Transient receptor potential cation channel subfamily V member

Overview
NameTransient receptor potential cation channel subfamily V member
Smed IDSMED30008753
Length (bp)2698
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily V member (SMED30008753) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily V member (SMED30008753) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily V member (SMED30008753) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily V member (SMED30008753) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008753

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008753h1SMcG0008468 SmedASXL_005902SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30008753h1SMcG0008468 SmedASXL_005904SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30008753h1SMcG0008468 SmedASXL_019889SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30008753h1SMcG0008468 dd_Smed_v4_23397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008753h1SMcG0008468 dd_Smed_v4_23397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008753h1SMcG0008468 dd_Smed_v4_23397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008753h1SMcG0008468 dd_Smed_v4_23397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008753h1SMcG0008468 dd_Smed_v4_48358_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008753h1SMcG0008468 dd_Smed_v4_45669_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008753h1SMcG0008468 dd_Smed_v4_45669_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008753h1SMcG0008468 dd_Smed_v4_45669_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30008753h1SMcG0008468 Contig12615newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008753h1SMcG0008468 Contig12615uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Human
Match: TRPV6 (transient receptor potential cation channel subfamily V member 6 [Source:HGNC Symbol;Acc:HGNC:14006])

HSP 1 Score: 174.866 bits (442), Expect = 1.044e-44
Identity = 149/582 (25.60%), Postives = 261/582 (44.85%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALKHYK-----KPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +         A +L++  P +  +    + + GQTALH  ++  ++ +V+ L+     V+ RA G  F+                                   +L YFGE+PLSFAAC  ++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L + +     +P D  V N  GLTP  L+   G   +F  ++       W YG +  ++Y    L  ID+SG  D  S L  II     +   +LD   V++L++ KW+ +G   F  L  + L Y +   +    R  K               ++ +  E  M+ K   R   E V ++  +++  + + ++   G+  F  + +L  P     +   F++L+ + +R+         +++ +V           + FA +L    +++F  GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D   +  F  +  +L + F++                 +  + +A+F I   +L+LN+LIAMMG+T+  V     + W + I+
Sbjct:  114 QRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRS-------------------------------PCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLD-LVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLY---DLTEIDSSG--DEQSLLELIITTKKREARQILDQTPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRPLKPRTNNRTSPRDNTLLQQKLLQEAYMTPKDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLI--------SASGEVVP---------MSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQIV 638          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Human
Match: TRPV6 (transient receptor potential cation channel subfamily V member 6 [Source:HGNC Symbol;Acc:HGNC:14006])

HSP 1 Score: 174.481 bits (441), Expect = 1.142e-44
Identity = 148/582 (25.43%), Postives = 266/582 (45.70%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALKHYK-----KPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +         A +L++  P +  +    + + GQTALH  ++  ++ +V+ L+     V+ RA G  F+             ++ +NL+                  YFGE+PLSFAAC  ++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L + +     +P D  V N  GLTP  L+   G   +F  ++       W YG +  ++Y L +   ID+SG  D  S L  II     +   +LD   V++L++ KW+ +G   F  L  + L Y +   +    R  K               ++ +  E  ++ K   R   E V ++  +++  + + ++   G+  F  + +L  P     +   F++L+ + +R+         +++ +V           + FA +L    +++F  GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D   +  F  +  +L + F++                 +  + +A+F I   +L+LN+LIAMMG+T+  V     + W + ++
Sbjct:   74 QRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFR-------------RSPRNLI------------------YFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLD-LVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLYDLTE---IDSSG--DEQSLLELIITTKKREARQILDQTPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRPLKPRTNNRTSPRDNTLLQQKLLQEAYVTPKDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLI--------SASGEVVP---------MSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVV 598          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Human
Match: TRPV6 (transient receptor potential cation channel subfamily V member 6 [Source:HGNC Symbol;Acc:HGNC:14006])

HSP 1 Score: 174.866 bits (442), Expect = 1.185e-44
Identity = 149/582 (25.60%), Postives = 261/582 (44.85%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALKHYK-----KPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +         A +L++  P +  +    + + GQTALH  ++  ++ +V+ L+     V+ RA G  F+                                   +L YFGE+PLSFAAC  ++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L + +     +P D  V N  GLTP  L+   G   +F  ++       W YG +  ++Y    L  ID+SG  D  S L  II     +   +LD   V++L++ KW+ +G   F  L  + L Y +   +    R  K               ++ +  E  M+ K   R   E V ++  +++  + + ++   G+  F  + +L  P     +   F++L+ + +R+         +++ +V           + FA +L    +++F  GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D   +  F  +  +L + F++                 +  + +A+F I   +L+LN+LIAMMG+T+  V     + W + I+
Sbjct:  114 QRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRS-------------------------------PCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLD-LVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLY---DLTEIDSSG--DEQSLLELIITTKKREARQILDQTPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRPLKPRTNNRTSPRDNTLLQQKLLQEAYMTPKDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLI--------SASGEVVP---------MSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQIV 638          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Human
Match: TRPV5 (transient receptor potential cation channel subfamily V member 5 [Source:HGNC Symbol;Acc:HGNC:3145])

HSP 1 Score: 161.77 bits (408), Expect = 1.564e-40
Identity = 150/585 (25.64%), Postives = 258/585 (44.10%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALKH-----YKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMY---IINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +         A +L++  P +  +    + F GQTALH  ++  ++ +V+ L+     V+ RA G  F+              + +NL+                  YFGE+PLSFAAC  ++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L +     + +P D  V N  GLTP  L+   G   +F  ++       W YG +   +Y L ++D+        W   L +   +++    +   +L+   V++L++ KW  +G   F  L  L L Y +        R  K               ++ +  E   + +   R   E V IV  +++  L I ++   G   +  K +L  P     +    L+L+ + +R+T         +N +V           + FA +L    +++FT GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D  S+  F  +  +L T F++                 +  +V  +F I   +L+LN+ IAMMG+T+  V     + W + ++
Sbjct:   74 QRGALGETALHIAALYDNLE---AALVLMEAAPELVFEPTTCEAFAGQTALHIAVVNQNVNLVRALLTRRASVSARATGTAFR-------------HSPRNLI------------------YFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGHGDHLQPLD-LVPNHQGLTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDLTEIDS--------WGEELSFLELVVSSDKREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYRPLKFRGGNRTHSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRYFGKTILGGPFHVIIITYASLVLVTMVMRLT--------NTNGEVVP---------MSFALVLGWCSVMYFTRGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFLTVIDAPANYDVDLPFMFSIVNFAFTIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVV 598          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Human
Match: TRPV5 (transient receptor potential cation channel subfamily V member 5 [Source:HGNC Symbol;Acc:HGNC:3145])

HSP 1 Score: 161.77 bits (408), Expect = 1.564e-40
Identity = 150/585 (25.64%), Postives = 258/585 (44.10%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALKH-----YKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMY---IINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +         A +L++  P +  +    + F GQTALH  ++  ++ +V+ L+     V+ RA G  F+              + +NL+                  YFGE+PLSFAAC  ++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L +     + +P D  V N  GLTP  L+   G   +F  ++       W YG +   +Y L ++D+        W   L +   +++    +   +L+   V++L++ KW  +G   F  L  L L Y +        R  K               ++ +  E   + +   R   E V IV  +++  L I ++   G   +  K +L  P     +    L+L+ + +R+T         +N +V           + FA +L    +++FT GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D  S+  F  +  +L T F++                 +  +V  +F I   +L+LN+ IAMMG+T+  V     + W + ++
Sbjct:   74 QRGALGETALHIAALYDNLE---AALVLMEAAPELVFEPTTCEAFAGQTALHIAVVNQNVNLVRALLTRRASVSARATGTAFR-------------HSPRNLI------------------YFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGHGDHLQPLD-LVPNHQGLTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDLTEIDS--------WGEELSFLELVVSSDKREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYRPLKFRGGNRTHSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRYFGKTILGGPFHVIIITYASLVLVTMVMRLT--------NTNGEVVP---------MSFALVLGWCSVMYFTRGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFLTVIDAPANYDVDLPFMFSIVNFAFTIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVV 598          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Celegans
Match: osm-9 (Olfactory channel [Source:UniProtKB/TrEMBL;Acc:G5EBV8])

HSP 1 Score: 383.645 bits (984), Expect = 1.873e-118
Identity = 236/694 (34.01%), Postives = 367/694 (52.88%), Query Frame = 2
Query:  638 LYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKK-NYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDK----------------LSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMILQLC 2668
            LY  +     G+L+ IY   GE  + +F + ++   L + G+                         NP+++T +S   K    V  +    EES       F E      Y  W   KRGV GE L+HL   +       IA++LLK FP +A D ++GD+ FGQ+ALH  I+  D E V LL+ S  DVN RA G+FF  +  K  +  + +Q                        Y+GEYPL+FAAC GN++IYD L++ G  PN+QD  GNT+LHM VI+  +++Y +A++H+ KPADP+V+N  G TP+TL+ KLGR+ IF E++++   E W++  M CS YPL  LDTI   G T++ S+LM +ING++ +HLDM+   V+++LL +KW+ F  ++ I+ L+L++   + + +   +R T+   + +E      +    C     +  +  +    + E++ QG+  +++ L  +P KA F ++   +LLCIP R+ +                   IEE   +FA   +  +LLFF    KLTGPFV MI+ MI GD++RF  I  I L +F+Q F+F+ KD+D                  +I T+ TF  + +TLF+ + G + YEEF    Y  L   +F  +M  +PI+++N+LIAMMGNTY  VI++++K W     Q+ 
Sbjct:   39 LYKWVAVRKGGELINIYERDGEEGVLKFAEEKLLTILYDEGQ-------------------------NPKLVT-YSDYIKWKKGVNVQLGLSEESVDMQQSRFKEH-----YALWKLNKRGVEGENLIHLLLNREQQVCYEIARILLKRFPGMANDIYLGDEQFGQSALHLAIVHDDYETVSLLLNSKADVNARACGNFFLPEDFKLTNKITDYQGYA---------------------YYGEYPLAFAACFGNKDIYDLLIQFGANPNLQDSFGNTILHMCVINYSSSMYSYAVRHWAKPADPHVVNHAGFTPLTLATKLGRKQIFEEMLEIMKVEFWRFSDMTCSAYPLNTLDTIQPDGSTNYDSALMTVINGSTPEHLDMIGSEVIQRLLADKWKAFAQRKLIERLVLLIVQLITLSIVVYIRPTELPRLYMEDPQWDDYIRTACELLTILNCIFFVGYQQLGEIRTQGMRGYLRNLKTAPAKAVFCIANLFLLLCIPFRLMKKHE----------------IEEALFVFALPGSWIFLLFFARSAKLTGPFVQMIYSMIAGDMIRFAIISAIFLVSFSQVFYFVGKDMDAKQKLEDTNPHACRISGYTIYTYNTFPETFITLFRASMGGYDYEEFSCANYQALTKTLFVLYMFVMPIMMINILIAMMGNTYTTVIAQAEKAWRQQYAQIV 664          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Celegans
Match: ocr-4 (Osm-9 and Capsaicin receptor-Related [Source:UniProtKB/TrEMBL;Acc:Q9N3Y9])

HSP 1 Score: 243.817 bits (621), Expect = 9.491e-69
Identity = 178/596 (29.87%), Postives = 292/596 (48.99%), Query Frame = 2
Query:  968 YVCWNHAKRGVNGETLLHLCGMQITATH-RIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTID-ASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRET---KEESIALEPKMSFKHKFRYCLESXXXXX------------XXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLF-----KDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVL--LVFASFMIFVPILLLNMLIAMMGNTYQMVISRS---QKEWISMILQLCSS 2674
            ++CW    RG  GETLLH C +     H +++A+ L+ +FP I  D+++ D+++G+T LH  I+  + E V+ L+ SG DV+ R  G+FF         S +    +++ +I  +++T +   +     Y+GEYPLSFAAC    E    L+ HG + N  D NGNT+LH+  IH    +++ AL      AD ++ N+  LTP+TL+A L ++ +   I++      W YG    + YPL  +D+I+  SG  +  S L   + G   +HL +L   ++ QL++ KW  +G K     L +   Y + +     LR +   +++ IA +    +  K R   ES    +              +     +  +K  G   ++ GL   P KA FL SC L+++   LR   IF  +               E++  +   LL     LFF  GFK  GPFV M++K+I  DL+RF  IY++++  F+QAF+ +F      D      +       S + +F M+  +F     +  +    V+  + F  +M+ V +LL+NMLIAMM NTY  V   S    ++W ++IL +  S
Sbjct:  101 FICWKLNSRGAVGETLLHTCFLAGLPNHMKLLAERLIAIFPKIINDFYLSDEYYGETVLHMGIVSENAEFVRYLLKSGADVHARCSGNFFTCD--DQKGSRTDHPEVEHAII--SKHTKYPGHI-----YWGEYPLSFAACLSQPECIRMLVAHGADVNAADTNGNTILHICTIHENYEMFKMAL---SLGADLHIQNRQNLTPLTLAAFLAKKEMMQRIVEEERTVNWTYGRTQSAAYPLEHVDSIEPTSGSINQKSVLTIAVYGEKVEHLSLLP-HLLEQLVHHKWIAYGRKTLFAQLSMFCIYFICVTSCFLLRPSPFERQQHIANDLICFYDFKTRRFNESAVSTIIYHLLHLICVTGATLYLVQALLHIKNVGYHLYVLGLSGFPAKAIFLFSCILMVITFFLR---IFCLDEA-------------EDIVWIVIVLLTSLKFLFFCRGFKSVGPFVLMLYKIIIRDLMRFFLIYLVIVVGFSQAFYVIFLGYKRSDSGNREPSIMSNVAESYVRMFIMSLTEFTVFFEQLEECEHTVIGKITFVVYMLLVTLLLINMLIAMMTNTYTEVSGNSLEWLRQWSAIILMMEQS 667          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Celegans
Match: ocr-1 (Osm-9 and Capsaicin receptor-Related [Source:UniProtKB/TrEMBL;Acc:G5EDR9])

HSP 1 Score: 212.616 bits (540), Expect = 2.373e-57
Identity = 126/413 (30.51%), Postives = 222/413 (53.75%), Query Frame = 2
Query:  638 LYNLMNSNGKGKLLEIYSEQGER----ALEEFLKNEIPKYLLNNGEGMMVSKQEL-------KQMTIARYS-ITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTID-ASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFG 1837
            +Y +++ +G G L+++  +  E      L+ +L  E+ KY+ N G+G ++   EL       +   +  +S    +    P ++ +F +    ++   KK              +  + E +   W+  +RG  GE LL +C +Q +A H +IA+ L+  FP +  D  + ++++G + LH  I+  D +   LL+  G D+NQR  G FF +   K++ + S    L++  +  T+NTN+  S+     YFGEYPLSFA C G  +++  LL      + QD NGNT LH+ VIH++  +    L   +   +  + NK  LT +TL+A+L ++ +F +I+ L  +++W YGS  C  YPL K+DTID  +G  + +S+L  ++ G S  HL+++D G++ Q+L+EKW+ +G
Sbjct:   29 IYKMVDMHGGGILIKLARKCKELNSFVLLDAYLDQEVRKYMYNGGKGKLMPVAELVKARNKERNAKLGAFSRKKGKGKSGPNILDEFDQGQAEMAGDLKKALKLLDGGGKGGKSESKYREMV---WSVDERGSMGENLLAICLLQGSALHNLIARRLINFFPKLINDICVSEEYYGLSPLHLAIVNQDAQFTSLLLRLGADLNQRCYGAFFCADDQKASRTDS----LEHEFVELTKNTNYTGSM-----YFGEYPLSFAICMGQHDLFRMLLAKKANLSAQDTNGNTALHLCVIHDKMDMLDAVL---EAGGNIRLANKQNLTALTLAARLAKKTMFNKILQLECEKVWTYGSSQCVAYPLTKIDTIDETTGEMNDTSALSLVVYGESIQHLELMD-GLIEQILDEKWKAYG 425          

HSP 2 Score: 69.3218 bits (168), Expect = 9.543e-12
Identity = 60/231 (25.97%), Postives = 100/231 (43.29%), Query Frame = 2
Query: 2045 QGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLF----------KDIDKLSI-----------TTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMV-ISRSQ--KEWISMILQL 2665
            Q   +F+K     P K  F  +   I++ IP R+   F           + +   I+    + + LL   + L++       GPFV M++ +I  DL+RF  IY I L  F+Q+F+ +F          K ID +                +TF   +MT+ + +    +           +  L+F  F  FV IL  N+LIAMM  TY+ + ++R +  ++W  +IL L
Sbjct:  532 QKWFNFLKAF---PAKLMFKGAFLFIIISIPCRLACSF-----------HEFFLTIDNTMAIISILLVTQHFLYYMRAIPFVGPFVLMVYTIIATDLVRFAMIYSIFLVGFSQSFYLIFTSCERDSTAIKKIDPMGSEFNNIMENPVDALLRTF---IMTIGEFSVLYREMSACDNFWMKWIGKLIFVIFETFVSILQFNLLIAMMTRTYETIFLTRKEWKRQWAQVILML 745          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Celegans
Match: ocr-3 (Osm-9 and Capsaicin receptor-Related [Source:UniProtKB/TrEMBL;Acc:Q22374])

