Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30008752
Length (bp)1837
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30008752) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30008752) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox domain-containing protein (SMED30008752) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30008752) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008752

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30008752SMESG000016670.1 SmedASXL_006490SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30008752SMESG000016670.1 dd_Smed_v4_11150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008752SMESG000016670.1 dd_Smed_v4_11150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008752SMESG000016670.1 dd_Smed_v4_11150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30008752SMESG000016670.1 dd_Smed_v4_11150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008752SMESG000016670.1 dd_Smed_v4_11150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008752SMESG000016670.1 dd_Smed_v4_11150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008752SMESG000016670.1 dd_Smed_v4_11150_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30008752SMESG000016670.1 dd_Smed_v6_11150_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: ALX3 (ALX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:449])

HSP 1 Score: 90.5077 bits (223), Expect = 3.541e-20
Identity = 42/71 (59.15%), Postives = 51/71 (71.83%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDG 675
            K KK R+RTTFS +QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G I +G
Sbjct:    7 KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEG 77          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: ALX3 (ALX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:449])

HSP 1 Score: 93.2041 bits (230), Expect = 5.314e-20
Identity = 44/79 (55.70%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  439 DSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDG 675
            DS+    +K KK R+RTTFS +QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G I +G
Sbjct:  142 DSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEG 220          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: ARX (aristaless related homeobox [Source:HGNC Symbol;Acc:HGNC:18060])

HSP 1 Score: 92.8189 bits (229), Expect = 4.339e-19
Identity = 41/66 (62.12%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G
Sbjct:  325 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAG 390          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: ALX1 (ALX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:1494])

HSP 1 Score: 88.9669 bits (219), Expect = 1.393e-18
Identity = 52/125 (41.60%), Postives = 71/125 (56.80%), Query Frame = 1
Query:  295 LEEVSSNSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVT-RCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGII 666
            + +V    LH  +  A    N + +S  +  G+ +    D +  +C+S  S S      KK RHRTTF++ QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G I
Sbjct:   80 ITKVEGQPLHTELNRAMDNCNSLRMSPVK--GMQEKGELDELGDKCDSNVSSS------KKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQI 196          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: SHOX (short stature homeobox [Source:HGNC Symbol;Acc:HGNC:10853])

HSP 1 Score: 85.8853 bits (211), Expect = 2.196e-18
Identity = 43/78 (55.13%), Postives = 57/78 (73.08%), Query Frame = 1
Query:  460 SKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD---HNGIISDGTVN 684
            +KLK+ R RT F+  QL+ LE  FD++ YPDA  RE+L+ +LG+ E+RVQVWFQNRRAK RK++   H G+I  GT N
Sbjct:  113 TKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMHKGVIL-GTAN 189          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: unc-4 (Homeobox protein unc-4 [Source:UniProtKB/Swiss-Prot;Acc:P29506])

HSP 1 Score: 87.8113 bits (216), Expect = 3.521e-19
Identity = 46/94 (48.94%), Postives = 58/94 (61.70%), Query Frame = 1
Query:  376 DENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHN 657
            D+N+ +N+++          ED      S  K+ R RT FS +QL  LE AF+ S YPD   RE LA +L + ESRVQVWFQNRRAKWRKR+ N
Sbjct:   62 DDNLLMNEDDG------IALEDDNDTGESAAKRRRTRTNFSGWQLEELESAFEASHYPDVFMREALAMRLDLLESRVQVWFQNRRAKWRKREQN 149          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: unc-30 (Homeobox protein unc-30 [Source:UniProtKB/Swiss-Prot;Acc:P52906])

HSP 1 Score: 86.6557 bits (213), Expect = 2.502e-18
Identity = 42/100 (42.00%), Postives = 67/100 (67.00%), Query Frame = 1
Query:  397 DNNHQDPVTRCNSEDSLSRHNSKLKKSR-HRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNSQV 693
            D+NH D  +  +S  + S +  K++K R  RT F+++QL+ LE+ F ++ YPD   RE++A  + + E RV+VWF+NRRAKWRKR+ N +I +G   ++V
Sbjct:   86 DDNHLDTSSPTDSTGNGSTNGGKIQKPRRQRTHFTSHQLTELENWFSRNRYPDMACREEIAVWISLTEPRVRVWFKNRRAKWRKRERNYVIDNGQGTTKV 185          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: alr-1 (AristaLess (Drosophila homeodomain) Related [Source:UniProtKB/TrEMBL;Acc:Q21836])

HSP 1 Score: 87.0409 bits (214), Expect = 2.771e-18
Identity = 43/87 (49.43%), Postives = 59/87 (67.82%), Query Frame = 1
Query:  391 LNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            L++  +  P    NS D     N K K+ R+RTTFSA+QL  LE  F ++ YPD  TRE+LA ++ + E+RVQVWFQNRRAK+RK++
Sbjct:   94 LDNRENGSPSDGTNSPDD----NGKRKQRRYRTTFSAFQLDELEKVFARTHYPDVFTREELATRVQLTEARVQVWFQNRRAKYRKQE 176          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: unc-30 (Homeobox protein unc-30 [Source:UniProtKB/Swiss-Prot;Acc:P52906])

HSP 1 Score: 86.6557 bits (213), Expect = 2.950e-18
Identity = 42/100 (42.00%), Postives = 67/100 (67.00%), Query Frame = 1
Query:  397 DNNHQDPVTRCNSEDSLSRHNSKLKKSR-HRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNSQV 693
            D+NH D  +  +S  + S +  K++K R  RT F+++QL+ LE+ F ++ YPD   RE++A  + + E RV+VWF+NRRAKWRKR+ N +I +G   ++V
Sbjct:   86 DDNHLDTSSPTDSTGNGSTNGGKIQKPRRQRTHFTSHQLTELENWFSRNRYPDMACREEIAVWISLTEPRVRVWFKNRRAKWRKRERNYVIDNGQGTTKV 185          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-10 (Homeobox protein ceh-10 [Source:UniProtKB/Swiss-Prot;Acc:P41935])

HSP 1 Score: 83.9593 bits (206), Expect = 2.799e-17
Identity = 39/64 (60.94%), Postives = 44/64 (68.75%), Query Frame = 1
Query:  460 SKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            SK KK RHRT F+ YQ+  LE AF  S YPD   RE LA K  + E R+QVWFQNRRAKWRK +
Sbjct:  132 SKRKKRRHRTIFTQYQIDELEKAFQDSHYPDIYAREVLAGKTELQEDRIQVWFQNRRAKWRKTE 195          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: al (gene:FBgn0000061 transcript:FBtr0078053)

