      N +    +  +N E +  +   +     +L + L   Q    LK  +++  E   ++  + +  +  RHW++I ++  +      E   L  ++E +   YKEE+E+I   A  E  +E  LK+V   W    +     K+  ++ + G  T E+    +DS + + ++ S+R+  P K ++ +WV+ L      IE W+  Q  W+YLE++F   DI +QLP EAK F S+DKS+ +IM +  ++P  +++           P LL+        LD  QK L  YLE KR++FPRF+F+S+  LLEIL Q  +   +Q HL   FD I  + F                       K  + ILA+ S E E + L + + A GNVE WL  + +    +L  ++RQ+    + +  E  ++L + + Q+ L   QM+W R+    L +   +R  G++    + F +L N L  +    L  + R     LIT++VH RD+  ++ +  + + + FEW KQ R+Y++   D   + +++  + Y  E+LGC+ RLVITPLTDRCY+ L  AL + +GGAPAGPAGTGKTET KD+ + L K  VVFNCSD +D++ +GR F GLAQSG+W CFDEFNRI++ VLSV AQQ+  +   K  +   F+F +G  + +      F+TMNPGYAGR ELP+NLK  FR ++MMVPD ++I  V L S GF  +  LA K   +YKLC EQLS+Q HYDFG+R + SVL   G  KR NP   E  ++ R L+D NL K + +D ELF ++++DLFPG+EL +  Y   +  I+  I+ +GL  +P   LKVIQ YET  VRHG+M +GP+G GKTT   +L K ++              QP +   +NPK+IT  +++G ++  T +W DG+   + R T      +H W++ DGPVDA+WIEN+N+VLDDN+ L LAN +RI + P   ++FE  ++  ASPATVSR GMV++    LGW P ++ WL   +   + EV   L  +F     +  +F+       M  +    I     +L+ L+     P      +     +   ++F  +W  G  L   +      W   ++ +R    +    R  +  D + + A+ H      W   V  + +  +V   +  ++VP VD +R  +L++ +    ++VL  G  G  K+V+ +  ++            +NFS+ T+    Q  +E+ ++K+     G P  K++ I IDD+NMP ++ +G Q   E++RQ  +  GFY+ +K    T I D+   AA   PGGGRN +  RL R F++F+   PS  S+ +IF  I  G F     F ++V+     +VL    ++      +LPTPAK HY+FNLRDLS+  QG+L  +   +     +  L+ HE +RV  DR    +D  +F Q +A++  +  GE  +      +   F DF++      G E  E      ++YEP+  F  +K+ L+ +L  +N +     M +VFF DA+ H+ +++R+IR   GNALLVGVGG+GKQSLTRLA+F+ GY  FQI L R Y+      DLK +Y   G   +   F++TD +I  E FLE +NN+L+SGEV +LF  +E + ++       K E        + ++++ ++RVR+NLH+VLC SPVG  FR+R   FP+L++ CT+DWF+ WP++AL+ V+       DI    ++K ++          VA++   ++   +R  + TP SYL  I  Y ++  EK+ +++        GL K+ E +E +A +  EL     +L+   +  + +++++    E +++V+ +V++ +  A+       A    A+  L+ A PALE A  AL  +  +DIA +R  + PP ++   M+ V LLL ++              + W  + +++    FL +L  +PKD I E  ++ L+ Y + PN+  E     S     L+ W +AM  +    K V P K        RL +AN +L++   +L  KQAEL  V  +       Y+ ++TEK  L  +      +++ A  L + LA EKERWTE   +F  +   +VGDV +  A ++Y G F   +R  LL+ W    ++  IP   ++ +  +L DA  + +WN +GLP D++S  N I+VT+  R+PL+IDPQ Q   WI+NKE  N+L+I  L+   F   LE  + LG P L+ED+GE LDP L+ + L++ F+K G T  + +GD +++  K FKLY+TTKL NP Y PEI  + +II+FTVT +GLEDQLLG V   E+ E+E++R +L+  +  +K +++  E+ +L  L  ++G+++D E LI  L  +K T+ E  +++  A  T+ +I  AR +Y PVA RGS++YF++  M+ ++ MYQ SL  F  LF+ ++  S KS +  ERIK ++   T   Y   ARGL+E+ K +F+ +L ++I  Q   ++  E+   ++G   ++ K  P+KP + WI    W N+V++S +   FS +++ I+                                E + KS  D E  +   L   Y   L  F++L+L++ +C ++ +    ++++  +G ++ E    D+   +++ +  +PL+  LS GSDP +      K+ K+
Sbjct:  741 NRPIKDLDDIRIAMAAIDKIRKDQISIELQIGPIEESYAMLNKYKFPVQKEEGEKVETLRLYWDKLMFRSTEVQSELETLQPKFKKELESNMIVLQEECQNFYQDYDKDGPMGVGLAPQDVSDRLIMFQNQFDNLFLKYTTYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQTRCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQ-------LDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQF---------------------HEKIYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDR--GIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECG-----------QPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPN-EAEV---LRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLI-----PLKEQCGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVT-AEGHWVH---WSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKC-LNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVMN------TGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAE-------YEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNV-LEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAE-WILDMSWLNLVELSKLWQ-FSEILDQISH------------------------------HEKLWKSWFDKEAPEEEVLPNSYQ-SLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKI 3559          