HSP 1 Score: 202.216 bits (513), Expect = 5.535e-54
Identity = 130/425 (30.59%), Postives = 218/425 (51.29%), Query Frame = 2
Query:  632 TELYNLMNSNGKGKL---LEIYSEQGERA-LEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQ-------PKIISKVTKKNYFEESYCSILPFFD-------EFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDAS-GHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            + LY+L++  G G L   ++     G+ + LEE+L   +  YL N G+G +V   +L         +T R+     ++    ++       P I+  + +       +   L   D         F  +  V W+  +RG  GE LLH+C +  TA    + K +   FP I  D F+ ++++G + LHQ I+  DLE+V  L   G DV+QR  G FF +   K++ + S    L++  ++  ++T +   +     Y+GEYPLSFAACT   + +  L     +PN+ D NGNTVLH+ VIH+   ++  A+   +  A+ +V N   LTP+ L+A+L ++HI+  I++ +    W+YG +VC  YPL  +DTI+ S G  + +S +  ++ G   DHL+  D G++ ++L  KW  FG K+ 
Sbjct:   10 STLYSLVDEQGGGILSPWIKYARSSGDYSILEEYLDTAVKSYLYNGGKGKLVPISQL---------VTIRNKQRNALLGALRRKKGRGKSGPNILEHIDQDALSSGDFLKALKVLDGGMIKGRRSFKYRELV-WDMDQRGRLGENLLHVCMLLNTADMNELVKQMTYRFPKIVNDIFLSEEYYGLSPLHQAIVNEDLEMVYFLCRKGADVHQRCYGSFFCADDQKASRTDS----LEHEWVDLVQSTKYTGQM-----YWGEYPLSFAACTNQVDCFRLLRAMKADPNMPDTNGNTVLHLTVIHDLPEMFMLAV---ELGANLHVRNNLKLTPLALAARLAKKHIYDLILECDMDISWRYGPVVCKAYPLNDVDTINESDGSLNPNSVIANVVYGDKVDHLEFFD-GLIEEVLESKWETFGKKQL 411          

HSP 2 Score: 75.8702 bits (185), Expect = 1.041e-13
Identity = 59/202 (29.21%), Postives = 97/202 (48.02%), Query Frame = 2
Query: 2111 CFLILLC-IPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFH-------------------GSLMTLFQMXXXXXXXXXXXXXXXNQLVL----LVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEW 2644
            C +++LC +PLR+        G   +D +     IE + V+   +++  + LF+    K  GPFV M++K+I  D+LRF  IY   L  F QAFF +FK  ++  I   K  +                    ++M +F M+ G+F        +    +     + F  F + V ++LLN+LIAMM  TY+  I+ ++KEW
Sbjct:  545 CQILVLCTVPLRV--------GCYLDDSFL---VIENLLVVCIVIMSTLHFLFYCRSLKFVGPFVLMVYKIIVRDMLRFLLIYSFFLMGFAQAFFVIFKSCERAEIAYQKAHNYTEDDEYIEKFENIMEDGWEAVMRMFIMSVGEFGALYKNLNECKSSIAPQSKVFFILFELIVTVMLLNLLIAMMTRTYEK-IAETEKEW 734          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Celegans
Match: ocr-2 (Osm-9 and Capsaicin receptor-Related [Source:UniProtKB/TrEMBL;Acc:O61220])

HSP 1 Score: 181.415 bits (459), Expect = 7.061e-47
Identity = 116/395 (29.37%), Postives = 199/395 (50.38%), Query Frame = 2
Query:  635 ELYNLMNSNGKGKLLEIYS----EQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMT-------IARYS-ITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIY--VCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTI-DASGHTDWSSSLMYIINGTSDDH 1774
            ++Y L++ +G G+LL              ++ +L+ ++  +L N G+G +V+  EL ++        +  +S    +    P V+  F+++ + +  + K     +             NE  Y  + W   +RG  GET++  C +  +  H  +   +L  +P +  D  I + F+G + LHQ II  D ++V   +  G DVN R  G FF +   K++ + S    L++  +  +  TN+  ++     Y GEYPLSFAAC    E +  LL     PN QD NGN+VLHM VIH   A+++ AL+     A    +NK  L+P+TL+AKL ++ +F EI++L    +W YG    + YPL K+DTI + +G  + +S+L  ++ G + +H
Sbjct:   25 KIYQLVDMHGGGELLPWLRYAIISSDTSFIDAYLETKVKDFLYNGGKGKLVTVTELVKLRNKERNERLGAFSRKKGKGKSGPNVLDDFNQEGENVGDLKKALKLLDGGGKGGR------NESKYREISWKLEERGSMGETIIGCCLLHASDIHNALVLKILDYYPKLLNDIHISEDFYGLSPLHQAIINTDCKLVYKFLKLGADVNSRCYGAFFCADDQKASRTDS----LEHEYVELSLKTNYTGNM-----YLGEYPLSFAACLNQPESFRLLLAFKANPNAQDTNGNSVLHMCVIHENMAMFKLALEC---GASLRTVNKQSLSPLTLAAKLAKKEMFDEILELEGDSVWAYGDASSTAYPLAKIDTINETTGELNEASALSLVVYGQTVEH 401          

HSP 2 Score: 51.2174 bits (121), Expect = 3.576e-6
Identity = 31/123 (25.20%), Postives = 55/123 (44.72%), Query Frame = 2
Query: 2033 ELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLF 2401
            ++K  G   +   L   P K  F ++ FL+L  IP R+             D+      ++ + +    +    + L++    +  GPFV M++ +I  D+ RF  IY I L  F+Q+F  +F
Sbjct:  540 DIKRIGRKKWWNVLTAFPAKITFKLTYFLVLAMIPTRLA-----------CDLSPVLLVVDNVLITVTMIFTTVHYLYYCRVIRFVGPFVLMVYTIIATDIFRFMLIYGIFLMGFSQSFSLIF 651          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Fly
Match: iav (gene:FBgn0086693 transcript:FBtr0070969)

HSP 1 Score: 412.92 bits (1060), Expect = 9.764e-128
Identity = 253/695 (36.40%), Postives = 388/695 (55.83%), Query Frame = 2
Query:  638 LYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLR---------ETKEESIALEPKM---------------SFKHKFRYCLE-SXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWI 2647
            LY L +    G L++  +  G  A+E+ ++ +   ++ N+G+G ++++ E  +    +Y    RD+                   T+     E+  SI     ++ + K   CW    RG  GE+LLH+  +  +  H  +A++LL++FPN+A D   G+++ G +ALH  I   + E+V  L+ +G D++QRA+G FF  +                   N  ++T++    EG L Y GEYPL++AAC  N+ +Y+ L++ G++P+ QD  GN +LHMVV+ ++  ++ +AL+H K PA   ++N+ GLTP+TL+ KLGR  +F E+++L+ +E W+Y ++ CS YPL  LDT+   G T+W+S+L  I+NGT  +HLDMLDGG++++LL EKW+ F   +F++ LL++  + L + V+  LR         E  E S A    +               + +   RYC E +  + ++  +      E+K QG+  F+K L ++P KA FL S  LIL CIP R+             D  T     EE  ++FA   + F L+FF G  +LTGPFVTMI+ MI GD+  FG IY IVLC F+QAF+FL+K   ++  T F T+  + M LFQ T G + Y +   T Y  L   VF  FMIFVPILLLNMLIAMMGNTY  VI +S+KEW+
Sbjct:   38 LYKLADYKRGGDLIDAINSGGLIAVEQLIREQFGVFMYNDGKGQVINRAEFLRW---KY----RDH-------------------TEVTIPIEASLSIHDPLGKWEDHK--ACWQMQYRGALGESLLHVLIICDSKVHTKLARVLLRVFPNLALDVMEGEEYLGASALHLSIAYSNNELVADLIEAGADIHQRAIGSFFLPR--------------DQQRANPAKSTDY----EG-LAYMGEYPLAWAACCANESVYNLLVDCGSDPDAQDSFGNMILHMVVVCDKLDMFGYALRHPKTPAKNGIVNQTGLTPLTLACKLGRAEVFREMLELSAREFWRYSNITCSGYPLNALDTLLPDGRTNWNSALFIILNGTKPEHLDMLDGGIIQRLLEEKWKTFAQNQFLKRLLILSTHLLCLSVSVYLRPAHDGEAEDEDSEGSDASAAALLDIQSDEGDSGGGDYNAQTVARYCAEFATLVGVLSYVIFQQGDEIKNQGLSAFLKQLSHAPAKAIFLFSNLLILACIPFRLI-----------GDTDT-----EEAILIFAVPGSWFLLMFFAGAIRLTGPFVTMIYSMITGDMFTFGIIYCIVLCGFSQAFYFLYKGHPQVQSTMFNTYTSTWMALFQTTLGDYNYPDLNQTTYPNLSKTVFVIFMIFVPILLLNMLIAMMGNTYVTVIEQSEKEWM 669          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Fly
Match: nan (gene:FBgn0036414 transcript:FBtr0089524)

HSP 1 Score: 212.616 bits (540), Expect = 2.493e-57
Identity = 130/423 (30.73%), Postives = 219/423 (51.77%), Query Frame = 2
Query:  605 LRRNENVRGTELYNLMNSNGKGKLLEIYSEQGE----RALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFE-ESYCSILPFFDEFFNEKIY--VCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTI-DASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            +++   V    LY  +N  G G L+++     +      ++  +K ++  +L N G G      +L         +  R+   PR      + P+I +     + F    YC  +   +   N   Y  VCW+   RG  GET+LHLC +  ++ H  +AK LLK +P +  D ++ D+++G++ LH  I+  D  +VK L+ +  DV +R  G F  ++    ++ FS   +  +  +     TN++  V     Y+GEYPLSFAAC   +E +  +L  G +P+ QD NGNTVLHM+VI+ +  ++      Y+   + ++ N   LTP+TL+AKLGR  +F  ++ +  +  W+ GS+ C+ YPL+ +DTI + +G+ +  S L +++ G   +HL++LD GVV  LL  KW  F   RF
Sbjct:   12 VKKQAGVSTQALYKFVNLKGGGLLVDMMKRACQTKQFAEIDHAIKTKVEPFLYNKGAGRYFPISKL---------VLLRNRDRPRT----RQLPEIRALENPDDDFNIHDYCPEVSEAEYISNPTAYRFVCWDLNMRGAVGETILHLCLLNASSLHADLAKRLLKFYPKLILDIYMSDEYYGESVLHIAIVNEDPAMVKYLLDANADVQERCCGAFMSAE----DTKFSRTDSPDHEYVALCPMTNYDGYV-----YWGEYPLSFAACLSQEECFRLVLARGADPDFQDTNGNTVLHMLVIYEKIEMFDVG---YEVGTNIHIKNIQNLTPLTLAAKLGRVEMFFHVMSIEREIYWQLGSITCAAYPLLMIDTINEETGNINKDSVLNFVVFGDKLEHLELLD-GVVIDLLKTKWDTFCKSRF 408          

HSP 2 Score: 102.834 bits (255), Expect = 4.759e-22
Identity = 70/239 (29.29%), Postives = 115/239 (48.12%), Query Frame = 2
Query: 2048 GIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDK--------------------------LSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVI---SRSQKEWISMILQLCSSV 2677
            G+  FI+ L+ +P +  FL SC L++    LR++ +                  I++   +   L    Y LFF  GFK  GPFV MI++M+ GDLLRF +IY++ +  F+QAF+ +F   D                           +S+T F  ++G++++                T++     ++F  FM+ V +LL+NMLIAMMGNTYQ +    +  Q++W  ++L +  SV
Sbjct:  541 GLKMFIENLMTAPSRVMFLFSCALMMTIPWLRVSCLTE----------------IDDHVTVVIMLTTAPYFLFFCRGFKTVGPFVVMIYRMVMGDLLRFVSIYLVFVMGFSQAFYIIFLTFDNPSSPEDQDAESNPMPSPMESIVAMFLMSLTNFGDYYGAMVS----------------TQHEYEAKILFFLFMVIVSVLLVNMLIAMMGNTYQKIAEIRNEWQRQWARIVLVVERSV 747          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Fly
Match: nan (gene:FBgn0036414 transcript:FBtr0321258)

HSP 1 Score: 212.616 bits (540), Expect = 2.901e-57
Identity = 130/423 (30.73%), Postives = 219/423 (51.77%), Query Frame = 2
Query:  605 LRRNENVRGTELYNLMNSNGKGKLLEIYSEQGE----RALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFE-ESYCSILPFFDEFFNEKIY--VCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTI-DASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            +++   V    LY  +N  G G L+++     +      ++  +K ++  +L N G G      +L         +  R+   PR      + P+I +     + F    YC  +   +   N   Y  VCW+   RG  GET+LHLC +  ++ H  +AK LLK +P +  D ++ D+++G++ LH  I+  D  +VK L+ +  DV +R  G F  ++    ++ FS   +  +  +     TN++  V     Y+GEYPLSFAAC   +E +  +L  G +P+ QD NGNTVLHM+VI+ +  ++      Y+   + ++ N   LTP+TL+AKLGR  +F  ++ +  +  W+ GS+ C+ YPL+ +DTI + +G+ +  S L +++ G   +HL++LD GVV  LL  KW  F   RF
Sbjct:   12 VKKQAGVSTQALYKFVNLKGGGLLVDMMKRACQTKQFAEIDHAIKTKVEPFLYNKGAGRYFPISKL---------VLLRNRDRPRT----RQLPEIRALENPDDDFNIHDYCPEVSEAEYISNPTAYRFVCWDLNMRGAVGETILHLCLLNASSLHADLAKRLLKFYPKLILDIYMSDEYYGESVLHIAIVNEDPAMVKYLLDANADVQERCCGAFMSAE----DTKFSRTDSPDHEYVALCPMTNYDGYV-----YWGEYPLSFAACLSQEECFRLVLARGADPDFQDTNGNTVLHMLVIYEKIEMFDVG---YEVGTNIHIKNIQNLTPLTLAAKLGRVEMFFHVMSIEREIYWQLGSITCAAYPLLMIDTINEETGNINKDSVLNFVVFGDKLEHLELLD-GVVIDLLKTKWDTFCKSRF 408          

HSP 2 Score: 102.834 bits (255), Expect = 4.890e-22
Identity = 70/239 (29.29%), Postives = 115/239 (48.12%), Query Frame = 2
Query: 2048 GIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDK--------------------------LSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVI---SRSQKEWISMILQLCSSV 2677
            G+  FI+ L+ +P +  FL SC L++    LR++ +                  I++   +   L    Y LFF  GFK  GPFV MI++M+ GDLLRF +IY++ +  F+QAF+ +F   D                           +S+T F  ++G++++                T++     ++F  FM+ V +LL+NMLIAMMGNTYQ +    +  Q++W  ++L +  SV
Sbjct:  541 GLKMFIENLMTAPSRVMFLFSCALMMTIPWLRVSCLTE----------------IDDHVTVVIMLTTAPYFLFFCRGFKTVGPFVVMIYRMVMGDLLRFVSIYLVFVMGFSQAFYIIFLTFDNPSSPEDQDAESNPMPSPMESIVAMFLMSLTNFGDYYGAMVS----------------TQHEYEAKILFFLFMVIVSVLLVNMLIAMMGNTYQKIAEIRNEWQRQWARIVLVVERSV 747          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Fly
Match: CG4393 (gene:FBgn0039075 transcript:FBtr0339617)

HSP 1 Score: 53.9138 bits (128), Expect = 7.276e-7
Identity = 40/132 (30.30%), Postives = 56/132 (42.42%), Query Frame = 2
Query: 1277 QNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEP---NVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGS 1663
            +++  LL+ +  + N  DS        G  PL  AA  G  EI   LL H   P   N+Q     T LH    H  T      L H    ADPN+ N  G TP+ L+A+ GR      +I  + + +   G+
Sbjct:   62 EDIVRLLLAHEASPNLPDS-------RGSSPLHLAAWAGETEIVRLLLTHPYRPASANLQTIEQETPLHCAAQHGHTGALALLLHHD---ADPNMRNSRGETPLDLAAQYGRLQAVQMLIRAHPELIAHLGT 183          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Fly
Match: CG4393 (gene:FBgn0039075 transcript:FBtr0301085)

HSP 1 Score: 53.9138 bits (128), Expect = 7.276e-7
Identity = 40/132 (30.30%), Postives = 56/132 (42.42%), Query Frame = 2
Query: 1277 QNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEP---NVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGS 1663
            +++  LL+ +  + N  DS        G  PL  AA  G  EI   LL H   P   N+Q     T LH    H  T      L H    ADPN+ N  G TP+ L+A+ GR      +I  + + +   G+
Sbjct:   62 EDIVRLLLAHEASPNLPDS-------RGSSPLHLAAWAGETEIVRLLLTHPYRPASANLQTIEQETPLHCAAQHGHTGALALLLHHD---ADPNMRNSRGETPLDLAAQYGRLQAVQMLIRAHPELIAHLGT 183          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Zebrafish
Match: trpv1 (transient receptor potential cation channel, subfamily V, member 1 [Source:ZFIN;Acc:ZDB-GENE-030912-8])

HSP 1 Score: 123.25 bits (308), Expect = 2.702e-28
Identity = 135/485 (27.84%), Postives = 207/485 (42.68%), Query Frame = 2
Query: 1073 LKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLE---HGTEPNVQDCNGNTVLHMV--VIHNRTAIYRFALKHY-----------KKPADPNVINKYGLTPITLSAKLGRRHIFMEIID---LNTQEL------WKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTS-DDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYC--RFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLF--KDIDKLSITTFK 2437
            LK F N A   +    + GQTALH  I +  ++ V++LV  G DV+ +A G FFQ              N K                     YFGE PLS AACT  Q+I DFL+E      +   +DC+GNTVLH +  V  N      F +  Y            K     + N  GLTPITL+AK G+  +F  I+    +  + L      W YG +  S+Y L  LDT +       +S+L  ++ G+   + L+ML    + +L+ EKW  F ++ F+   ++ + Y  I   +    E  ++     P +  K +  Y L +  I+ +                  FI+GL++   K     S     L I     Q+F  +       V  YC  ++    F++    L+   LL+F+ G K  G +  MI KM+ G++ RF  +Y++ L  F+ A   L   + ID  S   F+
Sbjct:  148 LKNFINAA---YTDSYYKGQTALHVAIERRSMKFVQMLVKKGADVHAKACGKFFQP-------------NQKMCF------------------YFGELPLSLAACTNQQDIVDFLMENPHQAVDVRERDCHGNTVLHALVSVADNSPENTEFVIAMYDHILIKADQLHPKTKLEEIENNEGLTPITLAAKKGKLGLFKHIVQRELMGCRHLSRKITEWAYGPVCSSLYDLSSLDTYEK------NSALEIVVYGSEIPNRLEMLQIEPLNRLIEEKWDQFAHRMFLFNFIVYVIYLFIFTASAFYHEEGKDYANQPPYLYAKSREGYLLLTGHIISITGAFYF------------FIRGLIDMVRKRPRFQS-----LIIDGYTDQLFFVQGLLFLASVVLYCYGQYEYLAFLVLCLALSWINLLYFSRGSKNLGIYNVMIQKMVLGEIRRFLVVYMVFLIGFSAALVTLLDQESIDSGSTRDFR 575          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Zebrafish
Match: trpv1 (transient receptor potential cation channel, subfamily V, member 1 [Source:ZFIN;Acc:ZDB-GENE-030912-8])