HSP 1 Score: 96.6709 bits (239), Expect = 3.615e-21
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 1
Query:  415 PVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            PV+  NS+     +  K K+ R+RTTF+++QL  LE AF ++ YPD  TRE+LA K+G+ E+R+QVWFQNRRAKWRK++  G
Sbjct:   66 PVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVG 147          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: hbn (gene:FBgn0008636 transcript:FBtr0071556)

HSP 1 Score: 92.8189 bits (229), Expect = 6.736e-20
Identity = 47/98 (47.96%), Postives = 63/98 (64.29%), Query Frame = 1
Query:  358 RMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            R D  T+ + GL+ +N  +  +  N+   LS      K  R RTTF+ +QL  LE AF+++ YPD  TRE LA +L + E+RVQVWFQNRRAKWRKR+
Sbjct:  115 REDSPTNTDGGLDVDNDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKRE 212          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Rx (gene:FBgn0020617 transcript:FBtr0342783)

HSP 1 Score: 86.6557 bits (213), Expect = 2.722e-17
Identity = 38/64 (59.38%), Postives = 50/64 (78.12%), Query Frame = 1
Query:  460 SKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            +K K  R+RTTF+ YQL  LE AF++S YPD  +RE+LA K+ + E RVQVWFQNRRAKWR+++
Sbjct:  555 AKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQE 618          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: Pph13 (gene:FBgn0023489 transcript:FBtr0078070)

HSP 1 Score: 82.8037 bits (203), Expect = 9.562e-17
Identity = 37/72 (51.39%), Postives = 51/72 (70.83%), Query Frame = 1
Query:  445 LSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            + +   K K+ R+RTTF+  QL  LE AF ++ YPD   RE+LA ++ + E+RVQVWFQNRRAKWRK++  G
Sbjct:    1 MDKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG 72          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: PHDP (gene:FBgn0025334 transcript:FBtr0072224)

HSP 1 Score: 78.5666 bits (192), Expect = 3.552e-16
Identity = 40/77 (51.95%), Postives = 56/77 (72.73%), Query Frame = 1
Query:  433 SEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGI 663
             +D LS    K K+ R RTTF++ QL+ LE  F ++ YPD  TRE++A+KL + E+RVQVWFQNRRAK+RK++ + I
Sbjct:  100 GDDGLSL-TDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEARVQVWFQNRRAKFRKQERHAI 175          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: arxb (aristaless related homeobox b [Source:ZFIN;Acc:ZDB-GENE-121109-2])

HSP 1 Score: 93.5893 bits (231), Expect = 4.191e-20
Identity = 41/67 (61.19%), Postives = 53/67 (79.10%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGI 663
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G+
Sbjct:  159 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKVGV 225          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: arxa (aristaless related homeobox a [Source:NCBI gene;Acc:30657])

HSP 1 Score: 94.3597 bits (233), Expect = 4.219e-20
Identity = 41/67 (61.19%), Postives = 53/67 (79.10%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGI 663
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G+
Sbjct:  212 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGV 278          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: alx1 (ALX homeobox 1 [Source:NCBI gene;Acc:565176])

HSP 1 Score: 88.9669 bits (219), Expect = 7.577e-19
Identity = 51/118 (43.22%), Postives = 68/118 (57.63%), Query Frame = 1
Query:  313 NSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGII 666
            +SLHAM    + R+      +    G +  +  +   +C+S  S S      KK RHRTTF++ QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G I
Sbjct:   79 SSLHAMENCCSLRV------SPATSGPDKTDLDELGEKCDSNVSSS------KKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRTELTEARVQVWFQNRRAKWRKRERYGQI 184          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: alx1 (ALX homeobox 1 [Source:NCBI gene;Acc:565176])

HSP 1 Score: 88.9669 bits (219), Expect = 7.577e-19
Identity = 51/118 (43.22%), Postives = 68/118 (57.63%), Query Frame = 1
Query:  313 NSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGII 666
            +SLHAM    + R+      +    G +  +  +   +C+S  S S      KK RHRTTF++ QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G I
Sbjct:   79 SSLHAMENCCSLRV------SPATSGPDKTDLDELGEKCDSNVSSS------KKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRTELTEARVQVWFQNRRAKWRKRERYGQI 184          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: alx1 (ALX homeobox 1 [Source:NCBI gene;Acc:565176])

HSP 1 Score: 88.9669 bits (219), Expect = 7.577e-19
Identity = 51/118 (43.22%), Postives = 68/118 (57.63%), Query Frame = 1
Query:  313 NSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGII 666
            +SLHAM    + R+      +    G +  +  +   +C+S  S S      KK RHRTTF++ QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G I
Sbjct:   79 SSLHAMENCCSLRV------SPATSGPDKTDLDELGEKCDSNVSSS------KKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRTELTEARVQVWFQNRRAKWRKRERYGQI 184          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045475.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:38234894:38239775:1 gene:ENSXETG00000019174.1 transcript:ENSXETT00000045475.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 1.768e-19
Identity = 44/86 (51.16%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  412 DPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIIS 669
            +PV + +     S  + K K+ R+RTTFS  QL  LE AF +S YPD  TRE LA +L + E+RVQVWFQNRRAKWRKR+   ++ 
Sbjct:   32 EPVAKQSCALESSAPSGKRKQRRYRTTFSNLQLEELEMAFRKSHYPDVFTREDLAMRLDLTEARVQVWFQNRRAKWRKREKTEMLG 117          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045443.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:38234864:38239775:1 gene:ENSXETG00000019174.1 transcript:ENSXETT00000045443.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 1.794e-19
Identity = 45/82 (54.88%), Postives = 55/82 (67.07%), Query Frame = 1
Query:  421 TRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGII 666
            T C  E S    + K K+ R+RTTFS  QL  LE AF +S YPD  TRE LA +L + E+RVQVWFQNRRAKWRKR+   ++
Sbjct:    1 TSCALESSAP--SGKRKQRRYRTTFSNLQLEELEMAFRKSHYPDVFTREDLAMRLDLTEARVQVWFQNRRAKWRKREKTEML 80          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045492.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:38234894:38239775:1 gene:ENSXETG00000019174.1 transcript:ENSXETT00000045492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 3.106e-19
Identity = 45/83 (54.22%), Postives = 55/83 (66.27%), Query Frame = 1
Query:  418 VTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGII 666
            V  C  E S    + K K+ R+RTTFS  QL  LE AF +S YPD  TRE LA +L + E+RVQVWFQNRRAKWRKR+   ++
Sbjct:   15 VESCALESSAP--SGKRKQRRYRTTFSNLQLEELEMAFRKSHYPDVFTREDLAMRLDLTEARVQVWFQNRRAKWRKREKTEML 95          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ARX (aristaless related homeobox [Source:NCBI gene;Acc:100486727])