HSP 2 Score: 324.324 bits (830), Expect = 9.172e-88
Identity = 183/589 (31.07%), Postives = 303/589 (51.44%), Query Frame = -3
Query:   72 ISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD----GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYAR-KYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1823
            +S+GQGQ   A K++      G W  LQNCHL  ++M  L + V +       ++++FRL++++   K FPI++LQ S+K TNEPP+GL+A +KR +  ++    +       W+ +++ + F HS + +R+KFGPLGWNI YEF+ +D    +  +     D     ++ W+ + Y+  EI YGGRVTD +D+R L      +F+      D+ + +   Y  P+  ++++Y  ++  LP  + PE+FG+H NA+++FQ ++ + +++TIL +QP+ ++ G G T +  V  +AD +LEKL     P E K       + G L  +   L QE+DR  +++ +++++L+ LK AI G ++MSE L        + ++P  W      S   L  W  +L  R      W+ +G P  FW+ GFF PQGFLT   Q  AR    + +D +              EV K MK          D     P  GV V+GLY++G  WD  N ++  S    +  ++P++ M  + +   +   Y  P+YK   R  +        N + +V L T Q    W+  G AL+C+
Sbjct: 3564 VSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETEC----INDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTN-QWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKG--YGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVK----RLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKSWASS--TLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVL----------CNEVTKWMK----------DDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNVVKDPRLYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALLCD 4111          
BLAST of SMED30008756 vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1208.36 bits (3125), Expect = 0.000e+0
Identity = 753/2181 (34.53%), Postives = 1191/2181 (54.61%), Query Frame = -2
Query: 1843 TPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMF-EGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESN------WDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVP--FFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWIT-IQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA---DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDK--SGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMK-----PGLEKHE------RLYEPLTDFAKVKNILHSYLDDFNMA-SSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAK-EAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIG-EDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQK--------------TDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKK-------KRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTL-IHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKR-PEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKS--LSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKL 8223
            T L   CY+ L  AL + +GGAPAGPAGTGKTET KD+ + L K  VVFNCSD +D++ +GR F GLAQSG+W CFDEFNRI++ VLSV AQQ+  +   K  +   F+F +G  + +      F+TMNPGYAGR ELP+NLK  FR ++MMVPD ++I  V L S GF  +  LA K   +YKLC EQLS+Q HYDFG+R + SVL   G  KR NP   E  ++ R L+D NL K + +D ELF ++++DLFPG+EL +  Y   +  I+  I+ +GL  +P   LKVIQ YET  VRHG+M +GP+G GKTT   +L K ++              QP +   +NPK+IT  +++G ++  T +W DG+   + R T      +H W++ DGPVDA+WIEN+N+VLDDN+ L LAN +RI + P   ++FE  ++  ASPATVSR GMV++    LGW P ++ WL   +   + EV+  L   F     +  +F+       M  +    I     +L+ L+  P    L     KLN  +   ++F  +W  G  L   +      W   ++ +R    +    R  +  D + + A+ H      W   V  + +  +V   +  ++VP VD +R  +L++ +    ++VL  G  G  K+V+ +  ++        +   +NFS+ T+    Q  +E+ ++K+     G P  K++ I IDD+NMP ++ +G Q   E++RQ  +  GFY+ +K    T I D+   AA   PGGGRN +  RL R F++F+   PS  S+ +IF  I  G F     F ++V+     +VL    ++      +LPTPAK HY+FNLRDLS+  QG+L C     R+     +  L+ HE +RV  DR    +D  +F Q +A++  +  GE  +      +   F DF++      G E  E      ++YEP+  F  +K+ L+ +L  +N +     M +VFF DA+ H+ +++R+IR   GNALLVGVGG+GKQSLTRLA+F+ GY  FQI L R          LK +Y   G   +   F++TD +I  E FLE +NN+L+SGEV +LF  +E + ++       K E        + ++++ ++RVR+NLH+VLC SPVG  FR+R   FP+L++ CT+DWF+ WP++AL+ V+       DI    ++K ++          VA++   ++   +R  + TP SYL  I  Y ++  EK+ ++    +R+  GL K+ E +E +A +  EL     +L+   +  + +++++    E +++V+ +V++ +  A+       A    A+  L+ A PALE A  AL  +  +DIA +R  + PP ++   M+ V LLL ++              + W  + +++    FL +L  +PKD I E  ++ L+ Y + PN+  E     S     L+ W +AM  +    K V P K        RL +AN +L++   +L  KQAEL  V  +       Y+ ++TEK  L  +      +++ A  L + LA EKERWTE   +F  +   +VGDV +  A ++Y G F   +R  LL+ W    ++  IP   ++ +  +L DA  + +WN +GLP D++S  N I+VT+  R+PL+IDPQ Q   WI+NKE  N+L+I  L+   F   LE  + LG P L+ED+GE LDP L+ + L++ F+K G T  + +GD +++  K FKLY+TTKL NP Y PEI  + +II+FTVT +GLEDQLLG V   E+ E+E++R +L+  +  +K +++  E+ +L  L  ++G+++D E LI  L  +K T+ E  +++  A  T+ +I  AR +Y PVA RGS++YF++  M+ ++ MYQ SL  F  LF+ ++  S KS +  ERIK ++   T   Y   ARGL+E+ K +F+ +L ++I  Q   ++  E+   ++G   ++ K  P+KP + WI    W N+V++S +   FS +++   Q+H                             E + KS  D E  +   L   Y   L  F++L+L++ +C ++ +    ++++  +G ++ E    D+   +++ +  +PL+  LS GSDP +      K+ K+
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECG-----------QPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPN-EAEVLRQL---FSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLI--PLKVRL-----KLNQHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVT-AEGHWVH---WSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEI-QLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGML-CTNHSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAE-------YEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNV-LEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAE-WILDMSWLNLVELSKLWQ-FSEILD---QVH---------------------------HHEKLWKSWFDKEAPEEEVLPNSYQ-SLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKI 2124          

HSP 2 Score: 324.709 bits (831), Expect = 4.908e-88
Identity = 185/597 (30.99%), Postives = 306/597 (51.26%), Query Frame = -3
Query:   72 ISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD----GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYAR-KYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTK--------YISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1823
            +S+GQGQ   A K++      G W  LQNCHL  ++M  L + V +       ++++FRL++++   K FPI++LQ S+K TNEPP+GL+A +KR +  ++    +       W+ +++ + F HS + +R+KFGPLGWNI YEF+ +D    +  +     D     ++ W+ + Y+  EI YGGRVTD +D+R L      +F+      D+ + +   Y  P+  ++++Y  ++  LP  + PE+FG+H NA+++FQ ++ + +++TIL +QP+ ++ G G T +  V  +AD +LEKL     P E K       + G L  +   L QE+DR  +++ +++++L+ LK AI G ++MSE L        + ++P  W   ++ S   L  W  +L  R      W+ +G P  FW+ GFF PQGFLT   Q  AR    + +D +              EV K MK          D     P  GV V+GLY++G  WD  N ++  S    +  ++P++ M  + +   E  K        Y  P+YK   R  +        N + +V L T Q    W+  G AL+C+
Sbjct: 2129 VSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETEC----INDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTN-QWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKG--YGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVK----RLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVL----------CNEVTKWMK----------DDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALLCD 2685          
BLAST of SMED30008756 vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1206.82 bits (3121), Expect = 0.000e+0
Identity = 848/2780 (30.50%), Postives = 1375/2780 (49.46%), Query Frame = -2
Query: 1843 TYKSYQKNFKVEQARMEDLEEVAAELKLKQILW----DSLDEWDSRYN-EWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILG-GTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEA--YLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSI--TEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDL-NKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMF-EGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESN------WDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVP--FFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWIT-IQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFA---DFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHE----------RLYEPLTDFAKVKNILHSYLDDFNMA-SSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAK-EAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAK--SSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQK--------------TDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKK-------KRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTL-IHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKS--LSGHYDLRLASFQKLILVKTFCEEK-IVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKL 9993
            TY    K F +   +   L ++  EL L Q L+    + ++  +  Y+  W      K+N E L  QT +      +L + L   Q    LK  +++  E   ++  + +  +  RHW++I                                E+I   A  E  +E  LK+V   W    +     K+  ++ + G  T E+    +DS + + ++ S+ +  P K ++ +WV+ L      IE W+  Q  W+YLE++F   DI +QLP EAK F S+DKS+ +IM +  ++P  +++    G +   +    LL+Q+  C ++  YLE KR++FPRF+F+S+  LLEIL Q  +   +Q HL   FD I  + F                       KY + ILA+ S E E + L + + A GNVE WL  + +    +L  ++RQ+    + +  E  ++L + + Q+ L   QM+W R+    L +   +R  G++    + F +L N L  +    L  + R     LIT++VH RD+  ++ +  + + + FEW KQ R+Y++   D   + +++  + Y  E+LGC+ RLVITPLTD                              KD+ + L K  VVFNCSD +D++ +GR F  LAQSG+W CFDEFNRI++ VLSV AQQ+  +   K  +   F+F +G  + +      F+TMNPGYAGR ELP+NLK  FR ++MMVPD ++I  V L S GF  +  LA K   +YKLC EQLS+Q HYDFG+R + SVL   G  KR NP   E  ++ R L+D NL K + +D ELF ++++DLFPG+EL +  Y   +  I+  I+ +GL  +P   LKVIQ YET  VRHG+M +GP+G GKTT   +L K ++     G        QP +   +NPK+IT  +++G ++  T +W DG+   + R T +   ++H W++ DGPVDA+WIEN+N+VLDDN+ L LAN +RI + P   ++FE  ++  ASPATVSR GMV++    LGW P ++ WL   +   + EV   L  +F     +  +F+       M  +    I     +L+ L+     P      +     +   ++F  +W  G  L   +      W   ++ +R    +    R  +  D + +     +     W   V  + +  +V   +  ++VP VD +R  +L++ +    ++VL  G  G  K+V+ +  ++        +   +NFS+ T+    Q  +E+ ++K+     G P  K++ I IDD+NMP ++ +G Q   E++RQ  +  GFY+ +K    T I D+   AA   PGGGRN +  RL R F++F+   PS  S+ +IF  I  G F     F ++V+     +VL    ++      +LPTPAK HY+FNLRDLS+  QG+L  +   +     +  L+ HE +RV  DR    +D  +F Q +A++  +  GE  +      +   F DF++   E  E          ++YEP+  F  +K+ L+ +L  +N +     M +VFF DA+ H+ +++R+IR   GNALLVGVGG+GKQSLTRLA+F+ GY  FQI L   Y+      DLK +Y   G   +   F++TD +I  E FLE +NN+L+SGEV +LF  +E + ++       K E        + ++++ ++RVR+NLH+VLC SPVG  FR+R   FP+L++ CT+DWF+ WP++AL+      S+F+ +D    ++K ++          VA++   ++                                      +  GL K+ E +E +A +  EL     +L+   +  + +++++    E +++V+ +V++ +  A+       A    A+  L+ A PALE A  AL  +  +DIA +R  + PP ++   M+ V LLL ++              + W  + +++    FL +L  +PKD I E  ++ L+ Y + PN+  E     S     L+ W +AM  +    K V P K        RL +AN +L++   +L  KQAEL  V  +       Y+ ++TEK  L  +      +++ A  L + LA EKERWTE   +F  +   +V DV +  A ++Y G F   +R  LL+ W    ++  IP   ++ +  +L DA  + +WN                                             L+I  L+   F   LE  + LG P L+ED+GE LDP L+ + L++ F+K G T  + +GD +++  K FKLY+TTKL NP Y PEI  + +II+FTVT +GLEDQLLG V                           +TE R          +++D E LI  L  +K T+ E  +++  A  T+ +I  AR +Y P A RGS++YF++  M+ ++ MYQ SL  F  LF+ ++ +S KS +  ERIK ++   T   Y   ARGL+E+ K +F+ +L ++I  Q   ++  E+   ++G     K  P+KP + WI    W N+V++S +   FS +++     H                             E + KS  D E  +   L   Y   L  F++L+L++ +C ++ I     ++++  +G ++ E    D+   +++ +  +PL+  LS GSDP +      K+ K+
Sbjct: 1109 TYCDGAKLFGITVTQHPQLMKIRTELTLLQKLYGLYNNVIETVNGYYDILWTNINIEKINNELLDFQTCR------KLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRIT-------------------------------EDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNYNT-PFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCV--GDVTMGQLLPHLLEQLDSCQKSLTYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQF---------------------HEKY-DRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDR--GIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDET---------------------------IKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT----CG--------QPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKT-LKAKKEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPN-EAEV---LRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLI-----PLKEQCGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVT-----AEHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQ-LGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFV-IGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTL-YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVESHHFLSAFD-IDCSP-QVKSEVVQCMGSFQDCVAEKCVDYF--------------------------------------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAE-------YEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWN---------------------------------------------LQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNV-LEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVI--------------------------LTEKR----------SLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLASS-KSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGASLDLKTCPQKPAE-WILDMSWLNLVELSKLWQ-FSEILDQQISHH-----------------------------EKLWKSWFDKEAPEEEVLPNSYQ-SLDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKI 3602          

