Origin recognition complex subunit 1

Overview
NameOrigin recognition complex subunit 1
Smed IDSMED30008750
Length (bp)1688
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Origin recognition complex subunit 1 (SMED30008750) t-SNE clustered cells

Violin plots show distribution of expression levels for Origin recognition complex subunit 1 (SMED30008750) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Origin recognition complex subunit 1 (SMED30008750) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Origin recognition complex subunit 1 (SMED30008750) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008750

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008750SMESG000072187.1 SmedASXL_015567SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30008750SMESG000072187.1 SmedASXL_015567SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30008750SMESG000072187.1 dd_Smed_v4_8215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30008750SMESG000072187.1 dd_Smed_v4_8215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30008750SMESG000072187.1 dd_Smed_v4_8215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30008750SMESG000072187.1 dd_Smed_v4_8215_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Match: ORC1 (origin recognition complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:8487])

HSP 1 Score: 281.952 bits (720), Expect = 1.700e-84
Identity = 168/409 (41.08%), Postives = 246/409 (60.15%), Query Frame = 2
Query:  452 KNYLKPR--KSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLT-----FRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL-----QKEDKK--IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            K  LKPR  +  +   RSR     +P++V    R +LHV ++PE+ PCRE+EF +IYNF+   L   T  CM+ISGVPGTGKTATV   I  L++         F+ + +N M ++EP QVY++I Q L   K  AN A   L ++  + G+        ++++DE+D L   KQD++Y +F W     +RLV+L I+NTMDL  RI+  +V+SRLG++++ F+PY+  QL QI+ +R+  + L+  F+  AI+LVARKVAA+SGDARR LDICRRA  +     QK D    + +A     + EM+SS  I AI K  S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +P    S+  A+   LG+ +LL  +   ND+ L++RL  S  D+L+AL D
Sbjct:  459 KKSLKPRTPRCAAPQIRSRSLAAQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQET---TVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRL--KHLKA-FEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAI-KNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKD 860          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Match: ORC1 (origin recognition complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:8487])

HSP 1 Score: 281.952 bits (720), Expect = 1.700e-84
Identity = 168/409 (41.08%), Postives = 246/409 (60.15%), Query Frame = 2
Query:  452 KNYLKPR--KSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLT-----FRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL-----QKEDKK--IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            K  LKPR  +  +   RSR     +P++V    R +LHV ++PE+ PCRE+EF +IYNF+   L   T  CM+ISGVPGTGKTATV   I  L++         F+ + +N M ++EP QVY++I Q L   K  AN A   L ++  + G+        ++++DE+D L   KQD++Y +F W     +RLV+L I+NTMDL  RI+  +V+SRLG++++ F+PY+  QL QI+ +R+  + L+  F+  AI+LVARKVAA+SGDARR LDICRRA  +     QK D    + +A     + EM+SS  I AI K  S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +P    S+  A+   LG+ +LL  +   ND+ L++RL  S  D+L+AL D
Sbjct:  459 KKSLKPRTPRCAAPQIRSRSLAAQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQET---TVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRL--KHLKA-FEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAI-KNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKD 860          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Match: CDC6 (cell division cycle 6 [Source:HGNC Symbol;Acc:HGNC:1744])

HSP 1 Score: 160.229 bits (404), Expect = 7.136e-42
Identity = 104/359 (28.97%), Postives = 182/359 (50.70%), Query Frame = 2
Query:  557 SIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVH---ANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRIL-QYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKED----------------------KKIDLASINAVIKEMYSSPIII---AIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLA 1546
            ++P+  P RE E   I NFL +++    +  +++SG PGTGKTA +   +  L++    F+ + +N M +   Q V+  I Q +   +V        +  LE+ +  T  +  M   +++V+DE+DQL  K QDVLY +F+W   SNS LVL+ I+NT+DL+ RIL + +   +     L F PY+  Q+V I+  R+     +   D  A++  ARKV+A+SGD R+ALD+CRRA+ + + D                      K++ L  I+ VI E+  + + +     +      +K+ + +L+   +    +E TL  +      +C+ + V  ++ S+  ++ G L A  +L 
Sbjct:  167 AVPDRLPAREREMDVIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQAVFPAIAQEICQEEVSRPAGKDMMRKLEKHM--TAEKGPM---IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILG 520          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Match: CDC6 (cell division cycle 6 [Source:HGNC Symbol;Acc:HGNC:1744])

HSP 1 Score: 160.229 bits (404), Expect = 7.136e-42
Identity = 104/359 (28.97%), Postives = 182/359 (50.70%), Query Frame = 2
Query:  557 SIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVH---ANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRIL-QYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKED----------------------KKIDLASINAVIKEMYSSPIII---AIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLA 1546
            ++P+  P RE E   I NFL +++    +  +++SG PGTGKTA +   +  L++    F+ + +N M +   Q V+  I Q +   +V        +  LE+ +  T  +  M   +++V+DE+DQL  K QDVLY +F+W   SNS LVL+ I+NT+DL+ RIL + +   +     L F PY+  Q+V I+  R+     +   D  A++  ARKV+A+SGD R+ALD+CRRA+ + + D                      K++ L  I+ VI E+  + + +     +      +K+ + +L+   +    +E TL  +      +C+ + V  ++ S+  ++ G L A  +L 
Sbjct:  167 AVPDRLPAREREMDVIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQAVFPAIAQEICQEEVSRPAGKDMMRKLEKHM--TAEKGPM---IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEVTLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILG 520          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Celegans
Match: orc-1 (Origin recognition complex subunit 1 [Source:UniProtKB/TrEMBL;Acc:Q9XX17])