HSP 1 Score: 92.4337 bits (228), Expect = 3.918e-19
Identity = 41/66 (62.12%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G
Sbjct:  298 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAG 363          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ALX1 (ALX homeobox 1 [Source:NCBI gene;Acc:100489661])

HSP 1 Score: 88.1965 bits (217), Expect = 1.764e-18
Identity = 40/66 (60.61%), Postives = 48/66 (72.73%), Query Frame = 1
Query:  469 KKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGII 666
            KK RHRTTF++ QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G I
Sbjct:  131 KKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQI 196          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Alx3 (aristaless-like homeobox 3 [Source:MGI Symbol;Acc:MGI:1277097])

HSP 1 Score: 90.8929 bits (224), Expect = 3.396e-21
Identity = 41/72 (56.94%), Postives = 52/72 (72.22%), Query Frame = 1
Query:  460 SKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDG 675
            +K KK R+RTTFS +QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G + +G
Sbjct:    6 TKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKMQEG 77          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Alx3 (aristaless-like homeobox 3 [Source:MGI Symbol;Acc:MGI:1277097])

HSP 1 Score: 92.8189 bits (229), Expect = 4.732e-20
Identity = 43/79 (54.43%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  439 DSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDG 675
            DS+    +K KK R+RTTFS +QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G + +G
Sbjct:  142 DSMELAKTKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKMQEG 220          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Arx (aristaless related homeobox [Source:MGI Symbol;Acc:MGI:1097716])

HSP 1 Score: 92.8189 bits (229), Expect = 2.946e-19
Identity = 41/66 (62.12%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G
Sbjct:  327 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAG 392          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Arx (aristaless related homeobox [Source:MGI Symbol;Acc:MGI:1097716])

HSP 1 Score: 92.8189 bits (229), Expect = 2.946e-19
Identity = 41/66 (62.12%), Postives = 52/66 (78.79%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G
Sbjct:  327 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAG 392          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Alx1 (ALX homeobox 1 [Source:MGI Symbol;Acc:MGI:104621])

HSP 1 Score: 88.5817 bits (218), Expect = 3.872e-19
Identity = 52/125 (41.60%), Postives = 72/125 (57.60%), Query Frame = 1
Query:  295 LEEVSSNSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVT-RCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGII 666
            + +V    LH  +  A    N + +S  +  G+ + +  D +  +C+S  S S      KK RHRTTF++ QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G I
Sbjct:   80 ITKVEGQPLHTELNRAMDNCNNLRMSPVK--GMPEKSELDELGDKCDSNVSSS------KKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQI 196          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q06453|AL_DROME (Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 3.624e-20
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 1
Query:  415 PVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            PV+  NS+     +  K K+ R+RTTF+++QL  LE AF ++ YPD  TRE+LA K+G+ E+R+QVWFQNRRAKWRK++  G
Sbjct:   66 PVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVG 147          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O95076|ALX3_HUMAN (Homeobox protein aristaless-like 3 OS=Homo sapiens OX=9606 GN=ALX3 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 2.552e-19
Identity = 44/79 (55.70%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  439 DSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDG 675
            DS+    +K KK R+RTTFS +QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G I +G
Sbjct:  142 DSMELAKNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEG 220          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O42115|ARX_DANRE (Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.185e-19
Identity = 41/67 (61.19%), Postives = 53/67 (79.10%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGI 663
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G+
Sbjct:  212 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGV 278          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O70137|ALX3_MOUSE (Homeobox protein aristaless-like 3 OS=Mus musculus OX=10090 GN=Alx3 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.310e-19
Identity = 43/79 (54.43%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  439 DSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDG 675
            DS+    +K KK R+RTTFS +QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G + +G
Sbjct:  142 DSMELAKTKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKMQEG 220          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q26657|ALX_STRPU (Aristaless homeobox protein (Fragment) OS=Strongylocentrotus purpuratus OX=7668 GN=ALX PE=2 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 1.213e-18
Identity = 40/68 (58.82%), Postives = 54/68 (79.41%), Query Frame = 1
Query:  460 SKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGI 663
            +K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA ++ + E+RVQVWFQNRRAKWRKR+  G+
Sbjct:  208 TKRKQRRYRTTFTSYQLEELERAFCKTHYPDVFTREELAMRVDLTEARVQVWFQNRRAKWRKREKLGL 275          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A504YIH2 (Homeobox domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_04144 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.044e-21
Identity = 49/75 (65.33%), Postives = 61/75 (81.33%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNS 687
            K KK+RHRTTFS +QLS+LE AFD   YPDA TRE +A+KL + ESRVQVWFQNRRAKWRK++   II++ TV++
Sbjct:  242 KSKKARHRTTFSVHQLSVLEAAFDNCPYPDAATREDIASKLALSESRVQVWFQNRRAKWRKQECGQIITNHTVST 316          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A4E0S3U6 (Homeobox domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_001122 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.118e-21
Identity = 49/75 (65.33%), Postives = 61/75 (81.33%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNS 687
            K KK+RHRTTFS +QLS+LE AFD   YPDA TRE +A+KL + ESRVQVWFQNRRAKWRK++   II++ TV++
Sbjct:  242 KSKKARHRTTFSVHQLSVLEAAFDNCPYPDAATREDIASKLALSESRVQVWFQNRRAKWRKQECGQIITNHTVST 316          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A2H1CTU5 (Homeobox domain protein OS=Fasciola hepatica OX=6192 GN=D915_01522 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.599e-21
Identity = 49/75 (65.33%), Postives = 61/75 (81.33%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNS 687
            K KK+RHRTTFS +QLS+LE AFD   YPDA TRE +A+KL + ESRVQVWFQNRRAKWRK++   II++ TV++
Sbjct:  186 KSKKARHRTTFSVHQLSVLEAAFDNCPYPDAATREDIASKLALSESRVQVWFQNRRAKWRKQECGQIITNHTVST 260          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A183AC78 (Homeobox domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS4563 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.601e-21
Identity = 49/75 (65.33%), Postives = 61/75 (81.33%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNS 687
            K KK+RHRTTFS +QLS+LE AFD   YPDA TRE +A+KL + ESRVQVWFQNRRAKWRK++   I+++ TV+S
Sbjct:   86 KSKKARHRTTFSVHQLSVLEAAFDNCPYPDAVTREDIASKLALSESRVQVWFQNRRAKWRKQECGQILTNHTVSS 160          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A4Z2CW81 (Retinal homeobox protein (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_006956 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.266e-21
Identity = 48/72 (66.67%), Postives = 59/72 (81.94%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGT 678
            K KK+RHRTTFS  QLSILE AFD   YPDA TRE +A+KL + ESRVQVWFQNRRAKWRK++ + ++++GT
Sbjct:  310 KCKKARHRTTFSVQQLSILETAFDNCPYPDAVTREDIASKLSLSESRVQVWFQNRRAKWRKQEGSQLLTNGT 381          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: arxa (aristaless related homeobox [Source:NCBI gene;Acc:103042910])