HSP 2 Score: 316.62 bits (810), Expect = 2.014e-85
Identity = 182/593 (30.69%), Postives = 305/593 (51.43%), Query Frame = -3
Query:   72 ISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCAD----GVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEK----GRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYAR-KYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICE 1823
            +S+GQGQ   A K++      G W  LQNCHL  ++M  L + V +       ++++FRL++++   K FPI++LQ S+K TNEPP+GL+A +KR +  ++    +       W+ +++ + F HS + +R+KFGPLGWNI YEF+ +D    +  +     D     ++ W+ + Y+  EI YGGRVTD +D+R L      +F+      D+ + +   Y  P+  ++++Y  ++  LP  + PE+FG+H NA+++FQ ++ + +++TIL +QP+ ++ G G T +  V  +AD +LEKL     P +  P      E+    G L  +   L QE+DR  +++ +++++L+ LK AI G ++MSE L        + ++P  W      +   L  W  +L  R      W+ +G P  FW+ GFF PQGFLT   Q  AR    + +D +              EV K MK          D     P  GV V+GLY++G  WD  N ++  S    +  ++P++ M  + + + +   Y  P+YK   R  +        N + +V L T Q    W+  G AL+C+
Sbjct: 3607 VSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETEC----INDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYG-INQDLLDVSNTN-QWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKG--YGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKL-----PPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVL----------CNEVTKWMK----------DDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNVK-DPRLYSCPIYKKPTRTDI--------NCIASVGLKTTQPPEHWVLRGVALLCD 4157          
BLAST of SMED30008756 vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 1050.43 bits (2715), Expect = 0.000e+0
Identity = 639/1833 (34.86%), Postives = 1004/1833 (54.77%), Query Frame = -2
Query: 4345 YVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPH--KDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFA-QTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVR-----NKFEDN----GDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDR-DKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDP--SCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQ 9798
            +++ + QL K +    V   L   +++ R  +S++ +L N  L++ HW ++ +     F  + ++ TL  L  L +  Y  +++EI   A  E S+E         W+ T++ + P    + + VF+LG  D I    D+  + +  +A SR  GP    + +W KNL LF +TIE WL  Q  W+ LE+IF   DI  QLP EAK    + K + EIM+  +  P   +  T PG L +       L++IQK L  +L+SKR  FPRF+ +S+DELL +L    +P  +Q H+ K +D I  L   +         D   QT           + AM+S EGE +   K +     VE+W+  V + M    R + ++++  +      +W++++   +VL   ++ W  E+   +++V +     +  +  +  + +++L   +     +  R  +  ++  +VHARD+V   V   + +++ FEW+ QLR+YW    D+  VR  N+  +YGYEY+G + RL ITPLT R YL L  AL + LGGA AGPAG GKTET KDLAK+L   CVV +C++ +D   +G+  SGLA+ G W CFDEFNRI   VLSV++ Q+  IRNA  +    F FEG++I L      +ITMNP Y  R ELP+++K  FRP+ ++ PD + I E++L+S+GF  +K LA+KMT +YK    QLS+Q HYDFG+ + KSVL MAG++KR++ +  EDVVL+RALRD NLPK + +D  +F  ++ D+FPG++     +  F+  +E +++ S   I P QV KV+Q YE +  +   M+VG T GGK+ V N L +        GL          K+Y LNPK+ ++ ELYG  +  T +W DG+   + R     T +  ++++ DG VD+ W+ENMN+VLDDNK+L LAN +RI+L  +  +LFEV DL  ASPATVSRC +V++DP+ L + P+ + W+ +   +L           FEKY+   +     ++ I  + +  +  +  +C +L+ LL        N  A+ L      A ++C L   G  L ES    FD  V+     +  +D     G   +P    L+  + D    K   W  +VP +  N  + F + I+PTVDT R  ++LE+++ +K+ VL  G  G  K+ + +  L N S ++  + + INFS++T+S   Q  +E  +EK+ K   G P  K++++F DD+NMPK+D +G+Q P+ LLR   D GG YDR  KL++ TI+D+   AA    GGGRN V  R L  F++F+IP P+  SL  I+ SI+ G    F   ++   + I    ++++  + TDL PTP+K HY F+ R+LS+   G+    P  SC+  +  V +++ +E  R FHDRL +  DK   H  + ++  +YF    + E+ +  PI+FGD+     E  +R+YE + D+   K I                    F DA++H+ R+ R++R DRG+ALL+G  G+  Q+LT+LAAF      F+I L RGY+   F  DLK +Y   GI N+ TVFLFTD  IV E FLE INN+L S  VP+LF  DE E +I    + A + G    +++ ++++ + +  NNLHIVLC+S  G + ++RCR FP + N   IDW+  W  +AL  VA+   E+  I +      +  +C  +H S+   S++   + +R  Y T  S+L+ I+ Y S L E+K + V +   ++  L ++ E  E I  + ++L   +  L +K     A ++++  +Q
Sbjct: 1133 FIESLMQLSKDVQTLPVAFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMNLQRFTLETLFSLELHKYANDIDEIVTSALKELSIEM-------TWKRTKFNMQPQLKVNQERVFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGV---------DSSGQTV----------VGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMKRTSRLITKEAVYHY-----VDWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQFEGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQA----QTLGLC--------TKLYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNRLNRL-----------FEKYVPSCIDVTLNSETI--VPRTDVNMVSQLCLMLDVLLESK-----NSSAEVLECYFLEA-LYCSL---GATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFDETQEKWVPWSSLVPEYIHNPAMKFAD-ILPTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSS-ISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGHTRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFV-RVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYF--ETDSEAVLADPILFGDYRAAREECEQRVYEDIGDYDVSKAIFQ-----------------LFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLISM-VPTLFADDEKESIIKQINSEALQEGAG-SSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFPLMSN-TVIDWYLPWSAQALHAVAQCVLENPTIPKAHFGAVIDHICM-VHASLCDFSKQLLLKHQRCNYATSKSFLDFISSY-STLLEEKNEHVLQCKCLEGSLNRLREAREQIDELNLKLADQKVVLAKKTATCTAFLEEIDKNQ 2871          