HSP 1 Score: 177.178 bits (448), Expect = 5.873e-48
Identity = 109/295 (36.95%), Postives = 171/295 (57.97%), Query Frame = 2
Query:  503 LEELTDP----SAVT----RGKLHVGSIPENFPCREEEFMNIYNFLYD--NLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQAL-----FTSKVHANKAVA-ALERELFSTGARAR-MRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRA--VVLQKEDKKIDLASI----NAVIKEM 1318
            LE+L DP    SA T      +LH+  +PE  PCR+ E   I  F+ +  +  R  SS M+ISGVPGTGKTATV   ++ ++++    + V++    +   + V++ IY  +      + K    K  A A  +EL S   R    R P++++IDE+D LC +KQDVLY IF+W     S++ ++ I+NT+D   R+L  +  SRL   +L F+PY  +Q+ +IV AR+    L    DPKA+ELVA+KVA  +GD R+ALD   RA  V ++++ +K++L+ +    NAV++ +
Sbjct:  236 LEDLVDPLDSRSASTLKELASRLHLSKVPEKLPCRDIESREIEKFIREVIDPKRGESSAMYISGVPGTGKTATVRAVVNSMKKSKKCQKFVYVEVNAMIFKKTVFVEIYNGIQEEYNISKKPQRAKITATAARQELNSIFKREDPKRPPIVVLIDELDSLCNRKQDVLYDIFEWTALPQSKVTIIGIANTLDFPERMLCQRNASRLDKRRLVFQPYQHEQIEEIVRARLQGSNL---IDPKAVELVAKKVAMNTGDLRQALDFLCRAIRVAVERKSEKLELSHVIAAQNAVLEPL 527          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Celegans
Match: orc-1 (Origin recognition complex subunit 1 [Source:UniProtKB/TrEMBL;Acc:Q9XX17])

HSP 1 Score: 177.178 bits (448), Expect = 5.873e-48
Identity = 109/295 (36.95%), Postives = 171/295 (57.97%), Query Frame = 2
Query:  503 LEELTDP----SAVT----RGKLHVGSIPENFPCREEEFMNIYNFLYD--NLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQAL-----FTSKVHANKAVA-ALERELFSTGARAR-MRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRA--VVLQKEDKKIDLASI----NAVIKEM 1318
            LE+L DP    SA T      +LH+  +PE  PCR+ E   I  F+ +  +  R  SS M+ISGVPGTGKTATV   ++ ++++    + V++    +   + V++ IY  +      + K    K  A A  +EL S   R    R P++++IDE+D LC +KQDVLY IF+W     S++ ++ I+NT+D   R+L  +  SRL   +L F+PY  +Q+ +IV AR+    L    DPKA+ELVA+KVA  +GD R+ALD   RA  V ++++ +K++L+ +    NAV++ +
Sbjct:  236 LEDLVDPLDSRSASTLKELASRLHLSKVPEKLPCRDIESREIEKFIREVIDPKRGESSAMYISGVPGTGKTATVRAVVNSMKKSKKCQKFVYVEVNAMIFKKTVFVEIYNGIQEEYNISKKPQRAKITATAARQELNSIFKREDPKRPPIVVLIDELDSLCNRKQDVLYDIFEWTALPQSKVTIIGIANTLDFPERMLCQRNASRLDKRRLVFQPYQHEQIEEIVRARLQGSNL---IDPKAVELVAKKVAMNTGDLRQALDFLCRAIRVAVERKSEKLELSHVIAAQNAVLEPL 527          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Celegans
Match: cdc-6 (Cell division control protein [Source:UniProtKB/TrEMBL;Acc:P91155])

HSP 1 Score: 127.872 bits (320), Expect = 2.272e-31
Identity = 82/261 (31.42%), Postives = 142/261 (54.41%), Query Frame = 2
Query:  581 REEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVV-LQKEDKKIDLASIN------AVIKEMYSSPIIIA 1342
            R EEF ++  ++  +    TS  +++SG PGTGKTAT    +  L+  G + R   +N    +    ++  I+++L                E+F    + + ++P+++V+DEID L  +K   LY  FQW ++ + ++++L I+N++DL+ R+L   + ++    +L FEPY+   +V+I+  +M  +E  +  D KAIEL ARKVAAMSGD R AL I ++    +  +D K+    +N       +I  +YSSP+  A
Sbjct:  175 RREEFDSLKLWIMKSKETNTSLSIYVSGQPGTGKTATT---MRVLKSLGKSVRSCIVNCASTNTKSALFKTIFESLDLD--------GKPNEEIFEKHVK-QFKTPLVLVLDEIDHLANRKNAALYAAFQWPETLSRKIIILGIANSIDLTERLLPKLMLAK-PPKRLVFEPYTKDDIVEILNDKMKNEETSI--DAKAIELTARKVAAMSGDLRTALHIFKQQKSRMIPDDSKVPGTPVNGCREVLGIINNVYSSPLARA 420          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Fly
Match: Orc1 (gene:FBgn0286788 transcript:FBtr0088959)

HSP 1 Score: 270.781 bits (691), Expect = 3.659e-80
Identity = 152/371 (40.97%), Postives = 221/371 (59.57%), Query Frame = 2
Query:  530 VTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKED--KKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            + R +LHV  +P++ PCRE EF NIY FL   +      CM++SGVPGTGKTATV G I  L+          F  + IN M ++EP+Q Y++IY+ L    V   +A A LE+  F+T A  R+ +  ++++DE+D LC ++QDV+Y +  W   S ++LV++TI+NTMDL  R+L  KVTSRLG+++L F+PYS +QL +IV AR+   E    F  +A++LVARKVAA+SGDARRALDICRRA  +      K + +  +   + EM +S  + AIR  CS  E++FL+A+ A     G EE T   V  Q++ +     V      +   +   LGA +L+  +   ND+  K+ L  S  DI +AL
Sbjct:  554 LAREQLHVSVVPKSLPCREREFENIYAFLEGKIQDQCGGCMYVSGVPGTGKTATVTGVIRTLQRMAKQNELPAFEYLEINGMRLTEPRQAYVQIYKQLTGKTVSWEQAHALLEKR-FTTPAPRRVTT--VLLVDELDILCNRRQDVVYNLLDWPTKSAAKLVVVTIANTMDLPERLLMGKVTSRLGLTRLTFQPYSHKQLQEIVTARLGGSET---FKGEAVQLVARKVAAVSGDARRALDICRRATEIADTAAVKCVTMLHVQQALAEMIASAKVQAIRN-CSRMEQIFLQAIAAEVTRTGVEETTFMGVYQQVETIAAFMGVTFPPPGRALRLCSKLGAERLIISEHSRNDLFQKILLNVSADDIHYAL 917          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Fly
Match: Cdc6 (gene:FBgn0035918 transcript:FBtr0076647)