HSP 1 Score: 119.398 bits (298), Expect = 4.879e-27
Identity = 135/487 (27.72%), Postives = 208/487 (42.71%), Query Frame = 2
Query: 1073 LKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLE---HGTEPNVQDCNGNTVLHMV--VIHNRTAIYRFALKHY-----------KKPADPNVINKYGLTPITLSAKLGRRHIFMEIID---LNTQEL------WKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTS-DDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEE--SIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYC--RFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLF--KDIDKLSITTFK 2437
            LK F N A   +    + GQTALH  I +  ++ V++LV  G DV+ +A G FFQ              N K                     YFGE PLS AACT  Q+I DFL+E      +   +DC+GNTVLH +  V  N      F +  Y            K     + N  GLTPITL+AK G+  +F  I+    +  + L      W YG +  S+Y L  LDT +       +S+L  ++ G+   + L+ML    + +L+ EKW  F ++ F+   ++ + Y  I   +    E  ++  +    P +  K +  Y L +  I+ +                  FI+GL++   K     S     L I     Q+F  +       V  YC  ++    F++    L+   LL+F+ G K  G +  MI KM+ G++ RF  +Y++ L  F+ A   L   + ID  S   F+
Sbjct:  152 LKNFINAA---YTDSYYKGQTALHVAIERRSMKFVQMLVKKGADVHAKACGKFFQP-------------NQKMCF------------------YFGELPLSLAACTNQQDIVDFLMENPHQAVDVRERDCHGNTVLHALVSVADNSPENTEFVIAMYDHILIKADQLHPKTKLEEIENNEGLTPITLAAKKGKLGLFKHIVQRELMGCRHLSRKITEWAYGPVCSSLYDLSSLDTYEK------NSALEIVVYGSEIPNRLEMLQIEPLNRLIEEKWDQFAHRMFLFNFIVYVIYLFIFTASAFYHEEGKDYANQTKPPYLYAKSREGYLLLTGHIISITGAFYF------------FIRGLIDMVRKRPRFQS-----LIIDGYTDQLFFVQGLLFLASVVLYCYGQYEYLAFLVLCLALSWINLLYFSRGSKNLGIYNVMIQKMVLGEIRRFLVVYMVFLIGFSAALVTLLDQESIDSGSTRDFR 581          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Zebrafish
Match: trpv1 (transient receptor potential cation channel, subfamily V, member 1 [Source:ZFIN;Acc:ZDB-GENE-030912-8])

HSP 1 Score: 119.398 bits (298), Expect = 4.879e-27
Identity = 135/487 (27.72%), Postives = 208/487 (42.71%), Query Frame = 2
Query: 1073 LKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLE---HGTEPNVQDCNGNTVLHMV--VIHNRTAIYRFALKHY-----------KKPADPNVINKYGLTPITLSAKLGRRHIFMEIID---LNTQEL------WKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTS-DDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEE--SIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYC--RFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLF--KDIDKLSITTFK 2437
            LK F N A   +    + GQTALH  I +  ++ V++LV  G DV+ +A G FFQ              N K                     YFGE PLS AACT  Q+I DFL+E      +   +DC+GNTVLH +  V  N      F +  Y            K     + N  GLTPITL+AK G+  +F  I+    +  + L      W YG +  S+Y L  LDT +       +S+L  ++ G+   + L+ML    + +L+ EKW  F ++ F+   ++ + Y  I   +    E  ++  +    P +  K +  Y L +  I+ +                  FI+GL++   K     S     L I     Q+F  +       V  YC  ++    F++    L+   LL+F+ G K  G +  MI KM+ G++ RF  +Y++ L  F+ A   L   + ID  S   F+
Sbjct:  152 LKNFINAA---YTDSYYKGQTALHVAIERRSMKFVQMLVKKGADVHAKACGKFFQP-------------NQKMCF------------------YFGELPLSLAACTNQQDIVDFLMENPHQAVDVRERDCHGNTVLHALVSVADNSPENTEFVIAMYDHILIKADQLHPKTKLEEIENNEGLTPITLAAKKGKLGLFKHIVQRELMGCRHLSRKITEWAYGPVCSSLYDLSSLDTYEK------NSALEIVVYGSEIPNRLEMLQIEPLNRLIEEKWDQFAHRMFLFNFIVYVIYLFIFTASAFYHEEGKDYANQTKPPYLYAKSREGYLLLTGHIISITGAFYF------------FIRGLIDMVRKRPRFQS-----LIIDGYTDQLFFVQGLLFLASVVLYCYGQYEYLAFLVLCLALSWINLLYFSRGSKNLGIYNVMIQKMVLGEIRRFLVVYMVFLIGFSAALVTLLDQESIDSGSTRDFR 581          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Zebrafish
Match: trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:ZFIN;Acc:ZDB-GENE-040624-12])

HSP 1 Score: 93.9745 bits (232), Expect = 3.611e-19
Identity = 82/297 (27.61%), Postives = 129/297 (43.43%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVN-QRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRTA---IYRFALKHYKK-----PADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            +RG  GET LH+  M         A  L+   P +  +    + + G TALH  +I  +  ++  ++  G DV   R  G +F+ +                               EG L Y+GE+ L+FAAC GN++I   L++ G     QD  GNT+LH++V+  N+T    I+ F L    +     P D  V N  GLTP  L+A+ G   +F  +++      W  G +   +Y L ++D+       D  S L  I      +   +L+   VRQL+  KW ++G   F
Sbjct:   71 ERGELGETALHVAVMNDNFE---AAVALMNGAPELINEPMTSELYHGLTALHIAVINQNPNLIWEMIKRGADVTTPRVTGMYFRKRR------------------------------EG-LFYYGEHILAFAACVGNKDIMSMLIKAGANIRAQDSRGNTILHLLVLQPNKTTACQIFDFLLAQDAEQDSALPLD-MVPNYKGLTPFKLAARDGNVVVFQHLVNRRKVVQWSLGPVSSYLYDLTEIDS-----RVDEHSVLEIIATSHKKEARRILELTPVRQLITLKWNLYGKHYF 327          

HSP 2 Score: 64.3142 bits (155), Expect = 4.578e-10
Identity = 36/143 (25.17%), Postives = 74/143 (51.75%), Query Frame = 2
Query: 2231 FASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            F+ +L  F L++F  GF++ GP+V +I K I GD+ +F  + +I L   + A +  +   + L++  +++F  +L + F+++ G+           + +V      F +   +LL N+L+AMM +T   V     + W + ++
Sbjct:  455 FSLILGWFSLVYFARGFEMLGPYVIVIQKSIFGDITKFMWLSIIFLIGSSAALWIFYMTQEPLALPQYRSFPITLFSQFEVSVGQIDLPVDHTLFTHPVVYWTHVCFSLISNVLLFNLLVAMMSDTQWRVTQERDELWRTQVV 597          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Zebrafish
Match: trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:ZFIN;Acc:ZDB-GENE-040624-12])

HSP 1 Score: 93.9745 bits (232), Expect = 3.611e-19
Identity = 82/297 (27.61%), Postives = 129/297 (43.43%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVN-QRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRTA---IYRFALKHYKK-----PADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            +RG  GET LH+  M         A  L+   P +  +    + + G TALH  +I  +  ++  ++  G DV   R  G +F+ +                               EG L Y+GE+ L+FAAC GN++I   L++ G     QD  GNT+LH++V+  N+T    I+ F L    +     P D  V N  GLTP  L+A+ G   +F  +++      W  G +   +Y L ++D+       D  S L  I      +   +L+   VRQL+  KW ++G   F
Sbjct:   71 ERGELGETALHVAVMNDNFE---AAVALMNGAPELINEPMTSELYHGLTALHIAVINQNPNLIWEMIKRGADVTTPRVTGMYFRKRR------------------------------EG-LFYYGEHILAFAACVGNKDIMSMLIKAGANIRAQDSRGNTILHLLVLQPNKTTACQIFDFLLAQDAEQDSALPLD-MVPNYKGLTPFKLAARDGNVVVFQHLVNRRKVVQWSLGPVSSYLYDLTEIDS-----RVDEHSVLEIIATSHKKEARRILELTPVRQLITLKWNLYGKHYF 327          

HSP 2 Score: 64.3142 bits (155), Expect = 4.578e-10
Identity = 36/143 (25.17%), Postives = 74/143 (51.75%), Query Frame = 2
Query: 2231 FASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            F+ +L  F L++F  GF++ GP+V +I K I GD+ +F  + +I L   + A +  +   + L++  +++F  +L + F+++ G+           + +V      F +   +LL N+L+AMM +T   V     + W + ++
Sbjct:  455 FSLILGWFSLVYFARGFEMLGPYVIVIQKSIFGDITKFMWLSIIFLIGSSAALWIFYMTQEPLALPQYRSFPITLFSQFEVSVGQIDLPVDHTLFTHPVVYWTHVCFSLISNVLLFNLLVAMMSDTQWRVTQERDELWRTQVV 597          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Xenopus
Match: rbm19 (RNA binding motif protein 19 [Source:Xenbase;Acc:XB-GENE-922190])

HSP 1 Score: 141.354 bits (355), Expect = 1.602e-34
Identity = 146/566 (25.80%), Postives = 250/566 (44.17%), Query Frame = 2
Query:  995 GVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDV-NQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPAD----------PNVINKYGLTPITLSAKLGRRHIFME-IIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLR---ETKEESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFY-LLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEW 2644
            G  GE +LH+  +     +  I   LL  FP +       D + G+TALH  I+  + E+V+ L+    D+ N RA G+FF  +                                   +Y+GEY  SFAA  GNQEI   L+E+      QD  GNTV H++V+H   ++   A K Y   A             + N  G+TP  L+A+ G   +  E  I      +  +G +  ++Y L  +D+ D     D  S +  I    ++   ++L+   +++LL+ KW  FGYK F+   +  + Y +I+ +    R    T   +IA   + +++ +  Y   S  I++V+             GI+  ++  +   L ACF+++  +      LR    F   +G              E  +M  +L++ +  +++F  GF+L GP   MI KM+ GDLL+F  + + VL  F  AF   F+ ++  ++ +F  F     TLFQ+  G             +++L+++  +M F  +LL+N+LIA+M +T+  V +     W
Sbjct:   30 GALGENVLHIAALY---NNNEILVELLDAFPFLINKPIECDAYKGETALHIAIVNQNAEMVRELIARKADMENARATGNFFAPR-------------------------------RKGQHYYGEYVTSFAAYVGNQEILQTLVENEAPLETQDSQGNTVFHILVLHQNKSM---ACKMYDFLAAIIPKKQLSYLETITNNDGMTPFKLAAQQGDVQVMFEYFIKKRRHTILSFGPLGSTLYDLTGIDSWD-----DRLSVIDIICTSNNNAARNLLEITPLKELLHYKWTAFGYKYFLLCTIFYIMYTVILTLCCLYRPIMHTITITIAEILQEAYQTRNDYLRLSGEIIVVV------------GGILCLVEIFIFRLLYACFIIAVVI------LR----FLSSDG--------------ETIMMSLALISAWCNVIYFARGFRLLGPLCIMIQKMVLGDLLKFCILLIAVLIGFAAAFNVHFQAMNTTAVPSFNGFPDITFTLFQLMMGLDSLPLPANIVMPKMILVLYIVYMFFGFVLLVNLLIALMTHTHFRVTNDRTTLW 517          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Xenopus
Match: trpv3 (transient receptor potential cation channel, subfamily V, member 3 [Source:NCBI gene;Acc:100487056])

HSP 1 Score: 128.642 bits (322), Expect = 6.596e-30
Identity = 148/538 (27.51%), Postives = 239/538 (44.42%), Query Frame = 2
Query: 1106 FIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHG-TEPNVQDCNGNTVLHMV--VIHNRTA-------IYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQEL-----------WKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYII--NGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIP--LRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEW 2644
            +  + + GQTAL+  I +  +E+VK L+  G  ++ RA G FF                            N  +  EG   YFGE PL+ AACT   EI   +++   T   +QD  GNTVLH +  V  N  A       +Y   L++ K  +   + N  GLT + L+AKLG+  I   I+    +E            W YG +  S+Y L  +DT        W +S++ I+  N   D+  ++L    +  LL  KW+ F    F    LL   Y + + + +  R   E+ +     +S+++ +   +  + I++           +KE  +M  +K    S LK+    + F IL  I   L I  +F    G    D Y        +F++ A  L    LL++T GF+  G +  MI K+I  D+L+F  +Y++ L  F  A   L ++ +       ++   +++ LF++T G    E  K  KY  L L +  +F+I   +LLLNMLIA+MG T + +   S+  W
Sbjct:  188 YTEENYKGQTALNIAIERRQVELVKYLIEKGAKIDVRAQGRFF----------------------------NPKNKYEG--FYFGETPLALAACTNQPEIVQLIMDKSPTIGTIQDSLGNTVLHALVNVADNSEAQNDFIIGMYDTILRNCKNKSLEQIPNNEGLTSMQLAAKLGKTEILHYILSREIKEKENMVLSRKFTDWAYGPVSSSLYDLTSIDTC-------WPNSVLEIVVYNTDIDNRHELLTLEPLHTLLQMKWKKFARYMFFLSFLLSFTYNIALTLVSYYRPRGEQDV-YPLNLSYENGWLQLVGQMFIIVCATYLM-----VKEAVVMFLVK---QSDLKSVLSDAWFHILFFIQAVLVIVSVFCYLFGV---DFYL-------VFLVLAMALGWMNLLYYTRGFQSLGIYSVMIQKVILNDVLKFLFVYILFLLGFGVALASLLENCEDGE--ECQSLSTAILELFELTIGLRGLEMDKDPKYPVLFLFLLITFVILTFVLLLNMLIALMGETVEKISQESEHIW 667          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Xenopus
Match: tulp2 (TUB like protein 2 [Source:Xenbase;Acc:XB-GENE-991735])

HSP 1 Score: 123.25 bits (308), Expect = 1.195e-28
Identity = 95/295 (32.20%), Postives = 138/295 (46.78%), Query Frame = 2
Query:  992 RGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDV-NQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLL-EHGTEPNVQDCNGNTVLHMVVIH--NRTAIYRFALKHYKKP-ADPNVI----NKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            RG  GET+LH+    +    R +AK++L+  P +  +    D + G+TALH  I++ D+E VKLL+  G DV N RA G  F                                  +  L YFGEYPLSFAACTG++EI   +L +H    N QD  GNTVLH++V+      A   + +     P  D + +    N  G T + L+A  G   +F  +I       W  G++  S+Y L  +DT D        S L  I +  S     ++D   +++LLN KW++FG K F
Sbjct:   60 RGSLGETILHI---AVLNGKRELAKVILENVPTLVNNAMTSDMYKGETALHIAILKEDIESVKLLLKYGADVINARATGTCFVPG-------------------------------KKSLCYFGEYPLSFAACTGHKEITKLILVDHNAPVNAQDSLGNTVLHILVLQPNKELACLMYEMILALVPLKDSHCVEHLQNNDGFTTLNLAANEGDMEMFNYLIKKQKAIYWTIGTVSYSIYNLTDIDTWDTE-----RSVLDIITSNKSSKVCKLIDVTPIKELLNLKWKLFGRKNF 315          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Xenopus
Match: tulp2 (TUB like protein 2 [Source:Xenbase;Acc:XB-GENE-991735])

HSP 1 Score: 122.865 bits (307), Expect = 2.361e-28
Identity = 95/295 (32.20%), Postives = 138/295 (46.78%), Query Frame = 2
Query:  992 RGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDV-NQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLL-EHGTEPNVQDCNGNTVLHMVVIH--NRTAIYRFALKHYKKP-ADPNVI----NKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            RG  GET+LH+    +    R +AK++L+  P +  +    D + G+TALH  I++ D+E VKLL+  G DV N RA G  F                                  +  L YFGEYPLSFAACTG++EI   +L +H    N QD  GNTVLH++V+      A   + +     P  D + +    N  G T + L+A  G   +F  +I       W  G++  S+Y L  +DT D        S L  I +  S     ++D   +++LLN KW++FG K F
Sbjct:   60 RGSLGETILHI---AVLNGKRELAKVILENVPTLVNNAMTSDMYKGETALHIAILKEDIESVKLLLKYGADVINARATGTCFVPG-------------------------------KKSLCYFGEYPLSFAACTGHKEITKLILVDHNAPVNAQDSLGNTVLHILVLQPNKELACLMYEMILALVPLKDSHCVEHLQNNDGFTTLNLAANEGDMEMFNYLIKKQKAIYWTIGTVSYSIYNLTDIDTWDTE-----RSVLDIITSNKSSKVCKLIDVTPIKELLNLKWKLFGRKNF 315          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Xenopus
Match: tgfb2 (transforming growth factor beta 2 [Source:Xenbase;Acc:XB-GENE-480560])