HSP 2 Score: 381.719 bits (979), Expect = 1.204e-175
Identity = 241/787 (30.62%), Postives = 432/787 (54.89%), Query Frame = -2
Query: 1852 LDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKT-DWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELL-SGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLK-IIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIP-VFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKE 4200
            L+ +DKN       F  PP+ VQ V E + +L G+K  +W +AK ++ +  FL  L     D+I  + +  +K ++ +   + E ++ +SKA   ++ +V +   Y    K V+PKK +++   KE  +   +L   + +L  ++ + + L++ Y+++  EK+       L   RL  A KL   L  E+E WT+ + +  ++   ++GD  + AA ++Y GAF   +R+ ++   W    ++  IP+S+   +   L +  E+  W SEGLP D+ S +N IL T+G R+PL IDPQ+QA  WI+NKE  N LK +  L++ +FL+ LE  I+ G P LL+D+ E +DP +  +L +   V  GRT+I LGD ++ Y  +FKL++ T L+NP Y P +  K  +IN++ T +GLEDQLL   T       ++Q   L+  I+ +K  L+   + +L  L  S GN+LD+ +LI TL ++K  ++ET K+++ A+    +    R  Y PVA RG+V++F +++MA ++ MYQ+SL  + +LF  +++ S    +L++R++ ++   T     NV   LF K KL+FS  + ++I +  G +   E +F ++ + G +  + +KPH+ WI    W ++  ++++ P  FS+L +DI Q              N     S+  L       A +++    ++++SLS        +FQKL+L++    +++   + ++V + +G   V PP  +   +++  +  SP+VF++S+GSDP     +FA++
Sbjct: 2864 LEEIDKNQTIS---FAKPPKQVQVVCECILVLRGKKELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIK-FLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSERE-WTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEI-SWGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTY----NVHNYLFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIKNLSG-DGTKVQKPHE-WIPDQAWQDITKLAELFPEQFSSLPSDIEQ--------------NSTNWKSWWDL------RAPEQAPFPLQYSESLS--------AFQKLLLLRCLRADRLHRAMADYVTVTMGN-CVHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEK 3608          

HSP 3 Score: 258.84 bits (660), Expect = 1.204e-175
Identity = 170/594 (28.62%), Postives = 296/594 (49.83%), Query Frame = -3
Query:   81 ISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMF---C---ADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFF-----HPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMV-QGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYI-SPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAAL 1823
            I++GQGQ  V  K+++ A  IG W+ LQNCHL   W+  LE+ ++K + NP   + NFR+++++     FPI +LQ S KV  EPP+ ++ N+K  ++++S Q   +      +  L++ + FFH+++ +R K+G  GW++   F+DSD   ++  L  +   C    D  I W++L Y+  E+ YGGR  D +D+R L+  +  +F      P      ++    G   PP     + Y + ++ +PL+  PE+ G+     + +  Q  +++   +  +QP    G  G   D+ +  +A  I ++L     PE    +L   +    L+  + VL+QE+ RFNKL+  ++ S+V+L +A+ G V MS+E + +  AF N+ VP +W  +A  +LK L  W+  L  R      W V +G PK  WL G   P+ +L   +Q   RK  +P+D  +F   V + YR ++++  ++K+                     + GL+++G  WD ENG +  S    ++  LPI+ ++P           + +P+Y T  R    S  G+    V    L T   ++ W+  G  L
Sbjct: 3616 IAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKIT-NP---NINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKISQQTLSS-CQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIPPPGRK-HVYTE-IEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQPETQVG-RGIGGDEHISHIAQDIQKQL-----PELFDINLVGEELGTDLSPTSVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRKKGWPLDQSTFHTEVTR-YRTEDDIDDRLKQ-------------------CYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLRLRNTLRTPVYTTSLRRNA-SGAGL----VFEADLFTTMHTSHWVLSGVCL 4171          
BLAST of SMED30008756 vs. Planmine SMEST
Match: SMESG000007049.1 (SMESG000007049.1)

HSP 1 Score: 7299.9 bits (18939), Expect = 0.000e+0
Identity = 3605/3662 (98.44%), Postives = 3607/3662 (98.50%), Query Frame = -2
Query: 1786 MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIXXXXXXXXXXXXXXXXXXXXLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIYGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFK---------------------------------------VEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 12654
            MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIDDIKCPLPKLPDKLKEKQDLLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIYGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANKHEVKEELEKLKNTMNELQTRAFTYKSYQKNFK                                       VEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEK    +  +   G   G    K
Sbjct:    1 MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIDDIKCPLPKLPDKLKEKQDLLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIYGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANKHEVKEELEKLKNTMNELQTRAFTYKSYQKNFKDMTLKITGSSLEDQILARAKLKVTSFLEFLKRSYPNILLVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKNYMERVQAISLGQGQGPVAEK 3662          

HSP 2 Score: 1261.51 bits (3263), Expect = 0.000e+0
Identity = 599/605 (99.01%), Postives = 601/605 (99.34%), Query Frame = -3
Query:   57 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL 1871
            F+   K+KNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSP DGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL
Sbjct: 3634 FQRFAKEKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPLDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL 4238          
BLAST of SMED30008756 vs. Planmine SMEST
Match: SMESG000007049.1 (SMESG000007049.1)

HSP 1 Score: 7291.81 bits (18918), Expect = 0.000e+0
Identity = 3594/3623 (99.20%), Postives = 3597/3623 (99.28%), Query Frame = -2
Query: 1786 MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIXXXXXXXXXXXXXXXXXXXXLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIYGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 12654
            MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIDDIKCPLPKLPDKLKEKQDLLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIY          +AMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANKHEVKEELEKLKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEK    +  +   G   G    K
Sbjct:    1 MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIDDIKCPLPKLPDKLKEKQDLLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIY----------EAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANKHEVKEELEKLKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKNYMERVQAISLGQGQGPVAEK 3613          

HSP 2 Score: 1261.13 bits (3262), Expect = 0.000e+0
Identity = 599/605 (99.01%), Postives = 601/605 (99.34%), Query Frame = -3
Query:   57 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL 1871
            F+   K+KNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSP DGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL
Sbjct: 3585 FQRFAKEKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPLDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL 4189          
BLAST of SMED30008756 vs. Planmine SMEST
Match: SMESG000007049.1 (SMESG000007049.1)