HSP 1 Score: 145.976 bits (367), Expect = 6.662e-37
Identity = 100/296 (33.78%), Postives = 161/296 (54.39%), Query Frame = 2
Query:  431 KPALKR-NKNYLKPRKSISVPTRSRLEELTDPS----AVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQAL------FTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISK--LAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKK 1279
            KP  K+ NKN  K + +I     ++   L  PS       R  L+     +N P RE +   +  F  ++L   TS  +++SG PGTGKTA +   + R  +     ++V+IN   ++    VY ++   L       T + H    + A++R L +     RM   +L+V+DEIDQLC  +Q+VLY IF+W     SR++L+ I+N++DL+ R L  ++ +R  +    + F PYS QQ+V+I  +R+   E+   F P  ++L+A KV+A+SGD RRALDI RR V + ++ K+
Sbjct:  216 KPPTKQPNKNQTKEKSNIQTNEETQQNNLPSPSRNKYQNARRVLNSAET-QNLPGRESQLQELREFFSNHLESQTSGSLYVSGQPGTGKTACL-SLLLRDPDFSKRLQRVYINCTSIASVGAVYKKLCTELQLKVSGRTERDH----LEAIQRHLKTA---KRM---LLLVLDEIDQLCTSRQEVLYTIFEWPALPGSRILLVGIANSLDLTDRAL-MRLNARCELKPRLMHFPPYSKQQIVEIFKSRLAEAEVLDVFPPVTLQLLAAKVSAISGDVRRALDIGRRVVEIAEQQKR 498          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Match: orc1 (origin recognition complex, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6960])

HSP 1 Score: 271.552 bits (693), Expect = 9.849e-81
Identity = 160/411 (38.93%), Postives = 244/411 (59.37%), Query Frame = 2
Query:  434 PALKRNKNYLKPRKSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL-------QKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            P+  R   +  P    S+P  SR      P  V    R +LHV ++PE+ PCRE+EF +IYNF+   +   T  CM+ISGVPGTGKTATV   I  L+++        F  + IN M +++P Q Y++I Q L   K  ++ A A LE+      A A  +   ++++DE+D L  +KQ+V+Y +F W    N+RLV+LTI+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F+  A++LV+RKVAA+SGDARR LDICRRA  +       QK    + ++ +   + EM+SS  I AIR   S  E+L L+A++A F+  G EEAT Q V +Q   +C+ E +  ++ S+   +   LG+ +LL  +    D+ L++RL  S  D+L+AL
Sbjct:  473 PSTPRTPRHATP----SIP--SRTAPARKPGNVLEEARARLHVSAVPESLPCREQEFQDIYNFVESKVIDGTGGCMYISGVPGTGKTATVHEVIRSLQQSAEQDEIPHFNFIEINGMKMTDPHQAYVQILQKLTDQKATSDHAAALLEKRF---SAPAPKKETTVLLVDELDLLWTRKQNVMYNLFDWPTRRNARLVVLTIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNRVKA---FEEDALQLVSRKVAALSGDARRCLDICRRATEICEHSGNQQKGSGLVGMSHVMEALDEMFSSSYIAAIRS-ASVQEQLLLRAVIAEFRRLGLEEATFQQVFVQHQALCRVEGLQPVSVSEGLLVCQRLGSCRLLLLEGSRLDLFLRIRLNVSQDDVLYAL 870          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Match: orc1 (origin recognition complex, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6960])

HSP 1 Score: 271.552 bits (693), Expect = 1.026e-80
Identity = 160/411 (38.93%), Postives = 244/411 (59.37%), Query Frame = 2
Query:  434 PALKRNKNYLKPRKSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL-------QKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            P+  R   +  P    S+P  SR      P  V    R +LHV ++PE+ PCRE+EF +IYNF+   +   T  CM+ISGVPGTGKTATV   I  L+++        F  + IN M +++P Q Y++I Q L   K  ++ A A LE+      A A  +   ++++DE+D L  +KQ+V+Y +F W    N+RLV+LTI+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F+  A++LV+RKVAA+SGDARR LDICRRA  +       QK    + ++ +   + EM+SS  I AIR   S  E+L L+A++A F+  G EEAT Q V +Q   +C+ E +  ++ S+   +   LG+ +LL  +    D+ L++RL  S  D+L+AL
Sbjct:  473 PSTPRTPRHATP----SIP--SRTAPARKPGNVLEEARARLHVSAVPESLPCREQEFQDIYNFVESKVIDGTGGCMYISGVPGTGKTATVHEVIRSLQQSAEQDEIPHFNFIEINGMKMTDPHQAYVQILQKLTDQKATSDHAAALLEKRF---SAPAPKKETTVLLVDELDLLWTRKQNVMYNLFDWPTRRNARLVVLTIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNRVKA---FEEDALQLVSRKVAALSGDARRCLDICRRATEICEHSGNQQKGSGLVGMSHVMEALDEMFSSSYIAAIR-SASVQEQLLLRAVIAEFRRLGLEEATFQQVFVQHQALCRVEGLQPVSVSEGLLVCQRLGSCRLLLLEGSRLDLFLRIRLNVSQDDVLYAL 870          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Match: orc1 (origin recognition complex, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6960])