HSP 1 Score: 118.242 bits (295), Expect = 1.228e-27
Identity = 85/291 (29.21%), Postives = 133/291 (45.70%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQ-RALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHN----RTAIYRFALKHYKKPADPN---VINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFG 1837
            +RG  GET LH+    +T  +   A++L++  P +       D + GQ ALH   +  ++ +VKLL+ SG DV+  RA G FF               N KNL                   YFGE+ L+FAAC GN  I   L+  G +   QDC GNTVLH++++         +  F L    + A  +   + NK GL+P+ L+A  G   +F  ++    +  W +G +   +Y L ++D+ +        S L  I         ++L+   V++LL EKW+  G
Sbjct:   41 QRGAQGETALHVA---VTHNNMEAAQVLIQEAPALVHQPMTSDLYQGQVALHIAAVNQNVGLVKLLIESGADVSSPRATGTFFSL-------------NPKNLF------------------YFGEHILAFAACVGNTHIVKLLINSGADLYAQDCWGNTVLHILILQPSENLSCQMLDFILSQELQDAKQSLCQICNKQGLSPLMLAAAEGNMAMFQHLVQKQRKAQWAFGPVTTMLYDLSEIDSWEKD-----QSVLEIIATSRKSQASNILNCQPVKELLKEKWKRRG 292          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Mouse
Match: Trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:MGI Symbol;Acc:MGI:1927259])

HSP 1 Score: 174.096 bits (440), Expect = 1.426e-44
Identity = 154/582 (26.46%), Postives = 265/582 (45.53%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALK-----HYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +         A +L++  P +  +    + + GQTALH  +I  ++ +V+ L+  G  V+ RA G              S+F    + LI                 Y+GE+PLSFAAC G++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L      H K  +   V N  GLTP  L+   G   +F  ++       W YG +  ++Y L +   ID+SG  D  S L  I+     +   +LD   V++L++ KW+ +G   F  L  + + Y +   +    R  K               ++ +  E  ++ K   R   E V IV  +++  + I ++   G+  F  + +L  P     +   F++L+ + +R+T +    +G             E + + FA +L    +++F  GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D   +  F  +  +L + F++                 +  + +A+F I   +L+LN+LIAMMG+T+  V     + W + ++
Sbjct:  114 QRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATG--------------SVFHYRPHNLI-----------------YYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLK--SLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTE---IDSSG--DDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYIICFTMCCVYRPLKPRITNRTNPRDNTLMQQKLLQEAYVTPKDDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTILGGPFHVIIITYAFMVLVTMVMRLTNV----DG-------------EVVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPANYDVDLPFMYSVTYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVV 637          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Mouse
Match: Trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:MGI Symbol;Acc:MGI:1927259])

HSP 1 Score: 174.096 bits (440), Expect = 1.561e-44
Identity = 154/582 (26.46%), Postives = 265/582 (45.53%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALK-----HYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +         A +L++  P +  +    + + GQTALH  +I  ++ +V+ L+  G  V+ RA G              S+F    + LI                 Y+GE+PLSFAAC G++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L      H K  +   V N  GLTP  L+   G   +F  ++       W YG +  ++Y L +   ID+SG  D  S L  I+     +   +LD   V++L++ KW+ +G   F  L  + + Y +   +    R  K               ++ +  E  ++ K   R   E V IV  +++  + I ++   G+  F  + +L  P     +   F++L+ + +R+T +    +G             E + + FA +L    +++F  GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D   +  F  +  +L + F++                 +  + +A+F I   +L+LN+LIAMMG+T+  V     + W + ++
Sbjct:  114 QRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATG--------------SVFHYRPHNLI-----------------YYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLK--SLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTE---IDSSG--DDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYIICFTMCCVYRPLKPRITNRTNPRDNTLMQQKLLQEAYVTPKDDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTILGGPFHVIIITYAFMVLVTMVMRLTNV----DG-------------EVVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPANYDVDLPFMYSVTYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVV 637          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Mouse
Match: Trpv5 (transient receptor potential cation channel, subfamily V, member 5 [Source:MGI Symbol;Acc:MGI:2429764])

HSP 1 Score: 160.999 bits (406), Expect = 2.151e-40
Identity = 150/585 (25.64%), Postives = 263/585 (44.96%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALK-----HYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMY---IINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMD-FIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +       I   ML++  P +  +  + + F GQTALH  ++  ++ +V+ L+  G   + RA G  F              ++  NL+                  Y+GE+PLSFAAC G++EI   L+EHG +   QD  GNTVLH++V+  N+T    +Y   L      H K  +   V N  GLTP  L+   G   +F  ++    +  W +G +  S+Y L ++D+        W   L +   +++    +   +L+   V++L++ KW+ +G   F  L  L +FY +        R  K               E+    E  ++++ K R   E V ++  +++  L I ++   G    F + +L  P     +    L+LL + +R+T +    NG             E + +  A +L    +++F  GF++ GPF  MI KMI GDLLRF  +  +V+  F  AF+ +F+  D  ++  F  +  ++ + F++                 +  + +A+F I   +L+LN+ IAMMG+T+  V     + W + ++
Sbjct:   68 QRGALGETALHVAALYDNLDAAI---MLMEAAPYLVTESTLCEPFVGQTALHIAVMNQNVNLVRALLARGASASARATGSAFH-------------RSSHNLI------------------YYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSYDGGDHLK--SLELVPNNQGLTPFKLAGVEGNTVMFQHLMQKRKRIQWSFGPLTSSLYDLTEIDS--------WGEELSFLELVVSSKKKEARQILEQTPVKELVSLKWKKYGQPYFCLLGALYIFYMVCFTTCCVYRPLKFRDANRTHVRDNTIMEQKSLQEAYVTYQDKIRLVGELVTVIGAVIILLLEIPDIFRVGASRYFGQTVLGGPFHVIIITYASLVLLTMAMRLTNV----NG-------------EVVPMSMALVLGWCSVMYFARGFQMLGPFTIMIQKMIFGDLLRFCWLMAMVILGFASAFYIIFQTEDPDNLGEFSDYPTAMFSTFELFLTIIDGPANYRVDLPFMYSVTYATFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVV 591          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Mouse
Match: Trpv3 (transient receptor potential cation channel, subfamily V, member 3 [Source:MGI Symbol;Acc:MGI:2181407])

HSP 1 Score: 120.553 bits (301), Expect = 2.214e-27
Identity = 151/585 (25.81%), Postives = 247/585 (42.22%), Query Frame = 2
Query: 1004 GETLLHLCGMQITATHRIIAKMLLKLFP-NIARDWFIG-----DKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEH-GTEPNVQDCNGNTVLHMVVIHNR---------TAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQEL-----------WKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKA---------CFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDI--DKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEW 2644
            G+T L    + I    + I ++LL     N   D FI      + + GQTAL+  I +   +I  +L+ +G DVN  A G FF                              N   + +  YFGE PL+ AACT   EI   L+E+  T+   QD  GN +LH +V               +Y   L          + N  GLTP+ L+AK+G+  I   I+    +E            W YG +  S+Y L  +DT      TD S   + + N   D+  +ML    +  LL+ KW+ F    F        FY + + + +  R  ++E   L   ++  HK  +      +  + VL       +KE GI  F+  L  S L++          F +   L++L + L +               + Y  ++  + +  A  L    +L++T GF+  G +  MI K+I  D+L+F  +Y++ L  F  A   L +    DK   +++ +F  +++ LF++T G       + + Y  L L +  +++I   +LLLNMLIA+MG T + V   S++ W
Sbjct:  168 GKTCLMKALLNINPNTKEIVRILLAFAEENDILDRFINAEYTEEAYEGQTALNIAIERRQGDITAVLIAAGADVNAHAKGVFF------------------------------NPKYQHEGFYFGETPLALAACTNQPEIVQLLMENEQTDITSQDSRGNNILHALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETMRNNDGLTPLQLAAKMGKAEILKYILSREIKEKPLRSLSRKFTDWAYGPVSSSLYDLTNVDTT-----TDNSVLEIIVYNTNIDNRHEMLTLEPLHTLLHTKWKKFAKYMFFLSFCFYFFYNITLTLVSYYRPREDED--LPHPLALTHKMSWL---QLLGRMFVLIWATCISVKE-GIAIFL--LRPSDLQSILSDAWFHFVFFVQAVLVILSVFLYL---------------FAYKEYLACLVLAMA--LGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYILFLLGFGVALASLIEKCSKDKKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSTYPILFLFLLITYVILTFVLLLNMLIALMGETVENVSKESERIW 692          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Mouse
Match: Trpv4 (transient receptor potential cation channel, subfamily V, member 4 [Source:MGI Symbol;Acc:MGI:1926945])

HSP 1 Score: 95.9005 bits (237), Expect = 1.017e-19
Identity = 84/270 (31.11%), Postives = 118/270 (43.70%), Query Frame = 2
Query: 1121 FFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHG---TEPNVQDCNGNTVLHMVV--IHNRTAIYRFALKHY--------KKPADPN---VINKYGLTPITLSAKLGRRHIFMEII-----DLNTQEL------WKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            + GQT+LH  I +     V+LLV  G DV+ +A G FFQ +                               EG   YFGE PLS AACT    I ++L E+     +   QD  GNTVLH +V    N     +F  K Y        +   D N   V+N  GL+P+ ++AK G+  +F  II     D +T+ L      W YG +  S+Y L  LDT       + S   + + N   ++  +ML    + +LL +KWR FG   F
Sbjct:  236 YRGQTSLHIAIERRCKHYVELLVAQGADVHAQARGRFFQPK------------------------------DEGGYFYFGELPLSLAACTNQPHIVNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCSRLFPDSNLETVLNNDGLSPLMMAAKTGKIGVFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYDLSSLDTCGE----EVSVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSF 471          

HSP 2 Score: 63.929 bits (154), Expect = 9.050e-10
Identity = 52/170 (30.59%), Postives = 84/170 (49.41%), Query Frame = 2
Query: 2225 VMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLF----------KDIDKLSITTF------KTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQK----EWISMILQLCSS 2674
            ++FA +L     L+FT G KLTG +  MI K++  DL RF  +Y++ +  +  A   L           +D    ++ T+      +TF   L+ LF++T G    E     KY  + +L+  +++I   +LLLNMLIA+MG T   V   S+     +W + IL +  S
Sbjct:  578 MVFALVLGWMNALYFTRGLKLTGTYSIMIQKILFKDLFRFLLVYLLFMIGYASALVTLLNPCTNMKVCDEDQSNCTVPTYPACRDSETFSAFLLDLFKLTIGMGDLEMLSSAKYPVVFILLLVTYIILTFVLLLNMLIALMGETVGQVSKESKHIWKLQWATTILDIERS 747          
BLAST of Transient receptor potential cation channel subfamily V member vs. UniProt/SwissProt
Match: sp|Q9H1D0|TRPV6_HUMAN (Transient receptor potential cation channel subfamily V member 6 OS=Homo sapiens OX=9606 GN=TRPV6 PE=1 SV=3)

HSP 1 Score: 174.866 bits (442), Expect = 5.011e-44
Identity = 149/582 (25.60%), Postives = 261/582 (44.85%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALKHYK-----KPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +         A +L++  P +  +    + + GQTALH  ++  ++ +V+ L+     V+ RA G  F+                                   +L YFGE+PLSFAAC  ++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L + +     +P D  V N  GLTP  L+   G   +F  ++       W YG +  ++Y    L  ID+SG  D  S L  II     +   +LD   V++L++ KW+ +G   F  L  + L Y +   +    R  K               ++ +  E  M+ K   R   E V ++  +++  + + ++   G+  F  + +L  P     +   F++L+ + +R+         +++ +V           + FA +L    +++F  GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D   +  F  +  +L + F++                 +  + +A+F I   +L+LN+LIAMMG+T+  V     + W + I+
Sbjct:  114 QRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVVNQNMNLVRALLARRASVSARATGTAFRRS-------------------------------PCNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDRHGDHLQPLD-LVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHTQWTYGPLTSTLY---DLTEIDSSG--DEQSLLELIITTKKREARQILDQTPVKELVSLKWKRYGRPYFCMLGAIYLLYIICFTMCCIYRPLKPRTNNRTSPRDNTLLQQKLLQEAYMTPKDDIRLVGELVTVIGAIIILLVEVPDIFRMGVTRFFGQTILGGPFHVLIITYAFMVLVTMVMRLI--------SASGEVVP---------MSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPEELGHFYDYPMALFSTFELFLTIIDGPANYNVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQIV 638          
BLAST of Transient receptor potential cation channel subfamily V member vs. UniProt/SwissProt
Match: sp|Q91WD2|TRPV6_MOUSE (Transient receptor potential cation channel subfamily V member 6 OS=Mus musculus OX=10090 GN=Trpv6 PE=1 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 1.092e-43
Identity = 154/582 (26.46%), Postives = 265/582 (45.53%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALK-----HYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +         A +L++  P +  +    + + GQTALH  +I  ++ +V+ L+  G  V+ RA G              S+F    + LI                 Y+GE+PLSFAAC G++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L      H K  +   V N  GLTP  L+   G   +F  ++       W YG +  ++Y L +   ID+SG  D  S L  I+     +   +LD   V++L++ KW+ +G   F  L  + + Y +   +    R  K               ++ +  E  ++ K   R   E V IV  +++  + I ++   G+  F  + +L  P     +   F++L+ + +R+T +    +G             E + + FA +L    +++F  GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D   +  F  +  +L + F++                 +  + +A+F I   +L+LN+LIAMMG+T+  V     + W + ++
Sbjct:  114 QRGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATG--------------SVFHYRPHNLI-----------------YYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLK--SLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTE---IDSSG--DDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYIICFTMCCVYRPLKPRITNRTNPRDNTLMQQKLLQEAYVTPKDDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTILGGPFHVIIITYAFMVLVTMVMRLTNV----DG-------------EVVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPANYDVDLPFMYSVTYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVV 637          
BLAST of Transient receptor potential cation channel subfamily V member vs. UniProt/SwissProt
Match: sp|Q9R186|TRPV6_RAT (Transient receptor potential cation channel subfamily V member 6 OS=Rattus norvegicus OX=10116 GN=Trpv6 PE=1 SV=2)

HSP 1 Score: 172.94 bits (437), Expect = 2.682e-43
Identity = 152/582 (26.12%), Postives = 263/582 (45.19%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALK-----HYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            ++G  GET LH+  +         A +L++  P +  +    + + GQTALH  +I  ++ +V+ L+  G  V+ RA G  F  +                                 +L Y+GE+PLSFAAC G++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L      H K  +   V N  GLTP  L+   G   +F  ++       W YG +  ++Y L +   ID+SG  D  S L  I+     +   +LD   V++L++ KW+ +G   F  L  + + Y +   +    R  K               ++ +  E  ++ K   R   E V IV  +++  + I ++   G+  F  + +L  P     +   F++L+ + +R+T          N+D        E + + FA +L    +++F  GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D   +  F  +  +L + F++                 +  + +A+F I   +L+LN+LIAMMG+T+  V     + W + ++
Sbjct:  114 QKGAMGETALHIAALYDNLE---AAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATGSVFHYR-------------------------------PHNLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLK--SLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHIQWTYGPLTSTLYDLTE---IDSSG--DDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFCVLGAIYVLYIICFTMCCVYRPLKPRITNRTNPRDNTLLQQKLLQEAYVTPKDDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTILGGPFHVIIVTYAFMVLVTMVMRLT----------NSDG-------EVVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPANYDVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVV 637          
BLAST of Transient receptor potential cation channel subfamily V member vs. UniProt/SwissProt
Match: sp|Q9XSM3|TRPV5_RABIT (Transient receptor potential cation channel subfamily V member 5 OS=Oryctolagus cuniculus OX=9986 GN=Trpv5 PE=1 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 3.107e-43
Identity = 148/585 (25.30%), Postives = 262/585 (44.79%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALKHYKKPAD-----PNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMY---IINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMD-FIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +         A +L++  P +A++  + + F GQTALH  ++  +L +V+ L+  G  V+ RA G  F+             ++  NL+                  Y+GE+PLSFAAC G++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L  Y + +D       V N  GLTP  L+   G   +F  ++       W  G +  ++Y L ++D+        W   L +   +++    +   +L+   V++L++ KW+ +G   F  L  L + Y +        R  K               ++ +  E  ++ +   R   E V +   +++  L I ++   G    F + +L  P     +    L+LL + +R+T +    NG             E + + FA +L    +++F  GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF   F+  D  ++  F  +  +L + F++                 +  + +A+F I   +L+LN+ IAMMG+T+  V     + W + ++
Sbjct:   74 QRGAVGETALHVAALYDNLE---AATLLMEAAPELAKEPALCEPFVGQTALHIAVMNQNLNLVRALLARGASVSARATGAAFR-------------RSPHNLI------------------YYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLS-YDEHSDHLQSLELVPNHQGLTPFKLAGVEGNTVMFQHLMQKRKHVQWTCGPLTSTLYDLTEIDS--------WGEELSFLELVVSSKKREARQILEQTPVKELVSFKWKKYGRPYFCVLASLYILYMICFTTCCIYRPLKLRDDNRTDPRDITILQQKLLQEAYVTHQDNIRLVGELVTVTGAVIILLLEIPDIFRVGASRYFGQTILGGPFHVIIITYASLVLLTMVMRLTNM----NG-------------EVVPLSFALVLGWCSVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFHITFQTEDPNNLGEFSDYPTALFSTFELFLTIIDGPANYSVDLPFMYCITYAAFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVV 598          
BLAST of Transient receptor potential cation channel subfamily V member vs. UniProt/SwissProt
Match: sp|Q9NQA5|TRPV5_HUMAN (Transient receptor potential cation channel subfamily V member 5 OS=Homo sapiens OX=9606 GN=TRPV5 PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 4.253e-40
Identity = 149/585 (25.47%), Postives = 259/585 (44.27%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT---AIYRFALKH-----YKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMY---IINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK---------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFI-KGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  +       ++   L++  P +  +    + F GQTALH  ++  ++ +V+ L+     V+ RA G  F+             ++ +NL+                  YFGE+PLSFAAC  ++EI   L+EHG +   QD  GNTVLH++++  N+T    +Y   L +     + +P D  V N  GLTP  L+   G   +F  ++       W YG +   +Y L ++D+        W   L +   +++    +   +L+   V++L++ KW  +G   F  L  L L Y +        R  K               ++ +  E   + +   R   E V IV  +++  L I ++   G   +  K +L  P     +    L+L+ + +R+T         +N +V           + FA +L    +++FT GF++ GPF  MI KMI GDL+RF  +  +V+  F  AF+ +F+  D  S+  F  +  +L T F++                 +  +V  +F I   +L+LN+ IAMMG+T+  V     + W + ++
Sbjct:   74 QRGALGETALHIAALYDNLEAALV---LMEAAPELVFEPTTCEAFAGQTALHIAVVNQNVNLVRALLTRRASVSARATGTAFR-------------RSPRNLI------------------YFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGHGDHLQPLD-LVPNHQGLTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDLTEIDS--------WGEELSFLELVVSSDKREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYRPLKFRGGNRTHSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRYFGKTILGGPFHVIIITYASLVLVTMVMRLT--------NTNGEVVP---------MSFALVLGWCSVMYFTRGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFLTVIDAPANYDVDLPFMFSIVNFAFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVV 598          
BLAST of Transient receptor potential cation channel subfamily V member vs. TrEMBL
Match: A0A267DQR1 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012503g1 PE=3 SV=1)