HSP 1 Score: 7259.46 bits (18834), Expect = 0.000e+0
Identity = 3594/3679 (97.69%), Postives = 3597/3679 (97.77%), Query Frame = -2
Query: 1786 MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIXXXXXXXXXXXXXXXXXXXXLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIYGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKY-----------------DVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFK---------------------------------------VEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 12654
            MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIDDIKCPLPKLPDKLKEKQDLLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIY          +AMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKY                 DVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANKHEVKEELEKLKNTMNELQTRAFTYKSYQKNFK                                       VEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEK    +  +   G   G    K
Sbjct:    1 MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIDDIKCPLPKLPDKLKEKQDLLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIY----------EAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDEIGVHKGEAKRKKLLDDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANKHEVKEELEKLKNTMNELQTRAFTYKSYQKNFKDMTLKITGSSLEDQILARAKLKVTSFLEFLKRSYPNILLVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKNYMERVQAISLGQGQGPVAEK 3669          

HSP 2 Score: 1261.9 bits (3264), Expect = 0.000e+0
Identity = 599/605 (99.01%), Postives = 601/605 (99.34%), Query Frame = -3
Query:   57 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL 1871
            F+   K+KNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSP DGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL
Sbjct: 3641 FQRFAKEKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPLDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL 4245          
BLAST of SMED30008756 vs. Planmine SMEST
Match: SMESG000007049.1 (SMESG000007049.1)

HSP 1 Score: 6514.48 bits (16900), Expect = 0.000e+0
Identity = 3204/3262 (98.22%), Postives = 3207/3262 (98.31%), Query Frame = -2
Query: 1786 GEGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFK---------------------------------------VEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTGTCCRK 11454
            G+GPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANKHEVKEELEKLKNTMNELQTRAFTYKSYQKNFK                                       VEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEK    +  +   G   G    K
Sbjct:  457 GKGPPGTGSSYMMQSYDMDVYAEAPDKMTYTEQANKRNHCQRLTNFIRLADYLIVNTMHVLAVNSVYTLLNYISDQLKKTPTAEEIFNYKIIVGEVIRNEDYEDLSRPEEQVKVEPIKQSSIEDIKPPEEEKAVVIPPLFITEFVLSVQNLLFLPDRERFQEGITEVIKRFQNTVLSVQNLVPDTYFDSFTKPVINNKFEEKTCGEGPSMAAMFAEDAHLHNLINQTSDAIDAAFNACDKYASTFVELRQFYEKNESTDLDAIRTGKYDVEFFREAFSRYHREIRMCKLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANKHEVKEELEKLKNTMNELQTRAFTYKSYQKNFKDMTLKITGSSLEDQILARAKLKVTSFLEFLKRSYPNILLVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEKGLPPNQVVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEERLQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQKLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNKFEDNGDCRMPSQGDLWSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLNWITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQIVAEMASKYFGENIEPESFIKLPIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAKSSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRDKVKEDEAVAKVKAKETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKNYMERVQAISLGQGQGPVAEK 3718          

HSP 2 Score: 1262.67 bits (3266), Expect = 0.000e+0
Identity = 599/605 (99.01%), Postives = 601/605 (99.34%), Query Frame = -3
Query:   57 FKDLPKKKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL 1871
            F+   K+KNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSP DGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL
Sbjct: 3690 FQRFAKEKNYMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGVIQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINEYKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAKPDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPLDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYEPESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALICENSKAL 4294          

HSP 3 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 391/402 (97.26%), Postives = 392/402 (97.51%), Query Frame = -2
Query: 11449 MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIXXXXXXXXXXXXXXXXXXXXLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIYGKCYITDLIDKAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGE 12654
            MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIDDIKCPLPKLPDKLKEKQDLLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIY          +AMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGE
Sbjct:    1 MNLNKVNSKHNNDANYNDSKSFGKMYKFEKQDFNEAVHGFIKFNPPTIAQKKKDAIPAEIFLEPLTNLKDFQHYNSVSEIQRRYKETIVRKSVSEADKHVKRRKIGTLDPIDDIKCPLPKLPDKLKEKQDLLVKPEIQDIEVVLARGHAKNHVTQATVVKPPHIY----------EAMSYEGETNIPKIISILREQPEIKFLYLTHTLDKKCTNYHYYNLKVVSYHNVIKEDFYMVSLNGCTHIVAGDEIDHISLDRFEFEYEMYTKMKKIPTFNQFRIWKAFIRWRKVIKYTKFHQCSKFLLNHLFIINSSLRPALLNVREMCHRISDMGLCKVEKGRTYTLIDFMNAQIAQLNEVASKLTEFRELVREVIRSACRTSLLENGFFPDDYFIDGTDTPNYGE 392          
BLAST of SMED30008756 vs. Planmine SMEST
Match: SMESG000017294.1 (SMESG000017294.1)