HSP 1 Score: 271.552 bits (693), Expect = 1.724e-80
Identity = 160/411 (38.93%), Postives = 244/411 (59.37%), Query Frame = 2
Query:  434 PALKRNKNYLKPRKSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL-------QKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            P+  R   +  P    S+P  SR      P  V    R +LHV ++PE+ PCRE+EF +IYNF+   +   T  CM+ISGVPGTGKTATV   I  L+++        F  + IN M +++P Q Y++I Q L   K  ++ A A LE+      A A  +   ++++DE+D L  +KQ+V+Y +F W    N+RLV+LTI+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F+  A++LV+RKVAA+SGDARR LDICRRA  +       QK    + ++ +   + EM+SS  I AIR   S  E+L L+A++A F+  G EEAT Q V +Q   +C+ E +  ++ S+   +   LG+ +LL  +    D+ L++RL  S  D+L+AL
Sbjct:  512 PSTPRTPRHATP----SIP--SRTAPARKPGNVLEEARARLHVSAVPESLPCREQEFQDIYNFVESKVIDGTGGCMYISGVPGTGKTATVHEVIRSLQQSAEQDEIPHFNFIEINGMKMTDPHQAYVQILQKLTDQKATSDHAAALLEKRF---SAPAPKKETTVLLVDELDLLWTRKQNVMYNLFDWPTRRNARLVVLTIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNRVKA---FEEDALQLVSRKVAALSGDARRCLDICRRATEICEHSGNQQKGSGLVGMSHVMEALDEMFSSSYIAAIR-SASVQEQLLLRAVIAEFRRLGLEEATFQQVFVQHQALCRVEGLQPVSVSEGLLVCQRLGSCRLLLLEGSRLDLFLRIRLNVSQDDVLYAL 909          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Match: orc1 (origin recognition complex, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6960])

HSP 1 Score: 271.552 bits (693), Expect = 1.800e-80
Identity = 160/411 (38.93%), Postives = 244/411 (59.37%), Query Frame = 2
Query:  434 PALKRNKNYLKPRKSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL-------QKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            P+  R   +  P    S+P  SR      P  V    R +LHV ++PE+ PCRE+EF +IYNF+   +   T  CM+ISGVPGTGKTATV   I  L+++        F  + IN M +++P Q Y++I Q L   K  ++ A A LE+      A A  +   ++++DE+D L  +KQ+V+Y +F W    N+RLV+LTI+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F+  A++LV+RKVAA+SGDARR LDICRRA  +       QK    + ++ +   + EM+SS  I AIR   S  E+L L+A++A F+  G EEAT Q V +Q   +C+ E +  ++ S+   +   LG+ +LL  +    D+ L++RL  S  D+L+AL
Sbjct:  510 PSTPRTPRHATP----SIP--SRTAPARKPGNVLEEARARLHVSAVPESLPCREQEFQDIYNFVESKVIDGTGGCMYISGVPGTGKTATVHEVIRSLQQSAEQDEIPHFNFIEINGMKMTDPHQAYVQILQKLTDQKATSDHAAALLEKRF---SAPAPKKETTVLLVDELDLLWTRKQNVMYNLFDWPTRRNARLVVLTIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNRVKA---FEEDALQLVSRKVAALSGDARRCLDICRRATEICEHSGNQQKGSGLVGMSHVMEALDEMFSSSYIAAIR-SASVQEQLLLRAVIAEFRRLGLEEATFQQVFVQHQALCRVEGLQPVSVSEGLLVCQRLGSCRLLLLEGSRLDLFLRIRLNVSQDDVLYAL 907          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Match: orc1 (origin recognition complex, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6960])

HSP 1 Score: 271.552 bits (693), Expect = 1.949e-80
Identity = 160/411 (38.93%), Postives = 244/411 (59.37%), Query Frame = 2
Query:  434 PALKRNKNYLKPRKSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL-------QKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            P+  R   +  P    S+P  SR      P  V    R +LHV ++PE+ PCRE+EF +IYNF+   +   T  CM+ISGVPGTGKTATV   I  L+++        F  + IN M +++P Q Y++I Q L   K  ++ A A LE+      A A  +   ++++DE+D L  +KQ+V+Y +F W    N+RLV+LTI+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F+  A++LV+RKVAA+SGDARR LDICRRA  +       QK    + ++ +   + EM+SS  I AIR   S  E+L L+A++A F+  G EEAT Q V +Q   +C+ E +  ++ S+   +   LG+ +LL  +    D+ L++RL  S  D+L+AL
Sbjct:  512 PSTPRTPRHATP----SIP--SRTAPARKPGNVLEEARARLHVSAVPESLPCREQEFQDIYNFVESKVIDGTGGCMYISGVPGTGKTATVHEVIRSLQQSAEQDEIPHFNFIEINGMKMTDPHQAYVQILQKLTDQKATSDHAAALLEKRF---SAPAPKKETTVLLVDELDLLWTRKQNVMYNLFDWPTRRNARLVVLTIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNRVKA---FEEDALQLVSRKVAALSGDARRCLDICRRATEICEHSGNQQKGSGLVGMSHVMEALDEMFSSSYIAAIR-SASVQEQLLLRAVIAEFRRLGLEEATFQQVFVQHQALCRVEGLQPVSVSEGLLVCQRLGSCRLLLLEGSRLDLFLRIRLNVSQDDVLYAL 909          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Match: klk1 (kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648])

HSP 1 Score: 273.092 bits (697), Expect = 1.566e-83
Identity = 158/410 (38.54%), Postives = 250/410 (60.98%), Query Frame = 2
Query:  443 KRNKNYLKPRKSIS-VPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL------QKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            +R  N   P  +   +P R+  + +  PS +    R +LHV ++PE+ PCRE+E+ ++YNF+   L   T  CM+ISGVPGTGKTATV   I  L+E+       +F+ + IN M +++P Q Y++I + L   K  A+ A A LE+  FST A  +     ++++DE+D L  +KQ+V+Y +F W    +++L++L I+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F   AI+LVARKVAA+SGDARR LDICRRA  +        +   + ++ +   ++EM+SSP + AIR   S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +     S+  A+   LGA +LL  +S  ND+ L++R+  S  DI++AL +
Sbjct:  184 ERGPNSKTPHSATPRIPERN--QPVKKPSNMLEEARIRLHVSAVPESLPCREQEYQDVYNFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRSLQESAEEEELPSFQYIEINGMKLTDPHQAYVQILKLLTGQKATADHAAALLEKR-FSTPASKK--ETTVLLVDELDLLWTRKQNVMYSLFDWPTRKHAKLIVLAIANTMDLPERIMMNRVASRLGLTRMSFQPYTHKQLQQIITSRLNHIKA---FGDDAIQLVARKVAALSGDARRCLDICRRATEICEFSCKMGDSSLVKMSHVMEALEEMFSSPYVTAIRN-SSLMEQTFLRAVIAEFRRSGLEEATFQQIYRQHVVLCRIEGLQPPLMSETMAVCHRLGASRLLLVESSRNDLHLRVRINVSQDDIMYALKE 584          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Match: klk1 (kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648])