HSP 1 Score: 506.523 bits (1303), Expect = 5.478e-162
Identity = 279/718 (38.86%), Postives = 429/718 (59.75%), Query Frame = 2
Query:  602 WLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFEES---------YCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIA--------LEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXX-------XXXXXXNQLVL--LVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMILQLCSSV 2677
            W  ++  +    +Y+L++  G G+L++ Y  +G  A+ + +K E+  YL   G+G+ +S  +L +  + +Y +   D +  R     +   + + K T    F E          + S    FD   N K  VCW+  KRG+ GETLLHLC +  T  HR +A +L+ +FPN+A+D+FIG ++FGQ+ALH   +  DLEIVK+L+ +G D++QRA G FFQ                    I   + TN+        +Y+GEYPLSFA C G+ EIYD+L+  G +P+ +D  GN+VLHM+VIHN+T +YR AL+HYK+PADP  +N  GL PI+L+AKLGRR +F EII L+  E+W+YG + C +YPL  +DTI  +GHTDW S+ M+IING + +HLDMLD GV+RQLL EKW  +  KRF+Q L L + Y  I+ +A  LR  +  +++        +  +++ ++  RY  E + ++   +     I+E++EQG   F + L ++P +A ++++CFLI L +P R+  +F  +N       +     +EE  ++ A      YLLFF  G  L G FVT+I+KM+ GD+L FG IY ++   F QAF+FLF++I++++I +F+    ++MT+FQMT G+FK  +        +++  N  ++   VFA FMI +PI+LLNM+IAMM +TY  V +RSQKE I+M  ++   V
Sbjct:   19 WAEQSGLIASNPIYSLVDIYGGGRLVDCYEREGVAAVRQIIKEEVAPYLYKGGDGIEISGSDLIRKPVTKYEVPDEDPLKTRSAMVSTLAAQSVEKSTASQLFREQPRKNVPMRLFASAAAVFDN--NIKHLVCWDITKRGIYGETLLHLCLLHKTPAHRQLAIILVGMFPNLAKDFFIGWEYFGQSALHMATLNNDLEIVKILIQAGADIHQRAAGDFFQPD--------------DQRWIKKAKATNYQGH-----SYYGEYPLSFACCIGSPEIYDYLIVSGADPSNRDQLGNSVLHMLVIHNQTEVYRLALRHYKRPADPTAVNHAGLNPISLAAKLGRRRVFNEIIGLSATEMWRYGDIACKLYPLTGVDTIGPNGHTDWDSAFMHIINGQTSEHLDMLDEGVIRQLLYEKWNKYVRKRFLQRLALTIAYLSIMTLAVYLRPQENWNVSSNSTGIVRVSLQVNGQNVVRYICEIITVINSGLTIYFMINEIREQGFRAFTRSLSHAPPRAVYIVACFLITLVLPARLGVLFWSDN-------WQTMTLVEESLLILAIPCVWTYLLFFASGTNLYGTFVTLIYKMLSGDVLTFGIIYCVLSTCFGQAFYFLFRNIEQITIGSFQDVLTTVMTVFQMTHGEFKMSKGEFLIKYAEFSYTNYPLMSKCVFAIFMIIMPIMLLNMIIAMMNHTYSTVNARSQKESIAMWARIVGIV 708          
BLAST of Transient receptor potential cation channel subfamily V member vs. TrEMBL
Match: A0A267GDK8 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012503g2 PE=3 SV=1)

HSP 1 Score: 503.827 bits (1296), Expect = 5.659e-161
Identity = 279/718 (38.86%), Postives = 428/718 (59.61%), Query Frame = 2
Query:  602 WLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFEES---------YCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIA--------LEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXX-------XXXXXXNQLVL--LVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMILQLCSSV 2677
            W  ++  +    +Y+L++  G G L++ Y  +G  A+ + +K E+  YL   G+G+ +S  +L +  + +Y +   D +  R     +   + + K T    F E          + S    FD   N K  VCW+  KRG+ GETLLHLC +  T  HR +A +L+ +FPN+A+D+FIG ++FGQ+ALH   +  DLEIVK+L+ +G D++QRA G FFQ                    I   + TN+        +Y+GEYPLSFA C G+ EIYD+L+  G +P+ +D  GN+VLHM+VIHN+T +YR AL+HYK+PADP  +N  GL PI+L+AKLGRR +F EII L+  E+W+YG + C +YPL  +DTI  +GHTDW S+ M+IING + +HLDMLD GV+RQLL EKW  +  KRF+Q L L + Y  I+ +A  LR  +  +++        +  +++ ++  RY  E + ++   +     I+E++EQG   F + L ++P +A ++++CFLI L +P R+  +F  +N       +     +EE  ++ A      YLLFF  G  L G FVT+I+KM+ GD+L FG IY ++   F QAF+FLF++I++++I +F+    ++MT+FQMT G+FK  +        +++  N  ++   VFA FMI +PI+LLNM+IAMM +TY  V +RSQKE I+M  ++   V
Sbjct:   19 WAEQSGLIASNPIYSLVDIYGGGCLVDCYEREGVAAVRQIIKEEVAPYLYKGGDGIEISGSDLIRKPVTKYEVPDEDPLKTRSAMVSTLAAQSVEKSTASQLFREQPRKNVPMRLFASAAAVFDN--NIKHLVCWDITKRGIYGETLLHLCLLHKTPAHRQLAIILVGMFPNLAKDFFIGWEYFGQSALHMATLNNDLEIVKILIQAGADIHQRAAGDFFQPD--------------DQRWIKKAKATNYQGH-----SYYGEYPLSFACCIGSPEIYDYLIVSGADPSNRDQLGNSVLHMLVIHNQTEVYRLALRHYKRPADPTAVNHAGLNPISLAAKLGRRRVFNEIIGLSATEMWRYGDIACKLYPLTGVDTIGPNGHTDWDSAFMHIINGQTSEHLDMLDEGVIRQLLYEKWNKYVRKRFLQRLALTIAYLSIMTLAVYLRPQENWNVSSNSTGIVRVSLQVNGQNVVRYICEIITVINSGLTIYFMINEIREQGFRAFTRSLSHAPPRAVYIVACFLITLVLPARLGVLFWSDN-------WQTMTLVEESLLILAIPCVWTYLLFFASGTNLYGTFVTLIYKMLSGDVLTFGIIYCVLSTCFGQAFYFLFRNIEQITIGSFQDVLTTVMTVFQMTHGEFKMSKGEFLIKYAEFSYTNYPLMSKCVFAIFMIIMPIMLLNMIIAMMNHTYSTVNARSQKESIAMWARIVGIV 708          
BLAST of Transient receptor potential cation channel subfamily V member vs. TrEMBL
Match: A0A267EZD3 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000062g1 PE=3 SV=1)

HSP 1 Score: 487.649 bits (1254), Expect = 4.020e-154
Identity = 279/609 (45.81%), Postives = 387/609 (63.55%), Query Frame = 2
Query:  920 YCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK-------------EESIALEPKMSF----------------KHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDK--LSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM 2653
            Y  + P + +  N +  VCW+  +RG+ GETLLHLC +  +  HR +AK LL +FPN+A D+FIG ++FG ++LH  ++  DLE+VKLLV  G  ++QRA+G FF+ +  +               +N    T++        +Y GEYPL+FA C G+ EIYDFLL  G  P+ +D  GN+VLHM+VIHN T IYR A+KH+KKPA+P + N  GL PI+L+AKLGR+ +F EIIDL++ E+W++ ++ C VYPL  +DTI  SG TDW+S+ MYIINGT+D HLDML+ G++ QLL EKW+ +   RF+Q LL++  + +I+  A  LR  K              ++ +L   +S+                +  FRY  E + +V  LV   +HI E++EQG++DF++GL ++P K  FL++C LI L +P+RI  +      TSN +  T     EE  ++ A+     YLLFF GG +L G FVTMI+KMIKGD+ RFG IY I+L  F Q ++FLF+DID    S+ +F   H ++MTL QMT G FKY+EF YT Y  L   VFA+F+I VPILLLNMLIAMMGNTY +V SRSQKEWI+M
Sbjct:   93 YDCVRPVYPD--NSRHRVCWDIEQRGMYGETLLHLCLVCDSPLHRQLAKALLSVFPNLAVDFFIGWEYFGHSSLHMAVMNKDLELVKLLVKCGAVIDQRAVGDFFRPEDQRQ--------------VNKAAITDYRGQ-----SYLGEYPLAFACCVGSAEIYDFLLSCGAHPDSKDQFGNSVLHMLVIHNNTEIYRLAVKHHKKPANPKLTNSAGLNPISLAAKLGRKDVFNEIIDLSSSEMWRFANITCKVYPLTGVDTIGQSGRTDWNSAFMYIINGTTDQHLDMLEQGLINQLLYEKWQKYARARFLQRLLMLTIHIIIMSAAIYLRPLKSSSDTSATSSSLESDNSSLTTTVSYVASTTTAAAAAVTISTQEVFRYVFECITVVNSLVTLFMHIDEVREQGVLDFLRGLGDAPPKTSFLIACLLISLALPVRIMSLL----WTSNLETLTNA---EETLLIIAAPCVWIYLLFFAGGTQLNGTFVTMIYKMIKGDMARFGIIYSIILVCFAQTYYFLFRDIDPNVSSVLSFSQPHTTVMTLLQMTLGDFKYDEFNYTNYTPLAKFVFAAFLILVPILLLNMLIAMMGNTYNLVNSRSQKEWIAM 673          
BLAST of Transient receptor potential cation channel subfamily V member vs. TrEMBL
Match: A0A267H584 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006500g2 PE=3 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 2.977e-152
Identity = 279/609 (45.81%), Postives = 384/609 (63.05%), Query Frame = 2
Query:  920 YCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK-----------------------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDK--LSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM 2653
            Y  + P + +  N +  VCW+  +RG+ GETLLHLC +  +  HR +AK LL +FPN+A D+FIG ++FG ++LH  ++  DLE+VKLLV  G  ++QRA+G FF+ +  +               +N    T++        +Y GEYPL+FA C G+ EIYDFLL  G  P+ +D  GN+VLHM+VIHN T IYR A+KH+KKPA+P + N  GL PI+L+AKLGR+ +F EIIDL++ E+W++ ++ C VYPL  +DTI  SG TDW+S+ MYIINGT+D HLDML+ G++ QLL EKW+ +   RF+Q LL++  + +I+  A  LR  K                               + A    +S +  FRY  E + +V  LV   +HI E++EQG++DF++GL ++P K  FL++C LI L +P+RI  +      TSN +  T     EE  ++ A+     YLLFF GG +L G FVTMI+KMIKGD+ RFG IY I+L  F Q ++FLF+DID    S+ +F   H ++MTL QMT G FKY+EF YT Y  L   VFA+F+I VPILLLNMLIAMMGNTY +V SRSQKEWI+M
Sbjct:  271 YDCVRPVYPD--NSRHRVCWDIEQRGMYGETLLHLCLVCDSPLHRQLAKALLSVFPNLAVDFFIGWEYFGHSSLHMAVMNKDLELVKLLVKCGAVIDQRAVGDFFRPEDQRQ--------------VNKAAITDYRGQ-----SYLGEYPLAFACCVGSAEIYDFLLSCGAHPDSKDQFGNSVLHMLVIHNNTEIYRLAVKHHKKPANPKLTNSAGLNPISLAAKLGRKDVFNEIIDLSSSEMWRFANITCKVYPLTGVDTIGQSGRTDWNSAFMYIINGTTDQHLDMLEQGLINQLLYEKWQKYARARFLQRLLMLTIHIIIMSAAIYLRPLKSSSDTSATSSSLESDNSSLTTTASSVASTTTAAAAAVTISTQEVFRYVFECITVVNSLVTLFMHIDEVREQGVLDFLRGLGDAPPKTSFLIACLLISLALPVRIMSLL----WTSNLETLTNA---EETLLIIAAPCVWIYLLFFAGGTQLNGTFVTMIYKMIKGDMARFGIIYSIILVCFAQTYYFLFRDIDPNVSSVLSFSQPHTTVMTLLQMTLGDFKYDEFNYTNYTPLAKFVFAAFLILVPILLLNMLIAMMGNTYNLVNSRSQKEWIAM 851          
BLAST of Transient receptor potential cation channel subfamily V member vs. TrEMBL
Match: A0A267H5B1 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006500g1 PE=3 SV=1)

HSP 1 Score: 487.649 bits (1254), Expect = 3.272e-152
Identity = 279/609 (45.81%), Postives = 384/609 (63.05%), Query Frame = 2
Query:  920 YCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETK-----------------------------EESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDK--LSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM 2653
            Y  + P + +  N +  VCW+  +RG+ GETLLHLC +  +  HR +AK LL +FPN+A D+FIG ++FG ++LH  ++  DLE+VKLLV  G  ++QRA+G FF+ +  +               +N    T++        +Y GEYPL+FA C G+ EIYDFLL  G  P+ +D  GN+VLHM+VIHN T IYR A+KH+KKPA+P + N  GL PI+L+AKLGR+ +F EIIDL++ E+W++ ++ C VYPL  +DTI  SG TDW+S+ MYIINGT+D HLDML+ G++ QLL EKW+ +   RF+Q LL++  + +I+  A  LR  K                               + A    +S +  FRY  E + +V  LV   +HI E++EQG++DF++GL ++P K  FL++C LI L +P+RI  +      TSN +  T     EE  ++ A+     YLLFF GG +L G FVTMI+KMIKGD+ RFG IY I+L  F Q ++FLF+DID    S+ +F   H ++MTL QMT G FKY+EF YT Y  L   VFA+F+I VPILLLNMLIAMMGNTY +V SRSQKEWI+M
Sbjct:  271 YDCVRPVYPD--NSRHRVCWDIEQRGMYGETLLHLCLVCDSPLHRQLAKALLSVFPNLAVDFFIGWEYFGHSSLHMAVMNKDLELVKLLVKCGAVIDQRAVGDFFRPEDQRQ--------------VNKAAITDYRGQ-----SYLGEYPLAFACCVGSAEIYDFLLSCGAHPDSKDQFGNSVLHMLVIHNNTEIYRLAVKHHKKPANPKLTNSAGLNPISLAAKLGRKDVFNEIIDLSSSEMWRFANITCKVYPLTGVDTIGQSGRTDWNSAFMYIINGTTDQHLDMLEQGLINQLLYEKWQKYARARFLQRLLMLTIHIIIMSAAIYLRPLKSSSDTSATSSSLESDNSSLTTTASSVASTTTAAAAAVTISTQEVFRYVFECITVVNSLVTLFMHIDEVREQGVLDFLRGLGDAPPKTSFLIACLLISLALPVRIMSLL----WTSNLETLTNA---EETLLIIAAPCVWIYLLFFAGGTQLNGTFVTMIYKMIKGDMARFGIIYSIILVCFAQTYYFLFRDIDPNVSSVLSFSQPHTTVMTLLQMTLGDFKYDEFNYTNYTPLAKFVFAAFLILVPILLLNMLIAMMGNTYNLVNSRSQKEWIAM 851          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Cavefish
Match: trpv6 (transient receptor potential cation channel subfamily V member 6-like [Source:NCBI gene;Acc:103028240])