HSP 1 Score: 96.2857 bits (238), Expect = 1.062e-20
Identity = 50/98 (51.02%), Postives = 65/98 (66.33%), Query Frame = 1
Query:  376 DENIGLNDNNHQDPV-TRCNSEDSLSRHNS-KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGI 663
            DE  G  D + +D   + C S  S S     K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G+
Sbjct:  191 DEESGHGDGDAKDGEDSACLSAGSDSEEGVLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGV 288          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: arxb (aristaless-related homeobox protein-like [Source:NCBI gene;Acc:103045700])

HSP 1 Score: 93.5893 bits (231), Expect = 1.004e-19
Identity = 42/67 (62.69%), Postives = 53/67 (79.10%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGI 663
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  GI
Sbjct:  274 KRKQRRYRTTFTSYQLEQLERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGI 340          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: alx1 (ALX homeobox 1 [Source:NCBI gene;Acc:565176])

HSP 1 Score: 87.4261 bits (215), Expect = 1.882e-18
Identity = 39/64 (60.94%), Postives = 47/64 (73.44%), Query Frame = 1
Query:  469 KKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            KK RHRTTF++ QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G
Sbjct:  116 KKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRTELTEARVQVWFQNRRAKWRKRERYG 179          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: alx4a (ALX homeobox 4 [Source:NCBI gene;Acc:103046081])

HSP 1 Score: 88.1965 bits (217), Expect = 1.892e-18
Identity = 40/66 (60.61%), Postives = 49/66 (74.24%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            K KK R+RTTF++YQL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G
Sbjct:  170 KGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERFG 235          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000011754.2 (visual system homeobox 1 [Source:NCBI gene;Acc:103029061])

HSP 1 Score: 86.6557 bits (213), Expect = 4.213e-18
Identity = 43/79 (54.43%), Postives = 52/79 (65.82%), Query Frame = 1
Query:  427 CNSEDSLSRHNS----KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            C S D     NS    K KK RHRT F+++QL  LE AF+++ YPD   RE LA K  + E R+QVWFQNRRAKWRKR+
Sbjct:  116 CLSGDRADGKNSANSQKRKKRRHRTVFTSHQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKRE 194          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010761.1 (pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-1 gene:ENSPMAG00000009746.1 transcript:ENSPMAT00000010761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 6.927e-13
Identity = 32/58 (55.17%), Postives = 42/58 (72.41%), Query Frame = 1
Query:  469 KKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWR 642
            K+ R RTTF+  QL +LE  F ++ YPD   RE++A K+ + ESRVQVWF+NRRAK R
Sbjct:    5 KQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 62          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: dmbx1b (diencephalon/mesencephalon homeobox 1b [Source:NCBI gene;Acc:550288])

HSP 1 Score: 68.5514 bits (166), Expect = 1.112e-12
Identity = 31/57 (54.39%), Postives = 40/57 (70.18%), Query Frame = 1
Query:  478 RHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKR 648
            R RT F+A QL  LE  F ++ YPD   RE+LA    + E+RVQVWF+NRRAK+RK+
Sbjct:   45 RSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKK 101          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: dlx5a (distal-less homeobox 5a [Source:NCBI gene;Acc:30569])

HSP 1 Score: 63.1586 bits (152), Expect = 7.005e-11
Identity = 31/69 (44.93%), Postives = 47/69 (68.12%), Query Frame = 1
Query:  457 NSKLKKSR-HRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            N K KK R  RT +S++QL+ L+  F Q+ Y     R +LAA LG+ +++V++WFQNRR+K++K   NG
Sbjct:  196 NGKPKKIRKPRTIYSSFQLAALQRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKLGKNG 264          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 56.9954 bits (136), Expect = 2.007e-10
Identity = 28/80 (35.00%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  469 KKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG---IISDGTVNSQVRI 699
            K  + RT FS +QL+ LE +F++  Y   Q R +LA+ L + +++V+ W+QNRR KW+++   G   +   GT  +  R+
Sbjct:    4 KPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKRQTAVGLEFLAEAGTYGALQRL 83          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: dbx1b (developing brain homeobox 1b [Source:NCBI gene;Acc:30416])

HSP 1 Score: 60.8474 bits (146), Expect = 2.282e-10
Identity = 31/81 (38.27%), Postives = 40/81 (49.38%), Query Frame = 1
Query:  484 RTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNSQVRINKDEQHSKL 726
            R  FS  Q   LE  F +  Y     R +LA KLG+ +S+V++WFQNRR KWR      ++S G    Q    K   H  L
Sbjct:  166 RAVFSDVQRKALEKMFQKQKYISKPDRRKLATKLGLKDSQVKIWFQNRRMKWRNSKERELLSAGGCREQTLPTKGNPHPDL 246          
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Match: YHP1 (Homeobox transcriptional repressor; binds Mcm1p and early cell cycle box (ECB) elements of cell cycle regulated genes, thereby restricting ECB-mediated transcription to the M/G1 interval; YHP1 has a paralog, YOX1, that arose from the whole genome duplication [Source:SGD;Acc:S000002859])