HSP 1 Score: 272.322 bits (695), Expect = 5.434e-83
Identity = 158/410 (38.54%), Postives = 250/410 (60.98%), Query Frame = 2
Query:  443 KRNKNYLKPRKSIS-VPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL------QKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            +R  N   P  +   +P R+  + +  PS +    R +LHV ++PE+ PCRE+E+ ++YNF+   L   T  CM+ISGVPGTGKTATV   I  L+E+       +F+ + IN M +++P Q Y++I + L   K  A+ A A LE+  FST A  +     ++++DE+D L  +KQ+V+Y +F W    +++L++L I+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F   AI+LVARKVAA+SGDARR LDICRRA  +        +   + ++ +   ++EM+SSP + AIR   S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +     S+  A+   LGA +LL  +S  ND+ L++R+  S  DI++AL +
Sbjct:  219 ERGPNSKTPHSATPRIPERN--QPVKKPSNMLEEARIRLHVSAVPESLPCREQEYQDVYNFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRSLQESAEEEELPSFQYIEINGMKLTDPHQAYVQILKLLTGQKATADHAAALLEKR-FSTPASKK--ETTVLLVDELDLLWTRKQNVMYSLFDWPTRKHAKLIVLAIANTMDLPERIMMNRVASRLGLTRMSFQPYTHKQLQQIITSRLNHIKA---FGDDAIQLVARKVAALSGDARRCLDICRRATEICEFSCKMGDSSLVKMSHVMEALEEMFSSPYVTAIRN-SSLMEQTFLRAVIAEFRRSGLEEATFQQIYRQHVVLCRIEGLQPPLMSETMAVCHRLGASRLLLVESSRNDLHLRVRINVSQDDIMYALKE 619          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Match: klk1 (kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648])

HSP 1 Score: 272.707 bits (696), Expect = 6.051e-83
Identity = 151/375 (40.27%), Postives = 236/375 (62.93%), Query Frame = 2
Query:  536 RGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL------QKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            R +LHV ++PE+ PCRE+E+ ++YNF+   L   T  CM+ISGVPGTGKTATV   I  L+E+       +F+ + IN M +++P Q Y++I + L   K  A+ A A LE+  FST A  +     ++++DE+D L  +KQ+V+Y +F W    +++L++L I+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F   AI+LVARKVAA+SGDARR LDICRRA  +        +   + ++ +   ++EM+SSP + AIR   S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +     S+  A+   LGA +LL  +S  ND+ L++R+  S  DI++AL +
Sbjct:  269 RIRLHVSAVPESLPCREQEYQDVYNFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRSLQESAEEEELPSFQYIEINGMKLTDPHQAYVQILKLLTGQKATADHAAALLEKR-FSTPASKK--ETTVLLVDELDLLWTRKQNVMYSLFDWPTRKHAKLIVLAIANTMDLPERIMMNRVASRLGLTRMSFQPYTHKQLQQIITSRLNHIKA---FGDDAIQLVARKVAALSGDARRCLDICRRATEICEFSCKMGDSSLVKMSHVMEALEEMFSSPYVTAIRN-SSLMEQTFLRAVIAEFRRSGLEEATFQQIYRQHVVLCRIEGLQPPLMSETMAVCHRLGASRLLLVESSRNDLHLRVRINVSQDDIMYALKE 636          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Match: klk1 (kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648])

HSP 1 Score: 272.322 bits (695), Expect = 7.902e-83
Identity = 151/375 (40.27%), Postives = 236/375 (62.93%), Query Frame = 2
Query:  536 RGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL------QKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            R +LHV ++PE+ PCRE+E+ ++YNF+   L   T  CM+ISGVPGTGKTATV   I  L+E+       +F+ + IN M +++P Q Y++I + L   K  A+ A A LE+  FST A  +     ++++DE+D L  +KQ+V+Y +F W    +++L++L I+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F   AI+LVARKVAA+SGDARR LDICRRA  +        +   + ++ +   ++EM+SSP + AIR   S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +     S+  A+   LGA +LL  +S  ND+ L++R+  S  DI++AL +
Sbjct:  260 RIRLHVSAVPESLPCREQEYQDVYNFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRSLQESAEEEELPSFQYIEINGMKLTDPHQAYVQILKLLTGQKATADHAAALLEKR-FSTPASKK--ETTVLLVDELDLLWTRKQNVMYSLFDWPTRKHAKLIVLAIANTMDLPERIMMNRVASRLGLTRMSFQPYTHKQLQQIITSRLNHIKA---FGDDAIQLVARKVAALSGDARRCLDICRRATEICEFSCKMGDSSLVKMSHVMEALEEMFSSPYVTAIRN-SSLMEQTFLRAVIAEFRRSGLEEATFQQIYRQHVVLCRIEGLQPPLMSETMAVCHRLGASRLLLVESSRNDLHLRVRINVSQDDIMYALKE 627          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Match: klk1 (kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648])

HSP 1 Score: 271.552 bits (693), Expect = 1.050e-82
Identity = 150/373 (40.21%), Postives = 235/373 (63.00%), Query Frame = 2
Query:  542 KLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL------QKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            +LHV ++PE+ PCRE+E+ ++YNF+   L   T  CM+ISGVPGTGKTATV   I  L+E+       +F+ + IN M +++P Q Y++I + L   K  A+ A A LE+  FST A  +     ++++DE+D L  +KQ+V+Y +F W    +++L++L I+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F   AI+LVARKVAA+SGDARR LDICRRA  +        +   + ++ +   ++EM+SSP + AIR   S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +     S+  A+   LGA +LL  +S  ND+ L++R+  S  DI++AL +
Sbjct:  252 RLHVSAVPESLPCREQEYQDVYNFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRSLQESAEEEELPSFQYIEINGMKLTDPHQAYVQILKLLTGQKATADHAAALLEKR-FSTPASKK--ETTVLLVDELDLLWTRKQNVMYSLFDWPTRKHAKLIVLAIANTMDLPERIMMNRVASRLGLTRMSFQPYTHKQLQQIITSRLNHIKA---FGDDAIQLVARKVAALSGDARRCLDICRRATEICEFSCKMGDSSLVKMSHVMEALEEMFSSPYVTAIRN-SSLMEQTFLRAVIAEFRRSGLEEATFQQIYRQHVVLCRIEGLQPPLMSETMAVCHRLGASRLLLVESSRNDLHLRVRINVSQDDIMYALKE 617          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Match: Orc1 (origin recognition complex, subunit 1 [Source:MGI Symbol;Acc:MGI:1328337])