HSP 1 Score: 2108.95 bits (5463), Expect = 0.000e+0
Identity = 1201/3000 (40.03%), Postives = 1769/3000 (58.97%), Query Frame = -2
Query: 1801 KLISEQKPIGMILVDATKMKQLMLPSPQRCLDVINEMLPVIARKEVDALIKESQDAEYTLCNEPTNTVDYVNALNFLSEIQVRMEPLEREADVIKEMYDLIDAFNVPTPPEDFAVYQTLYPSIDRAKNAIDKALADRDGNIDKFCASLDKDIAELRREVKDIRQAINNPLILDVKANXXXXXXXXXXXKNTMNELQTRAFTYKSYQKNFKVEQARMEDLEEVAAELKLKQILWDSLDEWDSRYNEWLREEFMKLNPEDLGTQTAKYVKIVAQLEK---GLPPNQ-VVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNVFDYKEELEEISGQASSEASLEALLKKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNNNQLLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVEEAMFLNLRKLLRQSITEFDTLEREEWLKAHANQIVLTVEQMMWCREITAILEDVVEER-LQGMIDFEVKCFQDLNKLAGLVRGVLPKLFRATLCALITVNVHARDMVTEMVKEKVSDINCFEWQKQLRYYWDSTLDNCVVRMSNSLYTYGYEYLGCSPRLVITPLTDRCYLCLMGALQLDLXXXXXXXXXXXXXXXXKDLAKSLAKQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKISRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPDYRLIAEVILYSEGFESSKTLAQKMTQMYKLCSEQLSQQDHYDFGMRALKSVLVMAGQLKRENPDKPEDVVLIRALRDSNLPKFLKQDAELFRAILQDLFPGVELPEHDYGRFKLEIEYVIENSGLQINPSQVLKVIQFYETLAVRHGVMLVGPTGGGKTTVYNVLAKVLSNLNAAGLAEERPDYQPVKMYILNPKSITMGELYGEVNKLTLEWHDGLMPYIVRITCVDTSQDHQWVICDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPYVHMLFEVQDLSVASPATVSRCGMVYVDPEELGWMPFVKTWLNSMTGKLKIEVIDYLYGMFEKYIDDGLKFAQTKCIQTMAQVSIAKIQTMCRLLESLLVGPGAPNLNVDAQ--------------------KLNPTIAIAFVFCYLWGIGGNLHESNWDSFDNFVRNK---------FEDNG---DCRMPSQGDL---------WSSYADLHSRKMDLWEKIVPVFKFNKEVPFFEMIVPTVDTIRFGYLLEKLLHVKQSVLFTGATGVGKSVVARGTLNNISENAGYVPVFINFSAQTSSNRTQEMIENKLEKKRKAVLGAPTNKRVIIFIDDLNMPKLDTYGSQPPIELLRQYQDFGGFYDRDKLN-WITIQDMTLSAACGPPGGGRNPVSARLLRHFAMFSIPAPSEISLRQIFTSILTGFFADFPQQVRGCTENIVLAAVEIYNRMYTDLLPTPAKSHYVFNLRDLSKCIQGILQCDPSCVRDKSGVFKLFCHEAQRVFHDRLINHEDKMFFHQI-VAEMASKYFGENIEPESFIKL-PIIFGDFMKPGLEKHERLYEPLTDFAKVKNILHSYLDDFNMASSKEMKLVFFMDAIDHIARIARMIRQDRGNALLVGVGGTGKQSLTRLAAFMNGYNCFQIELCRGYDYNMFHTDLKKIYEWTGINNQHTVFLFTDTQIVVEEFLEDINNILNSGEVPSLFEPDEYERMIIGCRAAAKEAGVSEGNRDGIFEFCINRVRNNLHIVLCMSPVGSSFRSRCRMFPSLVNCCTIDWFTAWPEEALLNVAK---SSFEHVDIGEDELKVKLALMCTEIHTSVAKESERFYAELKRHYYTTPTSYLELITLYLSMLTEKKKQLVTRRDRVKNGLTKILETNELIATMEVELVALRPQLEQKQKDTEALMQKLGTDQEQADIVRXXXXXXXXXXXXXXXETQAIADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLL------------GQKTD--WASAKSVLGDP-YFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPKKKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNSVTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEH--ITLMGVLGDAFELRQWNSEGLPRDQVSTENAILVTRGRRWPLMIDPQEQANRWIRNKETVNQLKIIKLSEGNFLRTLENCIRLGMPALLEDIGETLDPALEPILLKQTFVKAGRTLIHLGDSDIEYSKDFKLYITTKLSNPHYMPEICIKVTIINFTVTPQGLEDQLLGEVTRLERPELEEQRNNLIIRINNDKNQLQITENRILKLLFESEGNILDHEDLINTLNESKVTSAETTKRIAEAELTEQKITVARSKYIPVAGRGSVMYFVVANMAEIDPMYQFSLKYFKTLFNNTIENSQKSQDLEERIKILLAETTIATYNNVARGLFEKDKLVFSFMLCIQIMRQNGLISDMEWEFFLRGIGGIEKKRPEKPHDPWISLNVWNNVVDVSDIIPVFSNLINDITQMHIEVTIGELTISVNEEQNDSYRPLPPVPSEEAIQKSRLDSEFAKSLSGHYDLRLASFQKLILVKTFCEEKIVLCITEFVKLNLGTRFVEPPPTDLPLLFQDMSKVSPLVFVLSTGSDPMNQFQRFAKEKKLYGKSSSYIFGSRTG 10593
            +LI +   IG   ++   ++Q +    +   + I ++L    RK  D   +  +     L   P    +      ++  I   ++  +   D     Y+LI+ F      +DF    T+     + + +I +   +   + ++F      D+A    ++ ++  ++ + +  +     HEV  E+ ++   + E Q  A  + + ++ F       E L ++  + +  + LW ++ +W   ++  + +  + ++ E +     ++ K + +  K    LP  Q V   +K  +E+ +  + +I  L NP ++ RHW+ + D +       +  LT  K +E+ + D+ E + +I+  A  E ++E  L K+   W+  ++ VL +K++   +IL  +DEI QL DD  +   ++  S +  P + R+ +W   L      I+EWL CQR WLYLE IFS+ DI RQLP E K + ++D+ +++IM+     P  +       LL   K  N+LL+Q+QK L  YLE+KR  FPRFYFLS+DELLEIL+QT++P AVQPHLRKCF+ I+KL F                       +   +I AM S EGEK+   K     GNVEEW+ ++E  M  +LR ++ + +  +  + R EW+     Q+V+   Q  W +E++    D +E R L+G+    VK  + L+ L  +VRG + K+ R TL ALI + VHARD+V  M+ E + +IN FEW  QLRYYW    +N  +R  N+ + YGYEYLG + RLVITPLTDRCYL L GAL L  GGAPAGPAGTGKTETTKDL K+ A QCVVFNCSD LD+  MG+FF GLA +GAW CFDEFNRIDIEVLSV+AQQ+ TI+ A+  ++ RFMFEG E+ L  +CA FITMNPGYAGRTELPDNLKALFRP+AMMVPDY LIAE+ L+S GF  ++TL++K+   +KL SEQLS QDHYDFGMRA+KSV+  AG LKR+N    E+++ +RA++D N+PKFL  D +LF  I+ DLFP ++    DYG   + I+      GL+     V K IQ +ET  VRHG+MLVGPTG GKT  Y VL   LS+L      +  P +Q V  Y+LNPKSITMG+LYGE + +T EW DG++  ++R        D +W I DGPVDA+WIENMNTVLDDNK LCL++ E IKL   + M+FEV DL+VASPATVSRCGMVY++P  LG  PFV+ W+ S+   +     + +  +F+ Y+++ + F +    + +   +      M +L++S +      +L+++A+                    K+   +   F+F  +W  G +    +   FD ++R K         F + G   D R    G L                   K   W   VP +    ++ + ++IVPT+D +R   + E+LL  K+ V+  G TG GK++     L        Y+  FI FSA+T++N+TQ++I++KL+K+RK V G P  K +I FIDDLNMP L+ +GSQPPIEL+RQ+ DF G+YDR  +  + ++ D+    + GPPGGGRNP++ RL+RHF +       E S++ +F +IL  +      ++    E +V A +++Y  + + +LPTPAKSHY FNLRDLSK  QG+L  +P  +     V +L+ HE+ RVF DRL+N +D+ +F  + V ++ S +   N + E  +K+ P+++GDFM   +E  +  Y    ++ K+  ++   L+DFN  ++ +M LV FMDA+ H+ RIAR+IRQ  GNALL+G+GG+G+QSLT+LAA M  Y+CFQIEL + Y    +  DLK+I    G+ N+  VFLF+DTQI  E FLED+NNILNSG+VP+L+  D+ ER+    +   ++ G+ +  +  +F     RVR NLH V+ MSP+G  FR+R R FP+LVNCCTIDWF+ WP+EAL +VA    +    +++ E+ ++  L  MC EIH SV+  SE++  EL R+ Y TPTSYLEL+ ++  +   KK++L   RDR KNGL K+L T E++  ++ EL  ++PQLEQ  ++++A  +++  D E A   +  V  +EAVA  KAKE + I DDAQRDLDEA+PAL+ ++++L  L+KNDI E+R    PP+ V+ V+E+VC++             G K D  W + K +L DP  FL  L +Y KDNI +++++K++ YI   +FT   +EKVS+AC S+  WVRAM  Y    K V PK++ LE ++KEL++    L++ +A+L AVE++I  LQ+  +     +K LE+   L  ARL RA KL   L++EK RW +SV      + N+VG+V + A  VAY G FT  YR+ +   W    +   +P ++     L+   GD  ++R W  +GLP+D +S ENA++V   RRWPL IDPQ QANRWI+N +  N L +IKLS+ +FLR+LEN IR G P L+E++GE LDPALEPILLKQTF + G  +I LGD+ I Y  DF+ YITTKL NPHY PE+  KVTI+NFT++P GLEDQLLG V   ERP+LE+ +N LI+     + +L+  E++IL  L  +EG+ +D  DLI TL  SK+ S E   ++  AE TE+ I   RS+YIPVA R  +++F VA++A+IDPMYQ+SL++F  +F N I N+ K+  L ERI  +    T + Y+NV R LFEK KL+FSF+L  +I++  G I   EW F L G G ++ +    P   WIS  VWN ++ ++  +P FS    +    ++               ND  R        ++++  R      + L G +      FQ L++++    +K+   + +FV   LG RF+EP   DL L+++D S  +PL+FVLS G+DP +   +FA + K   K S+   G   G
Sbjct:  708 QLIPQYIIIGPFYINTENVRQGLAKKRKAMANAILDLLARELRKSADQACEAFKTITRKLYERPNTIEELAELREWILTIPDMLDEQQEVIDKCLTDYELIEEFYYNLSNDDFNAKWTMVGWPHKIRMSIIQVEQNLLEDEERFRKLQVADVAAFNEKLDNLTMSVASMVSYNDITKAHEVANEVRRIHKQLTEAQANAVLFNNRERLFNQPVTNYEKLSKLVKDFEPFRNLWIAVSDWIKLHDSVMNDPLIAVDSEVVEKSVTEFYKTMHKSVKIFNELPSVQEVAGQIKVAIEEFKPFIPLIQGLRNPGMRARHWEMLSDELGISIV-PKSTLTFSKCLEMRLQDHIEIISKIAEVAGKEYAIEQALNKMSGEWEALKFEVLSYKNT-GTYILKVSDEINQLLDDHIVMTQSMGFSPYKKPFEERITKWETTLRTTQDVIDEWLQCQRQWLYLEPIFSSEDINRQLPVEGKRYATMDRMWRKIMKTAFDNPSVITLCPDARLLTNLKECNKLLEQVQKGLSEYLETKRQSFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIAKLQF-----------------------EKDLEITAMFSGEGEKIVFEKSTYPTGNVEEWMLEIENMMRESLRIIIGKGLVNYKQIPRTEWVLKWPGQVVIAGCQTYWTQEVS----DALETRDLKGLY---VKLLEQLDGLRAVVRGDMTKIGRMTLSALIVIEVHARDVVNNMITENIQNINDFEWISQLRYYWIE--ENLKIRAVNAEFPYGYEYLGNTSRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAFAIQCVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQIATIQKAQQQRLDRFMFEGMELILKPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYALIAEISLFSFGFSDARTLSKKIVTTFKLSSEQLSSQDHYDFGMRAVKSVISAAGNLKRQNTTMDEELICLRAIQDVNVPKFLMDDLKLFNGIVSDLFPNIKEEPIDYGDLLISIQTAARKKGLKDVTGFVDKCIQLFETTVVRHGLMLVGPTGSGKTKCYEVLQSALSSLKDQISPDGSP-FQTVHTYVLNPKSITMGQLYGEFDLMTHEWTDGILSTLIRQGVTANGPDKRWYIFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLLEEMTMMFEVADLAVASPATVSRCGMVYLEPSILGLAPFVECWIRSLPDAIYPHR-ERVQKLFDVYLEETVDFMRHNLREIVPTTNGQLTFNMIKLMDSFIYPFVPSDLSIEAKTSKKKAERQMADQIPDEVVNKIGEAVESWFLFSLIWSFGASCDTDSRKKFDTYLRRKMSTQLIFLPFPEEGLVYDYRFDHGGTLSLNREEEENEEEIIKERKIKWVHWMANVPEYIIKPDMKYSDIIVPTIDNVRLISISEQLLISKKPVMCVGPTGTGKTLSISDKLTKYMP-PEYISEFIVFSAKTTANQTQDLIDSKLDKRRKGVFGPPMGKYIIFFIDDLNMPALEVFGSQPPIELIRQWCDFKGWYDRKAIGEFRSLVDINFIVSMGPPGGGRNPITQRLMRHFNLLGFNELQEDSMKTVFGTILKFWIMRAVAELHPLEETLVKACIDVYMAIQSQMLPTPAKSHYTFNLRDLSKVFQGMLMLEPESLTSVDQVLRLWFHESCRVFQDRLVNDQDREWFKNLLVGKLNSDF---NQKYEDVVKIEPLLYGDFMSVAIENKK--YVEFVEYDKMLKVIEENLEDFNQINTAKMNLVLFMDAVRHVCRIARIIRQPLGNALLLGMGGSGRQSLTKLAAHMAEYDCFQIELSKNYGVAEWRDDLKRIMLAAGLENKPIVFLFSDTQIKDESFLEDLNNILNSGDVPNLYSFDDLERIYGDMKPIVQDLGL-QATKTNLFSAYSKRVRINLHTVITMSPIGEIFRARLRQFPALVNCCTIDWFSQWPQEALESVALKFLNDIPELEVSEEVIR-GLMYMCKEIHQSVSNYSEKYRQELSRYNYVTPTSYLELLGIFSKIYARKKQELKQARDRTKNGLDKLLYTEEIVQKLQEELEIMKPQLEQAVEESKATKEEIERDSEMAKETQIVVTREEAVAAKKAKECEIIRDDAQRDLDEALPALQESLESLKKLNKNDITEVRAMMRPPEGVRLVIETVCIMKDVKPKKIQGDKPGVKIDDYWDAGKGLLQDPGKFLDSLFNYDKDNISDSVIQKIEPYIASESFTPAAIEKVSRACTSICQWVRAMYKYHFVAKGVAPKREALERSSKELEQTKKILKEARAKLKAVEDRILGLQEKLEACARRQKELENKSDLCEARLTRADKLIGGLSNEKIRWQDSVVNLEFLINNIVGNVLISAGYVAYLGTFTGEYRNSMCHEWSAALKTYGVPHTDKPATNLVDTFGDPVKIRNWQIDGLPKDTLSIENAVIVEFSRRWPLFIDPQGQANRWIKNLQKENGLDVIKLSDKDFLRSLENAIRFGKPCLMENVGEELDPALEPILLKQTFKQQGAVVIKLGDAIIPYHDDFRFYITTKLPNPHYTPEVSTKVTIVNFTLSPSGLEDQLLGMVVAEERPDLEDAKNQLIVSNAKMRQELKEIEDKILYRLSVAEGSPVDDIDLIQTLEASKLKSNEIEAKVIIAEQTERDIDETRSRYIPVAVRTQILFFCVADLAKIDPMYQYSLEWFLNIFKNGITNAAKADTLTERIDNINNYFTFSLYSNVCRSLFEKHKLLFSFLLATRILQHEGKIDLAEWRFLLAG-GSVKAQDLPNPAPEWISDRVWNEILTLAS-LPAFSKFPEEFIHKYL---------------NDFKRIF------DSLEPHR------EKLPGEWCDICDRFQVLLVLRCLRMDKVTNAMQDFVAHFLGERFIEPQTADLTLVYKDSSPTTPLIFVLSPGTDPASDLYKFADDMKFSKKLSAISLGQGQG 3634          