HSP 1 Score: 124.405 bits (311), Expect = 9.467e-29
Identity = 148/584 (25.34%), Postives = 251/584 (42.98%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVN-QRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRT----AIYRFALKHYKK--PADP--NVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKE----------------ESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMD-FIKGLLNSPLKACFLM-SCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  M  +      A  L++  P +  +   G+ + G TALH  +I  +  +V+ L+  G DV+  RA G +F+ +                                G L Y+GE+ L+FA+C GN  I   L+  G     QD  GNT+LH++V+         I+   L + +K  P  P   + N  GLTP  L+AK G    F  +++      W  G +   +Y L ++D+      TD  S L  I+     +   +L    V++L+  KW ++G   F  LLL+ L Y     +    R  K+                +    E  +++    R   E + +V  L++  L I ++   G    F +  L  P  A  +  +  ++ LCI LR T++                   E + +    +L    +L+F  GF++ GP+V +I K++ GDL +F  + +I L  F+ A +  +   D LSI ++++F  +  T F++T G            + +V +V   F +   +LLL++L AMM +T   V     + W + I+
Sbjct:   94 ERGALGETALHVAVMHDSYE---AAVALMEGAPELINEPMTGELYEGLTALHIAVINQNSNLVQELIERGADVSTPRATGMYFRKR-------------------------------RGGLFYYGEHILAFASCIGNTPIISMLISAGANIRAQDSLGNTILHILVMQPNKIISCQIFDLLLTNDEKTDPTIPLDKIPNYRGLTPFKLAAKKGNVVAFQHMVNSRRIVQWNLGCLTSYLYDLTEIDS-----RTDDMSVLELIVCSQKREARSILQVTPVQELITLKWNLYGKYYFRLLLLVYLLYIGTFTLCCMHRPLKDIPENYTKSEIDQTVKIQKTVKESYVTYADHLRLVGEIISVVGALIILLLEIPDILRVGAKRYFGQSALGGPFHATLITYAVMVVFLCI-LRTTEMPG-----------------ETVLMALCLVLGWCNVLYFARGFEMLGPYVIVIQKILFGDLTKFMWLSLIALVGFSTALWTWYMTQDHLSIPSYRSFPITFFTEFELTIGLIDLPVDHTIYTHPVVHVVHCCFSVVSHLLLLSLLTAMMSDTQWRVRQERDELWRTQIV 620          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Cavefish
Match: trpv6 (transient receptor potential cation channel subfamily V member 6-like [Source:NCBI gene;Acc:103028240])

HSP 1 Score: 124.02 bits (310), Expect = 1.039e-28
Identity = 148/584 (25.34%), Postives = 251/584 (42.98%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVN-QRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRT----AIYRFALKHYKK--PADP--NVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKE----------------ESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMD-FIKGLLNSPLKACFLM-SCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+  M  +      A  L++  P +  +   G+ + G TALH  +I  +  +V+ L+  G DV+  RA G +F+ +                                G L Y+GE+ L+FA+C GN  I   L+  G     QD  GNT+LH++V+         I+   L + +K  P  P   + N  GLTP  L+AK G    F  +++      W  G +   +Y L ++D+      TD  S L  I+     +   +L    V++L+  KW ++G   F  LLL+ L Y     +    R  K+                +    E  +++    R   E + +V  L++  L I ++   G    F +  L  P  A  +  +  ++ LCI LR T++                   E + +    +L    +L+F  GF++ GP+V +I K++ GDL +F  + +I L  F+ A +  +   D LSI ++++F  +  T F++T G            + +V +V   F +   +LLL++L AMM +T   V     + W + I+
Sbjct:   75 ERGALGETALHVAVMHDSYE---AAVALMEGAPELINEPMTGELYEGLTALHIAVINQNSNLVQELIERGADVSTPRATGMYFRKR-------------------------------RGGLFYYGEHILAFASCIGNTPIISMLISAGANIRAQDSLGNTILHILVMQPNKIISCQIFDLLLTNDEKTDPTIPLDKIPNYRGLTPFKLAAKKGNVVAFQHMVNSRRIVQWNLGCLTSYLYDLTEIDS-----RTDDMSVLELIVCSQKREARSILQVTPVQELITLKWNLYGKYYFRLLLLVYLLYIGTFTLCCMHRPLKDIPENYTKSEIDQTVKIQKTVKESYVTYADHLRLVGEIISVVGALIILLLEIPDILRVGAKRYFGQSALGGPFHATLITYAVMVVFLCI-LRTTEMPG-----------------ETVLMALCLVLGWCNVLYFARGFEMLGPYVIVIQKILFGDLTKFMWLSLIALVGFSTALWTWYMTQDHLSIPSYRSFPITFFTEFELTIGLIDLPVDHTIYTHPVVHVVHCCFSVVSHLLLLSLLTAMMSDTQWRVRQERDELWRTQIV 601          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Cavefish
Match: trpv4 (transient receptor potential cation channel, subfamily V, member 4 [Source:ZFIN;Acc:ZDB-GENE-030912-7])

HSP 1 Score: 91.6633 bits (226), Expect = 1.800e-18
Identity = 81/270 (30.00%), Postives = 113/270 (41.85%), Query Frame = 2
Query: 1121 FFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHG---TEPNVQDCNGNTVLHMVV--IHNRTAIYRFALKHYK----KPAD-------PNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQ-----------ELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            + GQTALH  I +   +  +LLV  G DV+ +A G FFQ +                               EG   YFGE PLS AACT   ++  +L E+     +   QD  GNTVLH +V    N     RF  K Y     K A          V+N  G++P+ ++AKLG+  +F  II    Q           + W YG +  S+Y L  LDT       D S   + + N   ++  +ML    + +LL  KW+ F    F
Sbjct:  202 YRGQTALHIAIERRCKQYAELLVEKGADVHAQARGRFFQPR------------------------------DEGGYFYFGELPLSLAACTNQPDMVHYLTENSHKKADMRRQDSRGNTVLHALVHIADNTRDNTRFLTKMYDLLLIKCARLYPECNLEQVLNNDGMSPLMMAAKLGKIGVFQHIIRREVQVEEARHLCRKFKDWAYGPVYSSLYDLSSLDTCGE----DVSVLEILVYNSRIENRHEMLAVEPINELLRAKWQKFAAVTF 437          

HSP 2 Score: 60.8474 bits (146), Expect = 4.994e-9
Identity = 52/168 (30.95%), Postives = 81/168 (48.21%), Query Frame = 2
Query: 2225 VMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLF----KDIDKLSITTFK---------TFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVF-ASFMIFVPILLLNMLIAMMGNTYQMVISRSQK----EWISMILQLCSS 2674
            ++FA +L     L+FT G KLTG +  MI K++  DL RF  +YV+ +  +  A   L      +    S+T            TF   L+ LF++T G    ++        +V L+   +++I   +LLLNMLIA+MG T   V   S+K    +W + IL +  S
Sbjct:  535 MVFALVLGWMNTLYFTRGLKLTGTYSIMIQKILFKDLFRFLLVYVLFMIGYASALVSLLTVCPANSTDCSVTPCPTVPHCRDTVTFSLFLLDLFKLTIGTGDLDDLVQGAQYPVVFLILVVTYIILTFVLLLNMLIALMGETVSQVSKESKKIWKLQWATTILDIERS 702          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Cavefish
Match: trpv1 (transient receptor potential cation channel, subfamily V, member 1 [Source:ZFIN;Acc:ZDB-GENE-030912-8])

HSP 1 Score: 86.6557 bits (213), Expect = 6.254e-17
Identity = 76/270 (28.15%), Postives = 112/270 (41.48%), Query Frame = 2
Query: 1127 GQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEH---GTEPNVQDCNGNTVLH--MVVIHNRTAIYRFALKHY------------KKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQE-----------LWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTS-DDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            GQT LH  I +       LL+  G +V+ +A G FFQ       + F                            YFGE PLS AACT  +EI D L+++     +   +D  GNTVLH  + V  N      F +  Y            K+    ++ N  GLT I L+AK G+  +F  I+    Q+            W YG +  S+Y L  +DT +       +S L  ++ GT   + L+ML    + +LL +KW  F ++ F
Sbjct:  136 GQTPLHVAIERRSKHFADLLIQKGANVHAKACGSFFQPH---GETCF----------------------------YFGELPLSLAACTNQKEIVDLLMDNPVSKADVREKDSQGNTVLHALVAVADNSPENTDFVICMYDYILTKDAHMNPKRQKLEDIQNNQGLTTIKLAAKTGKIGLFEHILHREFQQEECRHLSRKFTEWAYGPIYSSLYDLASVDTYEK------NSVLEIVVYGTEIPNRLEMLQVEPLNKLLEDKWNRFAHRIF 368          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Cavefish
Match: trpv1 (transient receptor potential cation channel, subfamily V, member 1 [Source:ZFIN;Acc:ZDB-GENE-030912-8])

HSP 1 Score: 86.2705 bits (212), Expect = 7.097e-17
Identity = 76/270 (28.15%), Postives = 112/270 (41.48%), Query Frame = 2
Query: 1127 GQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEH---GTEPNVQDCNGNTVLH--MVVIHNRTAIYRFALKHY------------KKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQE-----------LWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTS-DDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            GQT LH  I +       LL+  G +V+ +A G FFQ       + F                            YFGE PLS AACT  +EI D L+++     +   +D  GNTVLH  + V  N      F +  Y            K+    ++ N  GLT I L+AK G+  +F  I+    Q+            W YG +  S+Y L  +DT +       +S L  ++ GT   + L+ML    + +LL +KW  F ++ F
Sbjct:  130 GQTPLHVAIERRSKHFADLLIQKGANVHAKACGSFFQPH---GETCF----------------------------YFGELPLSLAACTNQKEIVDLLMDNPVSKADVREKDSQGNTVLHALVAVADNSPENTDFVICMYDYILTKDAHMNPKRQKLEDIQNNQGLTTIKLAAKTGKIGLFEHILHREFQQEECRHLSRKFTEWAYGPIYSSLYDLASVDTYEK------NSVLEIVVYGTEIPNRLEMLQVEPLNKLLEDKWNRFAHRIF 362          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001427.1 (pep scaffold:Pmarinus_7.0:GL477062:131466:156724:-1 gene:ENSPMAG00000001293.1 transcript:ENSPMAT00000001427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 8.190e-29
Identity = 87/298 (29.19%), Postives = 132/298 (44.30%), Query Frame = 2
Query:  980 NHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQ-RALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPN-------VINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            N   RG  GET LH   M +    +  A ML+   P +       D + GQTALH  ++  D+++V+ L+  G D++  RA G  F S                                +G   Y+GE+ LSFA CTGN EI   L+++G     QD  GN+VLH++V H+   + R       +   P+       + N  G TP+ L+  LG   +F  +++   +  W  G++  +VY L ++DT       D  S L  I + +      M+D   V+ LLN KW  FG+  F
Sbjct:   31 NPLARGELGETALH---MALLCDSQDAAMMLIHRIPPLLNQPITSDMYQGQTALHIAVMNQDVQMVRELLSCGADLHSPRATGSCFTS-------------------------------ADGSSCYYGEFVLSFAVCTGNGEIVRLLVKNGATLKAQDSLGNSVLHVLVQHHDAEMVRSMYDLLSELVQPDEWCQIESLANSEGYTPLKLAVALGDDAMFSYLVERRKKVYWTMGTISYTVYDLREIDT-----WGDQRSVLDIITSSSKKKVQSMIDLRPVKDLLNHKWNSFGFNYF 289          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007740.1 (pep scaffold:Pmarinus_7.0:GL478934:8361:25408:-1 gene:ENSPMAG00000007001.1 transcript:ENSPMAT00000007740.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 1.342e-27
Identity = 84/289 (29.07%), Postives = 132/289 (45.67%), Query Frame = 2
Query: 1004 GETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAI------YRFALKHYKKPADPNVI-NKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            GETLLH+    +   HR +A  LL   P I       + + G+TA+H  I   ++ +VK L++ G D+  RA G FF    L                                  Y+GEY LSFAACTGN+ I   L++HG     QD  GNTVLH++V+H    +      +  +L H  +      I N  G +P+ L+A  G   +F  ++       W  G +  ++Y L  +DT       D +S L  I +  + +  +++    +++LL+ KW+V+G+K F
Sbjct:    1 GETLLHVA---LLFRHRTLALRLLDAVPAIINIPMTCELYRGETAIHIAIANENVVMVKELLHRGADITARACGSFF----LPGKRCQC---------------------------YYGEYTLSFAACTGNEMIVKLLMDHGASLITQDSLGNTVLHVLVLHPDRVLAVHMYDFLISLVHEGQRRSLEAIRNAQGFSPLKLAAAEGNLAMFNHLMQKRKNIYWNCGPVRSAIYDLTDIDTWG-----DKNSILEIITSSKNKEARNLIGMTPIKELLHHKWKVYGFKYF 250          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Sea Lamprey
Match: trpv6 (transient receptor potential cation channel, subfamily V, member 6 [Source:ZFIN;Acc:ZDB-GENE-040624-12])

HSP 1 Score: 83.1889 bits (204), Expect = 6.219e-17
Identity = 55/173 (31.79%), Postives = 90/173 (52.02%), Query Frame = 2
Query: 1352 YFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH----NRTAIYRFAL---KHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            + GE+ L+FAACTGN++I   LLE+    + QD  GNTVLH++V+        A+++  L   +     A   V N  GLTPI ++A  G   +F  ++       W +GS+  S+Y L  +D+ D     D  S +  I +    +   +LD   V++L++ KW ++G + F
Sbjct:    2 FAGEHVLTFAACTGNEDIMRILLENHVPVHAQDSLGNTVLHVLVLQPNKNQACAMHQLLLSCDRSGAAAALEAVQNHDGLTPIKMAAANGNTVMFQNLVTRRRAVQWVFGSVTSSIYDLSGIDSWD-----DEQSVIELIASSRRREARRILDITPVKELVSLKWSLYGRRYF 169          

HSP 2 Score: 80.4925 bits (197), Expect = 4.234e-16
Identity = 46/128 (35.94%), Postives = 71/128 (55.47%), Query Frame = 2
Query: 2261 LFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEW 2644
            +FF  GF++ GPF  MI KM+ GDLLRF  + ++VL  +  AF   F+ + +     F  F   L T+FQ+  G          +   ++ LV+ S+MIF  +L++N+LIAMMG+T+  V     + W
Sbjct:  313 MFFARGFEMLGPFTIMIQKMLFGDLLRFCWLMLMVLLGYASAFHICFQLLRREDFLHFAGFETVLFTMFQLFLGLLDIPIPYDKQVPIIIKLVYVSYMIFAFLLMVNLLIAMMGDTHWRVAHERDELW 440          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 2.515e-7
Identity = 41/168 (24.40%), Postives = 73/168 (43.45%), Query Frame = 2
Query: 1127 GQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIID 1630
            G+TALH        E+V+ L+ +G  V+ +A        +        I Q    LL+ +  + +   S        G  PL  AA  G++++   LLEHG    V    G T LH+   + +  +    L+ +   A P+   K GLTP+ +++    + + + ++D
Sbjct:  171 GETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQ----LLLQHMASPDAATS-------NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRF---ASPDAAGKNGLTPLHVASHYDNQKVALLLLD 324          

HSP 2 Score: 52.7582 bits (125), Expect = 3.652e-7
Identity = 51/204 (25.00%), Postives = 85/204 (41.67%), Query Frame = 2
Query: 1133 TALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLM 1744
            TALH           K+L+  G + N RAL  F    +    +   + +    LL+       +  S+E  +   G  P+  +A  GN  I   LL+ G  PN  +  G T LHM     +T + R  L++    A  +   +   TP+ ++A+LG+    +EI+ L  Q +    +   + Y    L      GH D ++ L+
Sbjct:   74 TALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVME----LLLK------YGASIEA-VTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNG---AQVDAKAREEQTPLHIAARLGK----LEIVQLLLQHMASPDAATSNGY--TPLHVAAREGHEDVTAILL 257          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 3.525e-7
Identity = 41/168 (24.40%), Postives = 73/168 (43.45%), Query Frame = 2
Query: 1127 GQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIID 1630
            G+TALH        E+V+ L+ +G  V+ +A        +        I Q    LL+ +  + +   S        G  PL  AA  G++++   LLEHG    V    G T LH+   + +  +    L+ +   A P+   K GLTP+ +++    + + + ++D
Sbjct:   81 GETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQ----LLLQHMASPDAATS-------NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRF---ASPDAAGKNGLTPLHVASHYDNQKVALLLLD 234          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Nematostella
Match: EDO37108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGQ7])

HSP 1 Score: 258.07 bits (658), Expect = 3.114e-74
Identity = 191/584 (32.71%), Postives = 294/584 (50.34%), Query Frame = 2
Query:  995 GVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKW----RVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIALEPKMSFK-----------------HKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDI--DKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQ----LVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMILQL 2665
            G  GE +LH C +  T TH  +  +L+K +P I  D +  D+++G+  LH  I+  DL +V  L  +G+D++QRA G FF     KS+      Q    +L   T   + +++      Y+GEYPLSFAAC G ++   +LL     PN QD NGNTVLHM+VIH++    + ++K  K     ++ N+ G TP+TL+AKL R  +F  I+  + +  W+YG++  + +PL +LDTI   G     S++  II+  S +HL++LD G+V  +L EKW    R      F  LL + + Y LI  VA  +R +       +P  + K                  KFR  LE +  +  +    L   E+  QG+     GL+ +P++  F +SC LI  C+  R                +   + +E+   + A +L   Y L F  GF+LTGP+V MI++M+K D + F  IY I +  F+QA F        D +    F  +  S + L  M+ G+F     +  + +     + L VF  FM+   +L++NMLIAMMGNTYQ V S ++KEW     Q+
Sbjct:  117 GAVGENILHTCFLNATRTHFDLGMLLIKAYPKIINDIYTSDEYYGENCLHMAIVNGDLALVHFLCKNGIDIHQRACGAFFCPDDQKSSREDCETQE-SVVLCTETNYQSLSNT------YWGEYPLSFAACLGQEDTVKYLLHRRACPNKQDSNGNTVLHMMVIHDQ----KVSVKSVKYVLTLHIRNRQGFTPLTLAAKLARNEMFHHILTKSREVFWEYGNVTAAAFPLWELDTIGDQGQVIERSAINIIIHEDSHEHLELLD-GIVLNILTEKWKHGCRFRWGAMFFLLLCIYMMYLLIFSVALGIRPS-------DPSCAGKFVNVTTNITNSTGNWSYSKFRAVLEVLATIWAISYLVLIAVEMCHQGVRTVFWGLVYNPIRGLFAVSCALIPCCLATR----------------FACLQKVEDPLTVVALVLAWPYSLMFCKGFQLTGPYVVMIYQMLKRDFIIFFIIYGIFVIGFSQAMFLAVSGYLDDSVDEHMFARWFSSGLVLIIMSLGEFGDPLVQLVESDSPYKIIGLFVFFIFMVLGALLIVNMLIAMMGNTYQSV-SETKKEWTRQWAQI 664          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Medaka
Match: trpv6 (transient receptor potential cation channel subfamily V member 5 [Source:NCBI gene;Acc:101169560])