HSP 1 Score: 274.633 bits (701), Expect = 5.867e-82
Identity = 158/377 (41.91%), Postives = 233/377 (61.80%), Query Frame = 2
Query:  536 RGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLT-----FRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELR-FDPKAIELVARKVAAMSGDARRALDICRRAV-VLQKEDKKID------LASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            R +LHV ++P++ PCRE+EF +IY+F+   L   T  CM+ISGVPGTGKTATV   I  L++   T     F+ V +N M ++EP QVY++I + L   K  AN A   L ++    G++   +   ++++DE+D L   KQDV+Y +F W     + L++LTI+NTMDL  RI+  +V+SRLG+++++F+PYS  QL QI+ +R+      LR F+  AI+LVARKVAA+SGDARR LDICRRA  + +    + D      +A +   I EM+SS  I AI K  S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +P    S+  A+   LG+ +LL  +   ND+ L++RL  S  D+LFAL +
Sbjct:  471 RLRLHVSAVPDSLPCREQEFQDIYSFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRCLQQAAETDDVPPFQYVEVNGMKLTEPHQVYVQILKKLTGQKATANHAAELLAKQFCGQGSQ---KETTVLLVDELDLLWTHKQDVMYNLFDWPTHKGAHLIVLTIANTMDLPERIMMNRVSSRLGLTRMSFQPYSHSQLKQILVSRLR----NLRAFEDDAIQLVARKVAALSGDARRCLDICRRATEICELSHLRGDSLSLVTVAHLMEAIDEMFSSSYITAI-KNSSVVEQSFLRAIIAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSRLGSCRLLLVEPSRNDLLLRVRLNVSQNDVLFALKE 839          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Match: Cdc6 (cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1345150])

HSP 1 Score: 160.229 bits (404), Expect = 4.133e-42
Identity = 104/359 (28.97%), Postives = 185/359 (51.53%), Query Frame = 2
Query:  557 SIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKV---HANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRIL-QYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKED----------------------KKIDLASINAVIKEMYSSPIIIA---IRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLA 1546
            ++P+  P RE+E   I NFL +++    +  +++SG PGTGKTA +   +   ++    F+ + +N M +   Q V+  I Q +   ++        +  LE+ L  T  +  M   +++V+DE+DQL  K QDVLY +F+W   SNSRLVL+ I+NT+DL+ RIL + +         L F PY+  Q+  I+  R++    +   D  AI+  ARKV+A+SGD R+ALD+CRRA+ + + D                      K++ LA I+ VI E+  + + ++    +      +K+ + +L+   +    +E TL  +     ++C+ + V  ++ S+  ++ G L +  L+ 
Sbjct:  169 AVPDRLPAREQEMGVIRNFLKEHICGKKAGSLYLSGAPGTGKTACLSRILQDFKKEVKGFKSILLNCMSLRSAQAVFPAIAQEIGREELCRPAGKDLMRKLEKHL--TAEKGPM---IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSRLVLIGIANTLDLTDRILPRLEARENCKPQLLNFPPYTRNQIAAILQDRLSQVSKDQVLDSAAIQFCARKVSAVSGDIRKALDVCRRAIEIVESDVRSQTVLKPLSECKSPSESPVPKRVGLAHISQVISEVDGNRVTLSQENTQDSLPLQQKILVCSLLLLTRRLKIKEVTLGKLYEAYSSICRKQQVTAVDQSECLSLSGLLESRGLVG 522          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Match: Cdc6 (cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1345150])

HSP 1 Score: 160.614 bits (405), Expect = 4.776e-42
Identity = 104/359 (28.97%), Postives = 185/359 (51.53%), Query Frame = 2
Query:  557 SIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKV---HANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRIL-QYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKED----------------------KKIDLASINAVIKEMYSSPIIIA---IRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLA 1546
            ++P+  P RE+E   I NFL +++    +  +++SG PGTGKTA +   +   ++    F+ + +N M +   Q V+  I Q +   ++        +  LE+ L  T  +  M   +++V+DE+DQL  K QDVLY +F+W   SNSRLVL+ I+NT+DL+ RIL + +         L F PY+  Q+  I+  R++    +   D  AI+  ARKV+A+SGD R+ALD+CRRA+ + + D                      K++ LA I+ VI E+  + + ++    +      +K+ + +L+   +    +E TL  +     ++C+ + V  ++ S+  ++ G L +  L+ 
Sbjct:  196 AVPDRLPAREQEMGVIRNFLKEHICGKKAGSLYLSGAPGTGKTACLSRILQDFKKEVKGFKSILLNCMSLRSAQAVFPAIAQEIGREELCRPAGKDLMRKLEKHL--TAEKGPM---IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSRLVLIGIANTLDLTDRILPRLEARENCKPQLLNFPPYTRNQIAAILQDRLSQVSKDQVLDSAAIQFCARKVSAVSGDIRKALDVCRRAIEIVESDVRSQTVLKPLSECKSPSESPVPKRVGLAHISQVISEVDGNRVTLSQENTQDSLPLQQKILVCSLLLLTRRLKIKEVTLGKLYEAYSSICRKQQVTAVDQSECLSLSGLLESRGLVG 549          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Match: Cdc6 (cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1345150])