HSP 1 Score: 53.5286 bits (127), Expect = 4.481e-8
Identity = 24/64 (37.50%), Postives = 39/64 (60.94%), Query Frame = 1
Query:  496 SAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNS 687
            S+Y+L IL+ AFD+   P+   R +L+ +  + E  VQ+WFQN+R   +K  ++G  S   V+S
Sbjct:  181 SSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSGNTSHCKVHS 244          
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 48.9062 bits (115), Expect = 1.694e-6
Identity = 26/71 (36.62%), Postives = 40/71 (56.34%), Query Frame = 1
Query:  484 RTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNSQVR 696
            RT      L +L+  F+ +  P    R++++  +G+ E  V++WFQNRRAK RK+ H G   D   +SQ R
Sbjct:   81 RTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQH-GSNKDTIPSSQSR 150          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO31796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWY2])

HSP 1 Score: 90.1225 bits (222), Expect = 5.535e-22
Identity = 40/64 (62.50%), Postives = 51/64 (79.69%), Query Frame = 1
Query:  460 SKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            +K K+ R+RTTF++YQL  LE AF ++ YPD  TRE LA K+ + E+RVQVWFQNRRAKWRKR+
Sbjct:   27 AKRKQRRYRTTFTSYQLEELERAFAKTHYPDVFTREALAVKIDLTEARVQVWFQNRRAKWRKRE 90          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO39362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA96])

HSP 1 Score: 88.1965 bits (217), Expect = 1.669e-21
Identity = 47/72 (65.28%), Postives = 59/72 (81.94%), Query Frame = 1
Query:  436 EDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            EDS S + +K KK+R+RTTFS YQ+  LE AFD++ YPD   RE+LAAKLG+ E+R+QVWFQNRRAKWRKR+
Sbjct:    2 EDS-SANAAKKKKTRYRTTFSQYQIEELERAFDKAPYPDVFAREELAAKLGLTEARIQVWFQNRRAKWRKRE 72          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO38926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBH9])

HSP 1 Score: 90.5077 bits (223), Expect = 3.844e-21
Identity = 40/63 (63.49%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            K KK R+RTTF+AYQL  +E  F ++ YPD  TREQLA +  + E+RVQVWFQNRRAKWRKR+
Sbjct:   11 KRKKRRNRTTFTAYQLEEMERVFQKTHYPDVYTREQLALRCALTEARVQVWFQNRRAKWRKRE 73          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO39160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAY2])

HSP 1 Score: 87.4261 bits (215), Expect = 6.807e-21
Identity = 43/83 (51.81%), Postives = 56/83 (67.47%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD----HNGIISD-GTVNSQVR 696
            K KK RHRT F+ YQL  LE AF +S YPD   RE L+ K+ + E R+QVWFQNRRAKWRK++    H+ I+++ G   + VR
Sbjct:    2 KAKKRRHRTIFTNYQLEELEKAFKESHYPDVYARENLSLKIDLPEDRIQVWFQNRRAKWRKKEKCWGHSSIMAEYGLYGAMVR 84          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO42103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G7])

HSP 1 Score: 88.9669 bits (219), Expect = 3.264e-20
Identity = 41/74 (55.41%), Postives = 52/74 (70.27%), Query Frame = 1
Query:  430 NSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            + E+S        K  R RTTF+ YQL  LE AF+++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+
Sbjct:    6 SGEESAGEDGKPRKVRRSRTTFTTYQLHQLERAFEKTQYPDVFTREELALRLDLSEARVQVWFQNRRAKWRKRE 79          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: arx (aristaless related homeobox [Source:NCBI gene;Acc:100144363])

HSP 1 Score: 93.9745 bits (232), Expect = 5.852e-20
Identity = 41/67 (61.19%), Postives = 53/67 (79.10%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGI 663
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G+
Sbjct:  219 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGV 285          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: arx (aristaless related homeobox [Source:NCBI gene;Acc:100144363])

HSP 1 Score: 93.9745 bits (232), Expect = 8.013e-20
Identity = 41/67 (61.19%), Postives = 53/67 (79.10%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGI 663
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G+
Sbjct:  219 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGV 285          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: arx (aristaless related homeobox [Source:NCBI gene;Acc:100144363])

HSP 1 Score: 93.5893 bits (231), Expect = 9.448e-20
Identity = 41/67 (61.19%), Postives = 53/67 (79.10%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGI 663
            K K+ R+RTTF++YQL  LE AF ++ YPD  TRE+LA +L + E+RVQVWFQNRRAKWRKR+  G+
Sbjct:  219 KRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGV 285          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: alx1 (ALX homeobox 1 [Source:NCBI gene;Acc:101154901])

HSP 1 Score: 88.1965 bits (217), Expect = 1.123e-18
Identity = 40/66 (60.61%), Postives = 48/66 (72.73%), Query Frame = 1
Query:  469 KKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGII 666
            KK RHRTTF++ QL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G I
Sbjct:  123 KKRRHRTTFTSAQLEELEKVFQKTHYPDVYVREQLAMRTELTEARVQVWFQNRRAKWRKRERYGQI 188          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: alx4b (homeobox protein aristaless-like 4 [Source:NCBI gene;Acc:101168948])

HSP 1 Score: 88.5817 bits (218), Expect = 1.596e-18
Identity = 40/66 (60.61%), Postives = 49/66 (74.24%), Query Frame = 1
Query:  463 KLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNG 660
            K KK R+RTTF++YQL  LE  F ++ YPD   REQLA +  + E+RVQVWFQNRRAKWRKR+  G
Sbjct:  170 KGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERFG 235          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000016670.1 (SMESG000016670.1)