HSP 1 Score: 147.132 bits (370), Expect = 4.885e-36
Identity = 147/578 (25.43%), Postives = 252/578 (43.60%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDV-NQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT--------AIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEES--------IALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMD-FIKGLLNSPLKACFL-MSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASL-LNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            +RG  GET LH+    +   +   A  L+   P +  +    + F G T LH  ++  ++ +V+ L+  G DV   R  G +F+ ++                               G L Y+GE+ LSFAAC GN++I   L++ G    VQD  GNTVLH++V+  N+T         + R A      P D  V N  GLTP  L+AK G   +F  +++      W  G +   +Y L ++D+       D +S L  I+     +   +L+   VRQL++ KW ++G   F  L +++    L+         TK +S           E  +++    R   E + ++  +++  L I ++   G    F +  L  P     +  +  ++LLC                   V+  C    E  VM   L L    ++FF  GF++ GP+V MI K+I GDL +F  + +IVL  F+ + + ++   D  S+  +++F  +L + F+++ G          K   +V +V  +F      LL+N+LIAM+ +T   V     + W + ++
Sbjct:   75 ERGALGETALHVA---VINDNLDAAVALMDGAPELINEPMTSELFQGVTPLHIAVVNRNINLVQHLISRGGDVCTPRVTGLYFRKRI-------------------------------GGLIYYGEHALSFAACVGNEDIVSMLIDAGASTRVQDSRGNTVLHLLVLQPNKTIACQTMDLIMARDAELDQPVPLD-MVTNYRGLTPFKLAAKEGNTVVFQHLVNKRRVIQWSLGPLSSHLYDLTEIDS-----RADNTSVLELIVASPRREARGVLEVTPVRQLVSLKWNLYGKHYFRYLFVMLFHLILLFFCDIPENYTKSDSDYTIKIQKTLKESYVTYSDSLRLVGEVISVLGAVLILFLEIPDMIRVGAKRYFGQTALGGPFHVILISYASLVVLLC-------------------VFRLCEVQGEAEVMALCLVLGWCNVMFFARGFEMLGPYVIMIQKIIFGDLTKFMWLSLIVLIGFSTSLWMVYMTQDPSSLPMYRSFPITLFSEFELSLGMIDLPVDHTLKTPSIVHVVHVAFTFVCSTLLINLLIAMISDTIWRVGQERDELWRTQVV 593          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Medaka
Match: trpv6 (transient receptor potential cation channel subfamily V member 5 [Source:NCBI gene;Acc:101169560])

HSP 1 Score: 107.457 bits (267), Expect = 2.036e-23
Identity = 84/297 (28.28%), Postives = 133/297 (44.78%), Query Frame = 2
Query:  989 KRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDV-NQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIH-NRT--------AIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            +RG  GET LH+    +   +   A  L+   P +  +    + F G T LH  ++  ++ +V+ L+  G DV   R  G +F+ ++                               G L Y+GE+ LSFAAC GN++I   L++ G    VQD  GNTVLH++V+  N+T         + R A      P D  V N  GLTP  L+AK G   +F  +++      W  G +   +Y L ++D+       D +S L  I+     +   +L+   VRQL++ KW ++G   F
Sbjct:   75 ERGALGETALHVA---VINDNLDAAVALMDGAPELINEPMTSELFQGVTPLHIAVVNRNINLVQHLISRGGDVCTPRVTGLYFRKRI-------------------------------GGLIYYGEHALSFAACVGNEDIVSMLIDAGASTRVQDSRGNTVLHLLVLQPNKTIACQTMDLIMARDAELDQPVPLD-MVTNYRGLTPFKLAAKEGNTVVFQHLVNKRRVIQWSLGPLSSHLYDLTEIDS-----RADNTSVLELIVASPRREARGVLEVTPVRQLVSLKWNLYGKHYF 331          

HSP 2 Score: 68.5514 bits (166), Expect = 2.195e-11
Identity = 46/158 (29.11%), Postives = 81/158 (51.27%), Query Frame = 2
Query: 2189 VYTYCRFIEEMFVMFASL-LNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISMIL 2659
            V+  C    E  VM   L L    ++FF  GF++ GP+V MI K+I GDL +F  + +IVL  F+ + + ++   D  S+  +++F  +L + F+++ G          K   +V +V  +F      LL+N+LIAM+ +T   V     + W + ++
Sbjct:  463 VFRLCEVQGEAEVMALCLVLGWCNVMFFARGFEMLGPYVIMIQKIIFGDLTKFMWLSLIVLIGFSTSLWMVYMTQDPSSLPMYRSFPITLFSEFELSLGMIDLPVDHTLKTPSIVHVVHVAFTFVCSTLLINLLIAMISDTIWRVGQERDELWRTQVV 620          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Medaka
Match: trpv1 (transient receptor potential cation channel subfamily V member 1 [Source:NCBI gene;Acc:101170293])

HSP 1 Score: 97.8265 bits (242), Expect = 1.973e-20
Identity = 78/268 (29.10%), Postives = 118/268 (44.03%), Query Frame = 2
Query: 1127 GQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLE---HGTEPNVQDCNGNTVLHMVV---------------IHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQEL-----------WKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSD--DHLDMLDGGVVRQLLNEKWRVFG 1837
            GQTALH  I +  L  V+LLV S  DV+ +  G FFQ                                 +G   YFGE PLS AACT   E+ D+LL+      +P  +D +GNTVLH +V               +++R  I +   K + K    ++ N  GL+P+ ++AK G+  +F  I+     E            W YG + CS+Y L  +D+ +       ++SL+ I+   SD  +  +ML    + Q+L  KW+ F 
Sbjct:  168 GQTALHVAIERRSLPYVQLLVNSHADVHAKVSGKFFQPH-------------------------------DGPCFYFGELPLSLAACTNQPEMVDYLLKNEIQRADPEQRDSHGNTVLHALVAVADNSKENTEFINSMYDR--ILKITAKLHPKKKLEDIKNNKGLSPLLMAAKTGKIGVFSHILKREFHESDIKHLSRKFTEWVYGPVHCSLYDLASVDSCE-------NNSLLEILIYGSDIPNRHEMLQTEPLSQMLQAKWKKFA 395          

HSP 2 Score: 53.5286 bits (127), Expect = 1.110e-6
Identity = 45/161 (27.95%), Postives = 75/161 (46.58%), Query Frame = 2
Query: 2222 FVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQA--------------------FFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEW 2644
            F++    L+   +L+F+ G++  G +  MI K+I  D+LRF  +YV+ L  F+ A                    FF      +   I T+K F  +++ LF+ T G    E  +  +Y ++   +   ++I   ILLLNMLIA+M  T + +   S   W
Sbjct:  507 FLVLCLALSWVNVLYFSRGYQHMGIYSVMIQKIIVCDILRFLFVYVVFLFGFSAAVVTLLIVPPEKPRNATKGRSFFTTQAPGEDCFIPTYKNFSFTVLELFKFTIGMGDMEFSQAFQYTEIFYFLLIGYIILTYILLLNMLIALMNRTVENITKESTCIW 667          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Medaka
Match: ENSORLT00000027385.1 (transient receptor potential cation channel subfamily V member 1 [Source:NCBI gene;Acc:101166237])

HSP 1 Score: 91.2781 bits (225), Expect = 2.206e-18
Identity = 84/272 (30.88%), Postives = 123/272 (45.22%), Query Frame = 2
Query: 1121 FFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLN-YFGEYPLSFAACTGNQEIYDFLLEHG---TEPNVQDCNGNTVLH-MVVIHNRTA--------IYRFALKHYKKPADPNVI------NKYGLTPITLSAKLGR----RHIF-MEIIDLNTQELWK------YGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTS-DDHLDMLDGGVVRQLLNEKWRVFGYK 1843
            + GQTALH  I +  L++VKLLV  G DV  +A G FFQ+                                +G L  YFGE PLS AACT   +I  FL+E+     +   +D  GNTVLH ++ + + T+        IY   L  + K  + + I      N  GLTP+ L+AKL +    RH+   E +D  T+ L +      YG +  S+Y    +DT      ++ +S L  I+ G    +  +M+    +R LL +KW  F  K
Sbjct:  148 YKGQTALHVAIERRSLDLVKLLVQKGADVQAKASGTFFQN--------------------------------DGRLGFYFGELPLSLAACTNQPDIVSFLMENPYRRADLTDKDSQGNTVLHVLITVADDTSETTEMISKIYDQILVKHNKIGEKSQIQLEEIENNQGLTPLKLAAKLSKIGLFRHMLNREFMDEETRLLSRKFTECVYGPVHSSLYDTSSIDT------SECNSVLEIIVYGNEIPNRPEMIKLEPLRSLLQDKWERFASK 381          
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Medaka
Match: trpv4 (transient receptor potential cation channel subfamily V member 4 [Source:NCBI gene;Acc:101169862])

HSP 1 Score: 85.1149 bits (209), Expect = 2.095e-16
Identity = 79/270 (29.26%), Postives = 116/270 (42.96%), Query Frame = 2
Query: 1121 FFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHG---TEPNVQDCNGNTVLHMVV--IHNRTAIYRFALKHY--------KKPADPNV---INKYGLTPITLSAKLGRRHIFMEII--DLNTQEL---------WKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRF 1849
            + GQTALH  I +     V+LL+  G DV+ +A G FF+ +                               EG   YFGE PLS AACT    I ++L E+     +   QD  GNT LH +V    N     RF  K Y        K   + N+    N  GLTP+ ++AKLG+  +F  II  ++  +E+         W YG +  S+Y L  L+T       + S   + + N  +++  +ML    + +LL  KW+ F    F
Sbjct:  259 YRGQTALHIAIERRCKHYVELLMEKGADVHAQARGRFFEPK------------------------------DEGGYFYFGELPLSLAACTNQPNIVNYLTENPHKKADLRRQDSRGNTALHALVHIADNTKDNTRFLTKMYDLLLIKCTKLYPECNLEKMANNDGLTPLMMAAKLGKIGVFQHIIRREIKDEEVRHLSRKFKDWAYGPVYSSLYDLSSLETCGE----EPSVLEILVYNSRNENCHEMLAVEPINELLRAKWQKFAAVTF 494          

HSP 2 Score: 61.2326 bits (147), Expect = 4.057e-9
Identity = 50/163 (30.67%), Postives = 82/163 (50.31%), Query Frame = 2
Query: 2225 VMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLF-------KDIDKLSITTFK-----TFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQK----EWISMILQL 2665
            ++FA +L     L+FT G KLTG +  MI K++  D+ RF  +Y++ +  +  A   L         + +    T  K     TF   L+ LF++T G    E     +Y ++ L++  +++I   +LLLNMLIA+MG T   V   S+K    +W + IL +
Sbjct:  601 MVFALVLGWMNTLYFTRGLKLTGTYSIMIQKILLKDIFRFLLVYLLFMIGYASALVSLLTVCPTSGPECEGGCPTYPKCREPGTFSTFLLDLFKLTIGMGDLEMINSAQYPEVFLILLVTYIILTFVLLLNMLIALMGETVGQVSKESKKIWKLQWATTILDI 763          
BLAST of Transient receptor potential cation channel subfamily V member vs. Planmine SMEST
Match: SMESG000004138.1 (SMESG000004138.1)

HSP 1 Score: 1443.71 bits (3736), Expect = 0.000e+0
Identity = 750/750 (100.00%), Postives = 750/750 (100.00%), Query Frame = 2
Query:  404 MQSPMLNAYSYQNNFNCGMADVLGNSINSFNLSKYVINKGKGLPSVITCSDSESRTVSSVGEDDLIWLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM 2653
            MQSPMLNAYSYQNNFNCGMADVLGNSINSFNLSKYVINKGKGLPSVITCSDSESRTVSSVGEDDLIWLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFIQLLLLMLFYCLIILVATTLRETKEESIALEPKMSFKHKFRYCLESVGIVLVLVLCGLHIHELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMTFGKFKYEEFKYTKYNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM
Sbjct:    1 MQSPMLNAYSYQNNFNCGMADVLGNSINSFNLSKYVINKGKGLPSVITCSDSESRTVSSVGEDDLIWLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFIQLLLLMLFYCLIILVATTLRETKEESIALEPKMSFKHKFRYCLESVGIVLVLVLCGLHIHELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMTFGKFKYEEFKYTKYNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM 750          
BLAST of Transient receptor potential cation channel subfamily V member vs. Planmine SMEST
Match: SMESG000004138.1 (SMESG000004138.1)

HSP 1 Score: 1434.47 bits (3712), Expect = 0.000e+0
Identity = 746/746 (100.00%), Postives = 746/746 (100.00%), Query Frame = 2
Query:  416 MLNAYSYQNNFNCGMADVLGNSINSFNLSKYVINKGKGLPSVITCSDSESRTVSSVGEDDLIWLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM 2653
            MLNAYSYQNNFNCGMADVLGNSINSFNLSKYVINKGKGLPSVITCSDSESRTVSSVGEDDLIWLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFIQLLLLMLFYCLIILVATTLRETKEESIALEPKMSFKHKFRYCLESVGIVLVLVLCGLHIHELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMTFGKFKYEEFKYTKYNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM
Sbjct:    1 MLNAYSYQNNFNCGMADVLGNSINSFNLSKYVINKGKGLPSVITCSDSESRTVSSVGEDDLIWLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFIQLLLLMLFYCLIILVATTLRETKEESIALEPKMSFKHKFRYCLESVGIVLVLVLCGLHIHELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMTFGKFKYEEFKYTKYNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM 746          
BLAST of Transient receptor potential cation channel subfamily V member vs. Planmine SMEST
Match: SMESG000004138.1 (SMESG000004138.1)

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 393/393 (100.00%), Postives = 393/393 (100.00%), Query Frame = 2
Query: 1475 MVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM 2653
            MVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFIQLLLLMLFYCLIILVATTLRETKEESIALEPKMSFKHKFRYCLESVGIVLVLVLCGLHIHELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMTFGKFKYEEFKYTKYNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM
Sbjct:    1 MVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFIQLLLLMLFYCLIILVATTLRETKEESIALEPKMSFKHKFRYCLESVGIVLVLVLCGLHIHELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMTFGKFKYEEFKYTKYNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM 393          
BLAST of Transient receptor potential cation channel subfamily V member vs. Planmine SMEST
Match: SMESG000005887.1 (SMESG000005887.1)

HSP 1 Score: 407.142 bits (1045), Expect = 3.217e-128
Identity = 256/698 (36.68%), Postives = 387/698 (55.44%), Query Frame = 2
Query:  590 DDLIWLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARY---SITCRDYMNPRVITKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLRETKEESIALEPKMSFKHK---FRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQ--IFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVL--LVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM 2653
            DD   L+     R   +Y  +N  G GKL++    +G   + + + +E+  ++ NNG+G +V    + + +I +Y   S+  R+      +   S+  K + +  +  Y  +S         EF      VCW   +RG+ GE LLH+C M  T  H IIA++LL  +PN+ +D+FIG ++FGQT LH  II  +  +VKLLV  G  + +RALG FF          F I+ ++ N     +    +   +  D  ++GEYP+SFAA  G+QE YD L+E G  PNVQD  GNTVLH+VVI+NRT +YR AL+HYK  AD +V+N  GLTP+ L+A LG++ +F EII+LNT  LW + ++ C VYPL  LD+I+  G  DW+S+LM +++  ++ HL ML+ GVV +LL EKWR++  ++F   L   +   ++  +A  LR + +     E  +   +     RY  E +  V+ +     H+  + +Q    ++KGL  S L     +    ++L +  R+    +F     TS          +EE F++ A  L    LLF+    KLTGP VTMI K++ GD++RF  IY I +  F Q F+ LFKDI    IT+F     +++T+FQMT G+FK +  +      + L  ++F  FMI VPILLLNMLIAM+G TY  V S S++EWI++
Sbjct:   19 DDSYLLQLGMAQRKNLMYKYLNLQGNGKLIDGLRNKGVSHVHQVIVDELASFMHNNGKGTLVPTINILKCSITKYVDLSLRSRNSGKETQLPPDSRAIKEMVQTIQSRYEGQS---------EF------VCWEVGRRGILGENLLHICLMLNTKEHLIIARLLLLAYPNLCKDYFIGSQYFGQTPLHMAIINGNKSLVKLLVQIGSPLTRRALGTFFLQ-------DFGIWLDIGN----PSRKQYYRQKL--DTTFYGEYPVSFAASVGDQESYDCLIEKGASPNVQDTFGNTVLHIVVINNRTEMYRMALRHYKCSADSSVMNYDGLTPLALAASLGQQKVFNEIINLNTVVLWSFSNLTCRVYPLTGLDSINTDGSVDWNSTLMRVVDARTEQHLAMLEEGVVYRLLQEKWRLYAKRKFNLRLGFYITQLIVAGMALYLRPSGDLQPYAENHIHAPNNGDIVRYVAEGLSCVMSVTSALYHVANIVKQTFKSYVKGLKYSALSEIIFLGHLFLILAMACRLVGFIVFIVSKSTSTR---ISLFKLEEAFIIIAVPLLWMGLLFYASAIKLTGPCVTMIIKLLVGDIVRFSIIYSIAILLFGQVFYVLFKDIKAKGITSFDDVISTIVTIFQMTLGEFKLQVDQLNYIRYVTLGKIIFVIFMIAVPILLLNMLIAMIGRTYNEVFSSSEREWIAI 685          
BLAST of Transient receptor potential cation channel subfamily V member vs. Planmine SMEST
Match: SMESG000039339.1 (SMESG000039339.1)