HSP 1 Score: 151.369 bits (381), Expect = 7.292e-40
Identity = 87/243 (35.80%), Postives = 139/243 (57.20%), Query Frame = 2
Query:  557 SIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKV---HANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRIL-QYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKED 1273
            ++P+  P RE+E   I NFL +++    +  +++SG PGTGKTA +   +   +E    F+ + +N M +   Q V+  I Q +   ++        +  LE+ L  T  +  M   +++V+DE+DQL  K QDVLY +F+W   SNSRLVL+ I+NT+DL+ RIL + +         L F PY+  Q+  I+  R++    +   D  AI+  ARKV+A+SGD R+ALD+CRRA+ + + D
Sbjct:  169 AVPDRLPAREQEMGVIRNFLKEHICGKKAGSLYLSGAPGTGKTACLSRILQDFKEVK-GFKSILLNCMSLRSAQAVFPAIAQEIGREELCRPAGKDLMRKLEKHL--TAEKGPM---IVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSRLVLIGIANTLDLTDRILPRLEARENCKPQLLNFPPYTRNQIAAILQDRLSQVSKDQVLDSAAIQFCARKVSAVSGDIRKALDVCRRAIEIVESD 405          
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q80Z32|ORC1_RAT (Origin recognition complex subunit 1 OS=Rattus norvegicus OX=10116 GN=Orc1 PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 1.523e-84
Identity = 170/412 (41.26%), Postives = 252/412 (61.17%), Query Frame = 2
Query:  443 KRNKNYLKPRKSI-SVPT-RSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLT-----FRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRA-----VVLQKEDKK--IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            K  K   +PR  + + P  R R   + +P++V    R +LHV ++P++ PCRE+EF +IY+F+   L   T  CM+ISGVPGTGKTATV   I  L++   T     F  V +N M ++EP QVY++I Q L   K  AN A   L ++  S G++   +   ++++DE+D L   KQDVLY +F W     +RLV+LTI+NTMDL  RI+  +V SRLG+++++F+PYS  QL QI+ +R+  + L+  F+  A++LVARKVAA+SGDARR LDICRRA     V  Q+ D +  + +A +   I EM+SS  I AI K  S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +P    S+  A+   LG+ ++L  +   ND+ L++RL  S  D+L+AL +
Sbjct:  443 KSPKKTFRPRPPLHATPQIRDRNLAVQEPASVLEEARLRLHVSAVPDSLPCREQEFQDIYSFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRCLQQAAQTNDVPPFEYVEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCSRGSQ---KETTVLLVDELDLLWTHKQDVLYNLFDWPTHKGARLVVLTIANTMDLPERIMMNRVASRLGLTRMSFQPYSHSQLKQILVSRL--KHLKA-FEDDAVQLVARKVAALSGDARRCLDICRRATEICEVSHQRGDSQCLVTVAHLMEAIDEMFSSSYITAI-KNSSVLEQSFLRAIIAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSRLGSCRILLVEPSRNDLLLRVRLNVSQNDVLYALKE 847          
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q9JI69|ORC1_CRIGR (Origin recognition complex subunit 1 OS=Cricetulus griseus OX=10029 GN=ORC1 PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 3.153e-84
Identity = 167/418 (39.95%), Postives = 253/418 (60.53%), Query Frame = 2
Query:  428 TKPALKRNKNYLKPRKSISVPT---RSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLT-----FRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKK-------IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            +KP+L+       P+K+   PT   R R   + +P++V    R  LHV ++P++ PCRE+EF +IY+F+   L   T  CM+ISGVPGTGKTATV+  I  L++   T     F  V +N M ++EP QVY++I Q L   K  AN A   L +   S G++       ++++DE+D L   KQDV+Y +F W     +RL++L I+NTMDL  RI+  +V+SRLG+++++F+PYS  QL +I+ +R+  + L+  F+  AI+LVARKVAA+SGDARR LDICRRA  + +           + ++ +   I EM+SS  I AI K CS  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +P    S+  A+  +LG+ +LL  +   ND+ L++RL  S  D+L+AL +
Sbjct:  441 SKPSLQTPSK--TPKKTTHHPTPQIRGRNIAVQEPTSVLEEARLMLHVSAVPDSLPCREQEFQDIYSFVESKLLDGTGGCMYISGVPGTGKTATVNEVIRCLQQAAQTNDVPPFEYVDVNGMKLTEPHQVYVQILQKLTGQKATANHAAQLLAKRFCSQGSQQET---TVLLVDELDLLWTSKQDVMYNLFDWPTHKGARLIVLAIANTMDLPERIMMNRVSSRLGLTRMSFQPYSHNQLKEILVSRL--KHLKA-FEDDAIQLVARKVAALSGDARRCLDICRRATEICELSHNHGNSLGPVTVSHLMEAIDEMFSSSYITAI-KNCSLLEQGFLRAIIAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSNLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKE 849          
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q13415|ORC1_HUMAN (Origin recognition complex subunit 1 OS=Homo sapiens OX=9606 GN=ORC1 PE=1 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 8.166e-84
Identity = 168/409 (41.08%), Postives = 246/409 (60.15%), Query Frame = 2
Query:  452 KNYLKPR--KSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLT-----FRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL-----QKEDKK--IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            K  LKPR  +  +   RSR     +P++V    R +LHV ++PE+ PCRE+EF +IYNF+   L   T  CM+ISGVPGTGKTATV   I  L++         F+ + +N M ++EP QVY++I Q L   K  AN A   L ++  + G+        ++++DE+D L   KQD++Y +F W     +RLV+L I+NTMDL  RI+  +V+SRLG++++ F+PY+  QL QI+ +R+  + L+  F+  AI+LVARKVAA+SGDARR LDICRRA  +     QK D    + +A     + EM+SS  I AI K  S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +P    S+  A+   LG+ +LL  +   ND+ L++RL  S  D+L+AL D
Sbjct:  459 KKSLKPRTPRCAAPQIRSRSLAAQEPASVLEEARLRLHVSAVPESLPCREQEFQDIYNFVESKLLDHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQET---TVLLVDELDLLWTHKQDIMYNLFDWPTHKEARLVVLAIANTMDLPERIMMNRVSSRLGLTRMCFQPYTYSQLQQILRSRL--KHLKA-FEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSQQKPDSPGLVTIAHSMEAVDEMFSSSYITAI-KNSSVLEQSFLRAILAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYALKD 860          
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q58DC8|ORC1_BOVIN (Origin recognition complex subunit 1 OS=Bos taurus OX=9913 GN=ORC1 PE=2 SV=2)