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 497/497 (100.00%), Postives = 497/497 (100.00%), Query Frame = 1
Query:  196 MEVSRWISENTLSSMQLKDQEQLVAAQLERLKQLEEVSSNSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNSQVRINKDEQHSKLMRSTNQLFSEQNAAPGHTKTEPISITDFSSLSKQCXXXXXXXXXXXXXXXXYLHSTTGGLHPLDLYALSKLSPHENNNKNNLDSSLFSLPNTNMSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXXXIQKSPAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPVTGSNPSPIYPDTSNMGPXXXXXXXXXXXXXXXXXKQAISQLVQTAXXXXXXXXXXXXXXXXXXXLKRQSPIKQQPPXXXXXXXXXXXXXXXXXXHRLPSTERDSRSYSEAISNSTTVT 1686
            MEVSRWISENTLSSMQLKDQEQLVAAQLERLKQLEEVSSNSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNSQVRINKDEQHSKLMRSTNQLFSEQNAAPGHTKTEPISITDFSSLSKQCNTTSNSNSSVSASLSNYLHSTTGGLHPLDLYALSKLSPHENNNKNNLDSSLFSLPNTNMSDILNNIPSLLQPLPPPYSIPSNTESTNKNSNTVTSSTNPLSGLSSLYSSLSHQSDSLNSIQKSPAELLQQYYQQLTLSLPNSSHSLLSIPPPPPPPPIPLSSIYNPVTGSNPSPIYPDTSNMGPFYQQLLFQQYSQALSQYKQAISQLVQTAQSNQTNSKSDSKSSDNETNLKRQSPIKQQPPTSSSFTDNLNSSSFFNFLHRLPSTERDSRSYSEAISNSTTVT
Sbjct:    1 MEVSRWISENTLSSMQLKDQEQLVAAQLERLKQLEEVSSNSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNSQVRINKDEQHSKLMRSTNQLFSEQNAAPGHTKTEPISITDFSSLSKQCNTTSNSNSSVSASLSNYLHSTTGGLHPLDLYALSKLSPHENNNKNNLDSSLFSLPNTNMSDILNNIPSLLQPLPPPYSIPSNTESTNKNSNTVTSSTNPLSGLSSLYSSLSHQSDSLNSIQKSPAELLQQYYQQLTLSLPNSSHSLLSIPPPPPPPPIPLSSIYNPVTGSNPSPIYPDTSNMGPFYQQLLFQQYSQALSQYKQAISQLVQTAQSNQTNSKSDSKSSDNETNLKRQSPIKQQPPTSSSFTDNLNSSSFFNFLHRLPSTERDSRSYSEAISNSTTVT 497          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000016670.1 (SMESG000016670.1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 1
Query:  238 MQLKDQEQLVAAQLERLKQLEEVSSNSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNSQVRINKDEQHSKLMRSTNQLFSEQNAAPGHTKTEPISITDFSSLSKQCXXXXXXXXXXXXXXXXYLHSTTGGLHPLDLYALSKLSPHENNNKNNLDSSLFSLPNTNMSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXXXIQKSPAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPVTGSNPSPIYPDTSNMGPXXXXXXXXXXXXXXXXXKQAISQLVQTAXXXXXXXXXXXXXXXXXXXLKRQSPIKQQPPXXXXXXXXXXXXXXXXXXHRLPSTERDSRSYSEAISNSTTVT 1686
            MQLKDQEQLVAAQLERLKQLEEVSSNSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNSQVRINKDEQHSKLMRSTNQLFSEQNAAPGHTKTEPISITDFSSLSKQCNTTSNSNSSVSASLSNYLHSTTGGLHPLDLYALSKLSPHENNNKNNLDSSLFSLPNTNMSDILNNIPSLLQPLPPPYSIPSNTESTNKNSNTVTSSTNPLSGLSSLYSSLSHQSDSLNSIQKSPAELLQQYYQQLTLSLPNSSHSLLSIPPPPPPPPIPLSSIYNPVTGSNPSPIYPDTSNMGPFYQQLLFQQYSQALSQYKQAISQLVQTAQSNQTNSKSDSKSSDNETNLKRQSPIKQQPPTSSSFTDNLNSSSFFNFLHRLPSTERDSRSYSEAISNSTTVT
Sbjct:    1 MQLKDQEQLVAAQLERLKQLEEVSSNSLHAMVAAANHRLNRMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRDHNGIISDGTVNSQVRINKDEQHSKLMRSTNQLFSEQNAAPGHTKTEPISITDFSSLSKQCNTTSNSNSSVSASLSNYLHSTTGGLHPLDLYALSKLSPHENNNKNNLDSSLFSLPNTNMSDILNNIPSLLQPLPPPYSIPSNTESTNKNSNTVTSSTNPLSGLSSLYSSLSHQSDSLNSIQKSPAELLQQYYQQLTLSLPNSSHSLLSIPPPPPPPPIPLSSIYNPVTGSNPSPIYPDTSNMGPFYQQLLFQQYSQALSQYKQAISQLVQTAQSNQTNSKSDSKSSDNETNLKRQSPIKQQPPTSSSFTDNLNSSSFFNFLHRLPSTERDSRSYSEAISNSTTVT 483          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000020038.1 (SMESG000020038.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.344e-19
Identity = 42/80 (52.50%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  418 VTRCNSED--SLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            +  C+  D  S +   +K KK R+RTTFS+YQL  +E  F ++ YPD   REQLA + G+ E+RVQVWFQNRRAKWRK++
Sbjct:   45 IQSCSKSDNGSANSEEAKKKKRRNRTTFSSYQLDEMERIFQKTHYPDVYAREQLAFRTGLSEARVQVWFQNRRAKWRKKE 124          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000033843.1 (SMESG000033843.1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.403e-19
Identity = 42/73 (57.53%), Postives = 54/73 (73.97%), Query Frame = 1
Query:  433 SEDSLSRHNSKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD 651
            S D LS  N K +  R+RTTF+ YQL  LE AF++S YPD  +RE+LA K+ + E RVQVWFQNRRAKWR+++
Sbjct:   79 SPDRLSNCNKKHR--RNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKISLPEVRVQVWFQNRRAKWRRQE 149          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000080420.1 (SMESG000080420.1)