HSP 1 Score: 334.339 bits (856), Expect = 5.347e-102
Identity = 245/717 (34.17%), Postives = 375/717 (52.30%), Query Frame = 2
Query:  626 RGTELYNLMNSNGKGKLLEIYS--------EQGERALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVITKFSKQPKIISK---VTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVNGETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYIIQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNL-LINNTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDCNGNTVLHMVVIHNRTAIYRFALKHYK----KPADPNVINKYGLTPITLSAKLGRRHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYIINGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFXXXXXXXXXXXXXXXVATTLR-------------------------ETKEESIALEPKMSFKHKFRYCLESXXXXXXXXXXXXXXXELKEQGIMDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYCRFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTIYVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMXXXXXXXXXXXXXXXNQLVL--LVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWI 2647
            +    +  ++ +G G+  E+          +Q ++ + E+L      YL NNGEG +VS  EL      RY        + +  TK SK   I  +   + +     E+   I P + E       VCW+  +RG  GETLL  C +  T+TH  +AK ++K+FP +  D+++ ++++G++ LH  I   D  +VK L+  G +VNQR  G+FF  +  K       F N++N  L+N T  TN+   V     Y+GE PLSFAAC G +E    L+  G +  +QD NGNT LHM+VIH +      AL+ +     K A  ++ N++GLTP+TL+AKLGR+ ++  I  L  +  WKYG++VC+  PL +LDTI   G  + +S+LM+I+ G   +HLDML+ G++  LL+EKW     KRF     L   Y LI  VA  LR                         +T +    L      +   R  LE + ++  L+     + E+  QG   F+K L+++P+K   L+SCF+I+L IP R             N  Y      E++  + A L    + LF+  GF+L GPFV MI+KM++GDLLRF  IY+I L  F+QA + +F+ +++   + F     +LM +F M+ G+F+    ++      VL  ++F  +MI V +LL+NMLIAMMGNTY MV + +QKEW+
Sbjct:   19 KAVSWFKYLDVSGAGEFFEMMKICNKTKQYDQMDKKIYEYLS----PYLYNNGEGKLVSVDEL-----VRYRSGKSTEKDKKKNTKNSKHNTIYPELQIIREDENGRENPPIINPLYRE-------VCWDIDQRGPVGETLLLFCFLSATSTHYDLAKRIIKIFPKLINDYYMSEEYYGESVLHIAISNEDPAMVKYLLDHGANVNQRCFGNFFLPEDQKHT-----FTNIENSELLNLTVETNYEGHV-----YWGESPLSFAACCGQEECVRLLIAKGADLFMQDHNGNTALHMLVIHIKKMDINIALRMFDLLVDKGARLDMKNRFGLTPLTLAAKLGRKEMYQHIQILEREVHWKYGNVVCAACPLNELDTISCDGTINHNSALMHIVYGEEPEHLDMLE-GIISHLLHEKWNSCVKKRFFINFFLFFIYFLIFTVAFALRPGEDPNLNWQTAVIVDGNNKIIVQNQTDKNRCYLLSTQRTEDIIRLVLELIVVICALMYICSALREVYYQGHKIFMKTLMSAPMKLLHLISCFIIMLMIPGR----------AVCNPEY------EDVMGVMAILSTAPHFLFYCRGFRLVGPFVVMIYKMVRGDLLRFFIIYIIFLLGFSQAMYVVFRRVNE---SLFHEPLEALMGMFIMSLGEFEDIYEQFDCSEHSVLGKILFVVYMILVTLLLVNMLIAMMGNTYTMV-NENQKEWL 688          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPV61.044e-4425.60transient receptor potential cation channel subfam... [more]
TRPV61.142e-4425.43transient receptor potential cation channel subfam... [more]
TRPV61.185e-4425.60transient receptor potential cation channel subfam... [more]
TRPV51.564e-4025.64transient receptor potential cation channel subfam... [more]
TRPV51.564e-4025.64transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osm-91.873e-11834.01Olfactory channel [Source:UniProtKB/TrEMBL;Acc:G5... [more]
ocr-49.491e-6929.87Osm-9 and Capsaicin receptor-Related [Source:UniP... [more]
ocr-12.373e-5730.51Osm-9 and Capsaicin receptor-Related [Source:UniP... [more]
ocr-35.535e-5430.59Osm-9 and Capsaicin receptor-Related [Source:UniP... [more]
ocr-27.061e-4729.37Osm-9 and Capsaicin receptor-Related [Source:UniP... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
iav9.764e-12836.40gene:FBgn0086693 transcript:FBtr0070969[more]
nan2.493e-5730.73gene:FBgn0036414 transcript:FBtr0089524[more]
nan2.901e-5730.73gene:FBgn0036414 transcript:FBtr0321258[more]
CG43937.276e-730.30gene:FBgn0039075 transcript:FBtr0339617[more]
CG43937.276e-730.30gene:FBgn0039075 transcript:FBtr0301085[more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpv12.702e-2827.84transient receptor potential cation channel, subfa... [more]
trpv14.879e-2727.72transient receptor potential cation channel, subfa... [more]
trpv14.879e-2727.72transient receptor potential cation channel, subfa... [more]
trpv63.611e-1927.61transient receptor potential cation channel, subfa... [more]
trpv63.611e-1927.61transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm191.602e-3425.80RNA binding motif protein 19 [Source:Xenbase;Acc:X... [more]
trpv36.596e-3027.51transient receptor potential cation channel, subfa... [more]
tulp21.195e-2832.20TUB like protein 2 [Source:Xenbase;Acc:XB-GENE-991... [more]
tulp22.361e-2832.20TUB like protein 2 [Source:Xenbase;Acc:XB-GENE-991... [more]
tgfb21.228e-2729.21transforming growth factor beta 2 [Source:Xenbase;... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpv61.426e-4426.46transient receptor potential cation channel, subfa... [more]
Trpv61.561e-4426.46transient receptor potential cation channel, subfa... [more]
Trpv52.151e-4025.64transient receptor potential cation channel, subfa... [more]
Trpv32.214e-2725.81transient receptor potential cation channel, subfa... [more]
Trpv41.017e-1931.11transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H1D0|TRPV6_HUMAN5.011e-4425.60Transient receptor potential cation channel subfam... [more]
sp|Q91WD2|TRPV6_MOUSE1.092e-4326.46Transient receptor potential cation channel subfam... [more]
sp|Q9R186|TRPV6_RAT2.682e-4326.12Transient receptor potential cation channel subfam... [more]
sp|Q9XSM3|TRPV5_RABIT3.107e-4325.30Transient receptor potential cation channel subfam... [more]
sp|Q9NQA5|TRPV5_HUMAN4.253e-4025.47Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DQR15.478e-16238.86ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267GDK85.659e-16138.86ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267EZD34.020e-15445.81ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267H5842.977e-15245.81ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267H5B13.272e-15245.81ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpv69.467e-2925.34transient receptor potential cation channel subfam... [more]
trpv61.039e-2825.34transient receptor potential cation channel subfam... [more]
trpv41.800e-1830.00transient receptor potential cation channel, subfa... [more]
trpv16.254e-1728.15transient receptor potential cation channel, subfa... [more]
trpv17.097e-1728.15transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001427.18.190e-2929.19pep scaffold:Pmarinus_7.0:GL477062:131466:156724:-... [more]
ENSPMAT00000007740.11.342e-2729.07pep scaffold:Pmarinus_7.0:GL478934:8361:25408:-1 g... [more]
trpv66.219e-1731.79transient receptor potential cation channel, subfa... [more]
ENSPMAT00000007446.12.515e-724.40pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.13.525e-724.40pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO371083.114e-7432.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpv64.885e-3625.43transient receptor potential cation channel subfam... [more]
trpv62.036e-2328.28transient receptor potential cation channel subfam... [more]
trpv11.973e-2029.10transient receptor potential cation channel subfam... [more]
ENSORLT00000027385.12.206e-1830.88transient receptor potential cation channel subfam... [more]
trpv42.095e-1629.26transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily V member vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004138.10.000e+0100.00SMESG000004138.1[more]
SMESG000004138.10.000e+0100.00SMESG000004138.1[more]
SMESG000004138.10.000e+0100.00SMESG000004138.1[more]
SMESG000005887.13.217e-12836.68SMESG000005887.1[more]
SMESG000039339.15.347e-10234.17SMESG000039339.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008753 ID=SMED30008753|Name=Transient receptor potential cation channel subfamily V member|organism=Schmidtea mediterranea sexual|type=transcript|length=2698bp
GCTTTATTTTGATTATCCAATTTCTTCAGTTTGGTTTAAACAATGATTTT
AGAAGCTTTTCTATTGGTAGATTTCAATTAATTTTCATTAATTGAAATCT
ACCAATAGAAAAGCTTCTAAAATCATTGTTTAAACCAAACTGAAGAAATT
GGATAATCAAAATAAAGCAGGCAAAATAAATAACAAGCTAATACAAACTA
TAATTATATTTATTATATTTTTGTTTCTTTAAATTATTGAAATCAATTGA
ATTTTCGGAATCAATTTAATTTAATAAATTGCTCACTCAAAAAAAATGGA
GTTTTTAAGAAAATAAAAATTTGACAGCTTTTTTTATCTCCAATTACCAG
TTTAACATTTGTAATTCTTCTTTGGAAAACAGAGATTGTCCACAATTTCC
AAAATGCAATCCCCAATGTTGAATGCCTATTCATATCAAAACAATTTCAA
TTGTGGTATGGCCGATGTTCTTGGGAATTCAATAAACAGTTTTAATTTAA
GTAAATACGTTATCAATAAAGGAAAAGGATTGCCTTCTGTTATTACTTGT
TCAGATTCTGAATCTAGAACAGTTAGTTCTGTTGGTGAAGATGATTTAAT
CTGGTTAAGACGAAACGAAAATGTTAGAGGAACCGAATTATATAATTTAA
TGAATTCTAATGGGAAAGGAAAGCTTTTAGAAATTTATAGTGAACAGGGT
GAAAGAGCGTTAGAAGAATTTCTTAAAAATGAAATACCGAAATATTTATT
AAATAATGGCGAAGGAATGATGGTTTCAAAACAAGAGCTCAAGCAAATGA
CGATAGCAAGATATTCCATTACATGTAGAGATTATATGAATCCAAGAGTT
ATCACCAAATTCAGTAAACAACCAAAAATTATCAGCAAAGTTACAAAGAA
AAATTATTTTGAAGAATCATATTGTTCTATTCTACCTTTTTTTGATGAAT
TTTTCAATGAAAAAATCTATGTTTGCTGGAATCATGCCAAACGCGGGGTT
AACGGAGAGACTTTACTGCATCTCTGTGGAATGCAAATCACTGCAACTCA
TAGAATAATCGCTAAAATGCTATTGAAGTTATTTCCAAACATCGCAAGGG
ATTGGTTTATCGGTGACAAATTTTTCGGTCAAACCGCTCTTCATCAATAT
ATCATTCAGTGTGATTTAGAAATCGTTAAACTTTTGGTCTACAGTGGAGT
TGACGTTAATCAACGCGCGTTAGGACATTTTTTTCAATCTCAACTACTGA
AATCAAATAGTAGTTTTTCAATTTTTCAAAATTTGAAAAATTTACTGATT
AACAATACAGAAAACACAAATTTCAACGACTCAGTTGAAGGGGATTTGAA
TTATTTTGGTGAGTACCCGTTGAGTTTTGCCGCTTGTACGGGAAATCAAG
AAATATATGATTTCCTTCTTGAGCATGGTACGGAACCAAATGTTCAAGAC
TGCAATGGTAATACTGTTCTTCATATGGTTGTTATTCATAATAGAACGGC
AATATACCGATTTGCTTTGAAGCATTATAAAAAACCTGCAGATCCAAACG
TAATTAACAAATACGGCCTCACTCCTATTACATTATCCGCAAAACTTGGC
AGAAGGCATATTTTCATGGAAATTATTGATTTAAATACTCAAGAATTATG
GAAATATGGATCTATGGTGTGTTCAGTTTATCCGTTAATGAAACTTGACA
CAATTGATGCATCTGGTCACACTGACTGGAGTTCTTCTCTCATGTATATT
ATCAATGGAACATCTGATGACCATTTAGATATGTTAGATGGAGGAGTAGT
ACGACAACTTTTAAATGAAAAATGGCGGGTTTTCGGTTATAAAAGATTTA
TACAATTACTCCTTCTGATGCTATTTTACTGCTTGATAATTTTGGTTGCG
ACTACTTTAAGAGAAACCAAAGAAGAAAGTATTGCATTGGAACCAAAGAT
GTCTTTCAAACATAAATTTCGATACTGCTTGGAGTCTGTTGGTATTGTAC
TTGTACTCGTTTTGTGCGGTCTTCACATCCATGAATTGAAAGAACAAGGA
ATTATGGATTTTATCAAAGGCTTACTCAATTCTCCTTTAAAAGCATGTTT
TCTAATGTCGTGCTTTTTAATATTGTTGTGCATTCCTTTGAGGATAACAC
AAATATTTACTAGGGAAAATGGCACTAGTAACAATGATGTGTACACCTAT
TGCAGATTTATAGAAGAAATGTTTGTTATGTTCGCTTCTCTACTCAATTG
TTTTTATCTACTATTTTTTACCGGAGGTTTTAAACTTACTGGACCGTTTG
TTACAATGATTTTTAAAATGATTAAAGGAGATTTATTGAGATTTGGAACA
ATATATGTTATTGTATTGTGCGCATTTACTCAAGCTTTCTTTTTTCTATT
CAAAGATATTGACAAATTATCTATTACTACGTTTAAAACCTTTCACGGCT
CTCTGATGACTTTATTTCAGATGACGTTTGGGAAATTTAAATATGAAGAA
TTCAAATACACCAAATACAATCAATTGGTTTTATTAGTTTTTGCATCTTT
TATGATTTTTGTGCCTATTTTATTACTGAATATGTTGATAGCGATGATGG
GAAACACTTACCAAATGGTTATTTCTCGATCACAGAAAGAATGGATTTCA
ATGATACTGCAGTTATGCTCATCAGTTTGATAAATCTGTCAATGATAA
back to top

protein sequence of SMED30008753-orf-1

>SMED30008753-orf-1 ID=SMED30008753-orf-1|Name=SMED30008753-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=759bp
MQSPMLNAYSYQNNFNCGMADVLGNSINSFNLSKYVINKGKGLPSVITCS
DSESRTVSSVGEDDLIWLRRNENVRGTELYNLMNSNGKGKLLEIYSEQGE
RALEEFLKNEIPKYLLNNGEGMMVSKQELKQMTIARYSITCRDYMNPRVI
TKFSKQPKIISKVTKKNYFEESYCSILPFFDEFFNEKIYVCWNHAKRGVN
GETLLHLCGMQITATHRIIAKMLLKLFPNIARDWFIGDKFFGQTALHQYI
IQCDLEIVKLLVYSGVDVNQRALGHFFQSQLLKSNSSFSIFQNLKNLLIN
NTENTNFNDSVEGDLNYFGEYPLSFAACTGNQEIYDFLLEHGTEPNVQDC
NGNTVLHMVVIHNRTAIYRFALKHYKKPADPNVINKYGLTPITLSAKLGR
RHIFMEIIDLNTQELWKYGSMVCSVYPLMKLDTIDASGHTDWSSSLMYII
NGTSDDHLDMLDGGVVRQLLNEKWRVFGYKRFIQLLLLMLFYCLIILVAT
TLRETKEESIALEPKMSFKHKFRYCLESVGIVLVLVLCGLHIHELKEQGI
MDFIKGLLNSPLKACFLMSCFLILLCIPLRITQIFTRENGTSNNDVYTYC
RFIEEMFVMFASLLNCFYLLFFTGGFKLTGPFVTMIFKMIKGDLLRFGTI
YVIVLCAFTQAFFFLFKDIDKLSITTFKTFHGSLMTLFQMTFGKFKYEEF
KYTKYNQLVLLVFASFMIFVPILLLNMLIAMMGNTYQMVISRSQKEWISM
ILQLCSSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR024862TRPV
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR005821Ion_trans_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 200..232
e-value: 210.0
score: 10.1
coord: 387..415
e-value: 2100.0
score: 2.7
coord: 241..270
e-value: 0.0046
score: 26.2
coord: 351..383
e-value: 15.0
score: 14.5
coord: 318..347
e-value: 0.6
score: 19.2
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 242..271
e-value: 0.027
score: 14.9
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 241..273
score: 9.698
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 318..350
score: 10.579
NoneNo IPR availablePFAMPF13857Ank_5coord: 338..393
e-value: 6.4E-7
score: 29.5
NoneNo IPR availablePANTHERPTHR10582:SF28NANCHUNG, ISOFORM Bcoord: 71..750
NoneNo IPR availableTMHMMTMhelixcoord: 564..586
NoneNo IPR availableTMHMMTMhelixcoord: 483..502
NoneNo IPR availableTMHMMTMhelixcoord: 708..730
NoneNo IPR availableTMHMMTMhelixcoord: 644..666
NoneNo IPR availableTMHMMTMhelixcoord: 522..544
NoneNo IPR availableTMHMMTMhelixcoord: 607..629
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 174..461
e-value: 9.2E-54
score: 184.7
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 194..409
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 488..743
e-value: 2.6E-10
score: 40.0
IPR024862Transient receptor potential cation channel subfamily VPANTHERPTHR10582TRANSIENT RECEPTOR POTENTIAL ION CHANNEL PROTEINcoord: 71..750
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 200..409
score: 22.676