HSP 2 Score: 492.271 bits (1266), Expect = 9.921e-139
Identity = 257/596 (43.12%), Postives = 377/596 (63.26%), Query Frame = -3
Query:   75 YMERVQAISLGQGQGPVAEKMMDAAAKIGDWVFLQNCHLAASWMVRLEEIVKKRSENPYEVHENFRLFLSSMPAKTFPISVLQNSVKVTNEPPKGLRANIKRAFNEMSPQFFETHVLGLVWRKLIFGICFFHSIILDRKKFGPLGWNIRYEFSDSDRECAILNLGMFCADGV-IQWDALTYITAEITYGGRVTDFWDQRCLRNILTTFFHPKTIVEDYKYSQSGIYYPPEFETINE-YKDFVDSLPLLEEPEIFGMHENANLSFQIQETQKLINTILDVQPRIAAGGTGRTTDDIVYELADQILEKLIDKINPEEAK---PDLFHPDEKGRLNSLTTVLMQEVDRFNKLLSVIKNSLVQLKKAIKGFVVMSEELESVYTAFTNNQVPNLWSNVAYPSLKPLSTWVKDLAMRCSSTYFWMVQGAPKSFWLPGFFFPQGFLTGTLQNYARKYDYPIDHLSFEFIVYKDYRNQEEVLKQMKELKFGEVIEADKHLSSPPDGVLVHGLYMDGMRWDDENGQIITSIRGEMLGVLPIMHMMPKMDYE-PESTKYISPLYKTEERAGVLSTTGMSTNFVVAVPLPTDQESNFWINMGAALIC 1844
            + +++ AISLGQGQGP AE+++  A + G WVF QNCHLA SWM  LE +V++  ++  +VH +FRL+L+SMP+  FP+ +LQN  K+T EPP+G++AN+ +++   S  F  +      WR L+  +C FH ++++RKKFGPLG+NI YEF+D D    I  LGMF  +   + +  L Y    I YGGRVTD WD+RC+ N+L+ F++P+ + EDY YSQSGIY      T +  Y  ++ SLP+ + PEIFG+H+NAN++F I ET  L++ +L +QP+++  G G++ ++IV E++ +IL+ + +  N E+     P ++         S+ TVL+QEV R+N+LL++IK+SL  L KAI+G VVMSE LES+  +  +N+VP+ W++ AYPSLKPL++WV DL  R      W+  G P  FW+ GFFFPQ FLTGTLQN+ARK    ID +SF F V         ++K   E+              P DG  + GL+++G RWD    Q+  S   E+   +P++ ++P  +   P S  Y  P+YKT  RAG LSTTG STNFV ++ +PTD++   WI  G AL+C
Sbjct: 3620 FSKKLSAISLGQGQGPRAEELIKNAMERGKWVFFQNCHLAPSWMPSLERLVEQIDKD--KVHRDFRLWLTSMPSPKFPVFILQNGSKMTVEPPRGIKANLLKSYTSFSDDFLNSIAKNTEWRHLLLSLCLFHGVLIERKKFGPLGFNIPYEFTDGDLRICINQLGMFLTEYTDVPFKVLQYTAGHINYGGRVTDDWDRRCVMNVLSGFYNPQVMTEDYIYSQSGIYRQISPLTDHTGYMAYIRSLPINDTPEIFGLHDNANITFAINETNNLLDDLLKLQPKMSTAG-GKSREEIVEEVSKEILQGMPEIFNIEDISKRYPVMYE-------QSMNTVLIQEVIRYNRLLNIIKSSLRDLLKAIQGLVVMSEALESMSNSLYDNKVPDNWASKAYPSLKPLASWVIDLHQRILFIQTWIDNGIPPVFWISGFFFPQAFLTGTLQNFARKKIISIDTISFGFKV---------MVKAWPEIT-----------EIPSDGCYIRGLFLEGARWDMGKMQLTESRPKELFTEMPVIWLIPCANRSIPPSEIYDCPVYKTLTRAGTLSTTGHSTNFVFSIEVPTDKDQKHWIKRGVALLC 4185          
The following BLAST results are available for this feature:
BLAST of SMED30008756 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH60.000e+060.84dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
DNAH15.551e-13941.92dynein axonemal heavy chain 1 [Source:HGNC Symbol;... [more]
DNAH23.108e-10841.36dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH23.108e-10841.36dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH122.446e-13738.56dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
back to top
BLAST of SMED30008756 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
che-30.000e+026.91Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-14.049e-17727.25Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-18.577e-17727.25Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-18.577e-17727.25Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-31.096e-3527.65Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of SMED30008756 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc16F8.213e-15844.39gene:FBgn0283476 transcript:FBtr0074509[more]
Dhc36C1.139e-12939.22gene:FBgn0013810 transcript:FBtr0304742[more]
kl-22.508e-9437.25gene:FBgn0001313 transcript:FBtr0346722[more]
Dnah35.328e-12037.86gene:FBgn0035581 transcript:FBtr0289982[more]
Dhc62B8.604e-11736.96gene:FBgn0013811 transcript:FBtr0303106[more]
back to top
BLAST of SMED30008756 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL807739.10.000e+060.83dynein, axonemal, heavy chain 6 [Source:NCBI gene;... [more]
dnah60.000e+060.83dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:Z... [more]
dnah61.102e-16060.42dynein, axonemal, heavy chain 6 [Source:ZFIN;Acc:Z... [more]
dnah17.270e-13443.05dynein, axonemal, heavy chain 1 [Source:ZFIN;Acc:Z... [more]
dnah22.466e-11040.06dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SMED30008756 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asxl21.596e-1562.02ASXL transcriptional regulator 2 [Source:Xenbase;A... [more]
asxl21.792e-1560.86ASXL transcriptional regulator 2 [Source:Xenbase;A... [more]
asxl21.820e-1559.69ASXL transcriptional regulator 2 [Source:Xenbase;A... [more]
plekhg31.437e-13241.01pleckstrin homology and RhoGEF domain containing G... [more]
plekhg31.439e-13240.98pleckstrin homology and RhoGEF domain containing G... [more]
back to top
BLAST of SMED30008756 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah60.000e+061.39dynein, axonemal, heavy chain 6 [Source:MGI Symbol... [more]
Dnah60.000e+061.39dynein, axonemal, heavy chain 6 [Source:MGI Symbol... [more]
Dnah60.000e+060.35dynein, axonemal, heavy chain 6 [Source:MGI Symbol... [more]
Dnah25.968e-10841.49dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah25.874e-10841.60dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
back to top
BLAST of SMED30008756 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9C0G6|DYH6_HUMAN0.000e+060.84Dynein heavy chain 6, axonemal OS=Homo sapiens OX=... [more]
sp|Q9P2D7|DYH1_HUMAN5.539e-13841.92Dynein heavy chain 1, axonemal OS=Homo sapiens OX=... [more]
sp|P0C6F1|DYH2_MOUSE4.174e-10741.49Dynein heavy chain 2, axonemal OS=Mus musculus OX=... [more]
sp|Q9P225|DYH2_HUMAN1.492e-10741.36Dynein heavy chain 2, axonemal OS=Homo sapiens OX=... [more]
sp|E9Q8T7|DYH1_MOUSE1.125e-13939.43Dynein heavy chain 1, axonemal OS=Mus musculus OX=... [more]
back to top
BLAST of SMED30008756 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203422200.000e+065.21tr|A0A1S3JEF3|A0A1S3JEF3_LINUN dynein heavy chain ... [more]
gnl|BL_ORD_ID|235003320.000e+064.94tr|A0A210QMM2|A0A210QMM2_MIZYE Dynein heavy chain ... [more]
gnl|BL_ORD_ID|182242520.000e+064.41tr|A0A1I8GYQ2|A0A1I8GYQ2_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|229197500.000e+063.31tr|A0A4S2M280|A0A4S2M280_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|229349400.000e+063.31tr|A0A4S2M2G6|A0A4S2M2G6_OPIFE Uncharacterized pro... [more]
back to top
BLAST of SMED30008756 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah25.985e-11138.99dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah122.200e-12842.26dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
si:dkeyp-86b9.14.161e-8037.88dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
ENSAMXT00000016172.22.988e-9033.45pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
dnah9l9.472e-8535.58dynein, axonemal, heavy polypeptide 9 like [Source... [more]
back to top
BLAST of SMED30008756 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH60.000e+062.26dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000001140.10.000e+039.75pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
ENSPMAT00000006497.10.000e+034.29pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 ge... [more]
ENSPMAT00000003955.10.000e+040.60pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 g... [more]
ENSPMAT00000003959.10.000e+040.55pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 g... [more]
back to top
BLAST of SMED30008756 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN13.661e-1025.31Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of SMED30008756 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5