HSP 1 Score: 88.5817 bits (218), Expect = 9.804e-19
Identity = 45/92 (48.91%), Postives = 61/92 (66.30%), Query Frame = 1
Query:  460 SKLKKSRHRTTFSAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRKRD-HNGIISDGTVNSQ-VRINKDEQHSKLM 729
            S+ K+ R+RTTF+  QL  LE AF Q+ YPD  TRE+LA ++ + E+RVQVWFQNRRAKWRK +    +  +  +N Q  R N   QH+ L+
Sbjct:   26 SRRKQRRNRTTFTMQQLEELEKAFQQTHYPDVFTREELALRISLTEARVQVWFQNRRAKWRKTERFQPLQQNSGINDQHFRSNNSNQHTNLL 117          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALX33.541e-2059.15ALX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:449][more]
ALX35.314e-2055.70ALX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:449][more]
ARX4.339e-1962.12aristaless related homeobox [Source:HGNC Symbol;Ac... [more]
ALX11.393e-1841.60ALX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:1494][more]
SHOX2.196e-1855.13short stature homeobox [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-43.521e-1948.94Homeobox protein unc-4 [Source:UniProtKB/Swiss-Pr... [more]
unc-302.502e-1842.00Homeobox protein unc-30 [Source:UniProtKB/Swiss-P... [more]
alr-12.771e-1849.43AristaLess (Drosophila homeodomain) Related [Sour... [more]
unc-302.950e-1842.00Homeobox protein unc-30 [Source:UniProtKB/Swiss-P... [more]
ceh-102.799e-1760.94Homeobox protein ceh-10 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
al3.615e-2152.44gene:FBgn0000061 transcript:FBtr0078053[more]
hbn6.736e-2047.96gene:FBgn0008636 transcript:FBtr0071556[more]
Rx2.722e-1759.38gene:FBgn0020617 transcript:FBtr0342783[more]
Pph139.562e-1751.39gene:FBgn0023489 transcript:FBtr0078070[more]
PHDP3.552e-1651.95gene:FBgn0025334 transcript:FBtr0072224[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arxb4.191e-2061.19aristaless related homeobox b [Source:ZFIN;Acc:ZDB... [more]
arxa4.219e-2061.19aristaless related homeobox a [Source:NCBI gene;Ac... [more]
alx17.577e-1943.22ALX homeobox 1 [Source:NCBI gene;Acc:565176][more]
alx17.577e-1943.22ALX homeobox 1 [Source:NCBI gene;Acc:565176][more]
alx17.577e-1943.22ALX homeobox 1 [Source:NCBI gene;Acc:565176][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045475.11.768e-1951.16pep primary_assembly:Xenopus_tropicalis_v9.1:8:382... [more]
ENSXETT00000045443.11.794e-1954.88pep primary_assembly:Xenopus_tropicalis_v9.1:8:382... [more]
ENSXETT00000045492.13.106e-1954.22pep primary_assembly:Xenopus_tropicalis_v9.1:8:382... [more]
ARX3.918e-1962.12aristaless related homeobox [Source:NCBI gene;Acc:... [more]
ALX11.764e-1860.61ALX homeobox 1 [Source:NCBI gene;Acc:100489661][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Alx33.396e-2156.94aristaless-like homeobox 3 [Source:MGI Symbol;Acc:... [more]
Alx34.732e-2054.43aristaless-like homeobox 3 [Source:MGI Symbol;Acc:... [more]
Arx2.946e-1962.12aristaless related homeobox [Source:MGI Symbol;Acc... [more]
Arx2.946e-1962.12aristaless related homeobox [Source:MGI Symbol;Acc... [more]
Alx13.872e-1941.60ALX homeobox 1 [Source:MGI Symbol;Acc:MGI:104621][more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q06453|AL_DROME3.624e-2052.44Homeobox protein aristaless OS=Drosophila melanoga... [more]
sp|O95076|ALX3_HUMAN2.552e-1955.70Homeobox protein aristaless-like 3 OS=Homo sapiens... [more]
sp|O42115|ARX_DANRE3.185e-1961.19Aristaless-related homeobox protein OS=Danio rerio... [more]
sp|O70137|ALX3_MOUSE3.310e-1954.43Homeobox protein aristaless-like 3 OS=Mus musculus... [more]
sp|Q26657|ALX_STRPU1.213e-1858.82Aristaless homeobox protein (Fragment) OS=Strongyl... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YIH21.044e-2165.33Homeobox domain-containing protein OS=Fasciola gig... [more]
A0A4E0S3U61.118e-2165.33Homeobox domain-containing protein OS=Fasciola hep... [more]
A0A2H1CTU51.599e-2165.33Homeobox domain protein OS=Fasciola hepatica OX=61... [more]
A0A183AC781.601e-2165.33Homeobox domain-containing protein OS=Echinostoma ... [more]
A0A4Z2CW812.266e-2166.67Retinal homeobox protein (Fragment) OS=Schistosoma... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arxa1.062e-2051.02aristaless related homeobox [Source:NCBI gene;Acc:... [more]
arxb1.004e-1962.69aristaless-related homeobox protein-like [Source:N... [more]
alx11.882e-1860.94ALX homeobox 1 [Source:NCBI gene;Acc:565176][more]
alx4a1.892e-1860.61ALX homeobox 4 [Source:NCBI gene;Acc:103046081][more]
ENSAMXT00000011754.24.213e-1854.43visual system homeobox 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010761.16.927e-1355.17pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-... [more]
dmbx1b1.112e-1254.39diencephalon/mesencephalon homeobox 1b [Source:NCB... [more]
dlx5a7.005e-1144.93distal-less homeobox 5a [Source:NCBI gene;Acc:3056... [more]
barhl22.007e-1035.00BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
dbx1b2.282e-1038.27developing brain homeobox 1b [Source:NCBI gene;Acc... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YHP14.481e-837.50Homeobox transcriptional repressor; binds Mcm1p an... [more]
PHO21.694e-636.62Homeobox transcription factor; regulatory targets ... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO317965.535e-2262.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393621.669e-2165.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389263.844e-2163.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391606.807e-2151.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421033.264e-2055.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arx5.852e-2061.19aristaless related homeobox [Source:NCBI gene;Acc:... [more]
arx8.013e-2061.19aristaless related homeobox [Source:NCBI gene;Acc:... [more]
arx9.448e-2061.19aristaless related homeobox [Source:NCBI gene;Acc:... [more]
alx11.123e-1860.61ALX homeobox 1 [Source:NCBI gene;Acc:101154901][more]
alx4b1.596e-1860.61homeobox protein aristaless-like 4 [Source:NCBI ge... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016670.10.000e+0100.00SMESG000016670.1[more]
SMESG000016670.10.000e+0100.00SMESG000016670.1[more]
SMESG000020038.11.344e-1952.50SMESG000020038.1[more]
SMESG000033843.13.403e-1957.53SMESG000033843.1[more]
SMESG000080420.19.804e-1948.91SMESG000080420.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008752 ID=SMED30008752|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1837bp
ATTATTATTATTATTATTATTTTTCCCTGGTACTCATCTTCAAATCAAAG
CAACATCAACAAGAGAGAAAAAGGAAAAAAACAAACTTTATCAACCAGAA
ACTTAATGAAAGAATCTTTACAACAGAGTTTCCAATAACAGCTTTTTTTA
TATATTTATTTTTTTTCCAAATCAAAAAAAAAACACCCCGTCAAAATGGA
AGTTTCACGTTGGATCTCAGAGAACACTCTTTCATCAATGCAACTGAAAG
ATCAAGAACAATTAGTGGCAGCTCAATTGGAACGATTGAAACAATTGGAA
GAGGTCTCGTCGAACAGTTTGCACGCAATGGTAGCCGCAGCGAACCACAG
ACTCAATCGGATGGATGTAAGCACCGATGAAAATATCGGCCTCAACGACA
ACAATCACCAAGATCCCGTAACCCGATGCAATTCTGAAGACTCATTATCC
CGACATAATAGTAAATTAAAAAAATCAAGACATAGGACAACGTTTTCTGC
GTATCAATTATCAATACTCGAACACGCGTTCGACCAATCAGCATATCCCG
ATGCACAAACTCGCGAACAGCTCGCCGCAAAACTAGGAATCGGAGAATCA
CGCGTTCAAGTCTGGTTTCAAAATAGACGTGCAAAATGGCGTAAACGTGA
TCACAATGGAATTATCTCAGATGGAACAGTAAACTCACAAGTTCGAATAA
ACAAAGACGAACAACATTCAAAATTGATGCGTTCAACCAATCAACTTTTC
TCGGAGCAAAATGCTGCTCCCGGTCACACGAAAACCGAGCCCATATCAAT
AACGGATTTCAGTTCCTTATCCAAGCAATGTAACACAACATCGAATTCCA
ATTCCTCTGTATCGGCCAGTCTTTCAAATTACCTTCATTCAACTACAGGA
GGCTTGCATCCATTAGATTTGTATGCCTTATCAAAACTTTCACCTCATGA
AAATAACAACAAAAACAATTTGGACTCATCGCTATTTTCACTTCCAAACA
CAAATATGTCAGATATTCTTAACAATATTCCTTCTCTCCTTCAGCCATTA
CCTCCTCCATATTCTATACCCTCGAATACAGAATCCACTAACAAAAACAG
CAATACGGTGACATCAAGTACGAATCCACTGTCAGGTCTGAGTAGTTTGT
ATTCTAGTTTATCACATCAAAGTGATTCATTAAATTCCATTCAAAAAAGT
CCAGCAGAATTGCTGCAACAATATTATCAACAGTTGACATTGTCATTACC
GAATTCGTCACACAGCCTCCTTTCAATTCCTCCTCCTCCTCCACCGCCAC
CCATTCCATTATCATCAATTTACAATCCAGTCACTGGATCCAATCCATCC
CCAATCTATCCCGACACATCGAATATGGGTCCATTTTATCAGCAGCTCCT
TTTCCAGCAATATTCTCAAGCTCTTTCTCAATATAAACAAGCAATATCAC
AATTGGTCCAAACCGCCCAATCCAATCAAACGAATTCAAAATCAGATTCC
AAGTCCTCTGATAACGAGACGAATTTAAAACGACAATCTCCGATTAAACA
ACAGCCCCCGACATCAAGCTCATTTACAGATAATCTCAACTCCAGTTCGT
TTTTTAACTTTTTACATAGACTGCCCTCAACAGAAAGAGACTCGAGAAGC
TACTCGGAGGCCATTAGCAATTCGACCACAGTTACGTGATTTTGTATAGT
TAAACTTCGCTATCAGCACTGATTTGCACTTGTTTTGTATTGCACTTTTT
CACTCTCATTGTACAGATAATCGGTTACAATCTTGTAACTCTGATGTTGT
TGATTTGAATTTGATAATAAATAATCTTGAACTCGAA
back to top

protein sequence of SMED30008752-orf-1

>SMED30008752-orf-1 ID=SMED30008752-orf-1|Name=SMED30008752-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=498bp
MEVSRWISENTLSSMQLKDQEQLVAAQLERLKQLEEVSSNSLHAMVAAAN
HRLNRMDVSTDENIGLNDNNHQDPVTRCNSEDSLSRHNSKLKKSRHRTTF
SAYQLSILEHAFDQSAYPDAQTREQLAAKLGIGESRVQVWFQNRRAKWRK
RDHNGIISDGTVNSQVRINKDEQHSKLMRSTNQLFSEQNAAPGHTKTEPI
SITDFSSLSKQCNTTSNSNSSVSASLSNYLHSTTGGLHPLDLYALSKLSP
HENNNKNNLDSSLFSLPNTNMSDILNNIPSLLQPLPPPYSIPSNTESTNK
NSNTVTSSTNPLSGLSSLYSSLSHQSDSLNSIQKSPAELLQQYYQQLTLS
LPNSSHSLLSIPPPPPPPPIPLSSIYNPVTGSNPSPIYPDTSNMGPFYQQ
LLFQQYSQALSQYKQAISQLVQTAQSNQTNSKSDSKSSDNETNLKRQSPI
KQQPPTSSSFTDNLNSSSFFNFLHRLPSTERDSRSYSEAISNSTTVT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002111X2 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000047HTH_motif
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 17..37
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 78..154
e-value: 4.1E-28
score: 98.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 75..95
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 425..461
NoneNo IPR availablePANTHERPTHR24329:SF534DORSAL ROOT GANGLIA HOMEOBOX, ISOFORM E-RELATEDcoord: 68..451
NoneNo IPR availablePANTHERPTHR24329FAMILY NOT NAMEDcoord: 68..451
IPR000047Helix-turn-helix motifPRINTSPR00031HTHREPRESSRcoord: 122..131
score: 52.04
coord: 131..147
score: 52.71
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 93..155
e-value: 4.6E-27
score: 105.9
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 95..150
e-value: 1.9E-24
score: 85.3
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 91..151
score: 20.342
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 95..151
e-value: 5.85603E-22
score: 86.9136
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 126..149
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 89..152