HSP 1 Score: 281.182 bits (718), Expect = 1.948e-83
Identity = 161/376 (42.82%), Postives = 231/376 (61.44%), Query Frame = 2
Query:  536 RGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLT-----FRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL-----QKEDKK--IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            R +LHV ++PE+ PCRE+EF +IYNF+   L   T  CM+ISGVPGTGKTATV   I  L++         F+ + +N M ++EP QVY++I Q L   +  AN A A L +   + G+        ++++DE+D L  +KQDV+Y +F W     +RLV+LTI+NTMDL  RI+  +V+SRLG++++ F+PY+  QL QI+ +R+   +    F+  AI+LVARKVAA+SGDARR LDICRRA  +     QK D    +  A +   I EM+SS  I AI K  S  E+ FL+A++A F+  G EEAT Q V IQ   +C+ E +P    S+  A+   LGA +LL  +   ND+  ++RL  S  D+L+AL +
Sbjct:  494 RLRLHVAAVPESLPCREQEFQDIYNFVESKLLDQTGGCMYISGVPGTGKTATVHEVICCLQQAAQANEVPPFQYIEVNGMKLTEPHQVYVQILQKLTGKRATANHAAALLAKRFCTQGSSQET---TVLLVDELDLLWTQKQDVMYNLFDWPTHKEARLVVLTIANTMDLPERIMMNRVSSRLGLTRMCFQPYTHSQLRQILLSRLRHVKA---FEDDAIQLVARKVAALSGDARRCLDICRRATEICEFSCQKPDSPGLVTTAHLLEAIDEMFSSSYITAI-KNSSVLEQSFLRAILAEFRRSGLEEATFQQVYIQHVALCRMEGLPYPTMSETMAVCSRLGACRLLLVEPSRNDVLRRVRLNVSQDDVLYALKE 862          
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q9Z1N2|ORC1_MOUSE (Origin recognition complex subunit 1 OS=Mus musculus OX=10090 GN=Orc1 PE=1 SV=2)

HSP 1 Score: 274.633 bits (701), Expect = 4.104e-81
Identity = 158/377 (41.91%), Postives = 233/377 (61.80%), Query Frame = 2
Query:  536 RGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLT-----FRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELR-FDPKAIELVARKVAAMSGDARRALDICRRAV-VLQKEDKKID------LASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            R +LHV ++P++ PCRE+EF +IY+F+   L   T  CM+ISGVPGTGKTATV   I  L++   T     F+ V +N M ++EP QVY++I + L   K  AN A   L ++    G++   +   ++++DE+D L   KQDV+Y +F W     + L++LTI+NTMDL  RI+  +V+SRLG+++++F+PYS  QL QI+ +R+      LR F+  AI+LVARKVAA+SGDARR LDICRRA  + +    + D      +A +   I EM+SS  I AI K  S  E+ FL+A++A F+  G EEAT Q +  Q   +C+ E +P    S+  A+   LG+ +LL  +   ND+ L++RL  S  D+LFAL +
Sbjct:  471 RLRLHVSAVPDSLPCREQEFQDIYSFVESKLLDGTGGCMYISGVPGTGKTATVHEVIRCLQQAAETDDVPPFQYVEVNGMKLTEPHQVYVQILKKLTGQKATANHAAELLAKQFCGQGSQ---KETTVLLVDELDLLWTHKQDVMYNLFDWPTHKGAHLIVLTIANTMDLPERIMMNRVSSRLGLTRMSFQPYSHSQLKQILVSRLR----NLRAFEDDAIQLVARKVAALSGDARRCLDICRRATEICELSHLRGDSLSLVTVAHLMEAIDEMFSSSYITAI-KNSSVVEQSFLRAIIAEFRRSGLEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSRLGSCRLLLVEPSRNDLLLRVRLNVSQNDVLFALKE 839          
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Match: A0A074ZP46 (Origin recognition complex subunit 1 OS=Opisthorchis viverrini OX=6198 GN=T265_04361 PE=3 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 2.582e-102
Identity = 181/412 (43.93%), Postives = 252/412 (61.17%), Query Frame = 2
Query:  425 ITKPALKRNKNYLKPRKSISVPTRSRLEELTDPSAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDG---AISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRS-----PVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSR--LVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRA---VVLQKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            I KP      N L P+++ SVP R     +T  +    G        E+ P RE+EF +IY F+   L + T  CM+ISG+PGTGKTA+V+    A++ + +   TF+K+ +N M V++P+QVY +I Q L    + A +A   LERE  S+G R   R      PV++VIDE+D LC ++QDVLY +F W      R  L++L I+NTMDL  R+L  +V SRLG+++L F PYS +QLV IV +R+        F  KA+EL ARKVAA+SGD RRALDICRRA   V   K  K+I +  INA +KEM+++P + AI + CS YEKLFL+AL+A F+A+  EEA L   ++Q+  +C+ E  P    S++F I  SLGA+KLL  +    D  + +RL CS  D+LFAL
Sbjct:   68 IAKP-----PNSLLPKRTFSVPARKHTAVMTSANTAVVG--------ESLPGREQEFDSIYTFISGKLLQGTGGCMYISGLPGTGKTASVNAVLAAMTDVRDQRATFQKITVNGMQVNDPKQVYAQILQQLTGQLLPAKQAAQQLEREFCSSGLRQSHREKSNLPPVVLVIDELDLLCTRRQDVLYNLFDWPTRPRGRRSLIVLAIANTMDLPERLLHPRVASRLGLTRLTFAPYSHEQLVHIVQSRLIGSGSS-SFQEKALELAARKVAAVSGDVRRALDICRRAAEMVPQSKSKKEIGIEHINAALKEMFTTPKLCAI-QACSLYEKLFLRALIAEFQARSTEEARLDRCILQMCALCRLEGFPCPTTSEVFDICSSLGAHKLLLTEPSRRDTSMLVRLNCSKSDVLFAL 464          
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Match: A0A3R7GUT9 (Cell division control protein OS=Clonorchis sinensis OX=79923 GN=ORC1 PE=3 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 2.520e-101
Identity = 181/412 (43.93%), Postives = 253/412 (61.41%), Query Frame = 2
Query:  425 ITKPALKRNKNYLKPRKSISVPTRSRLEELTDPSAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDG---AISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRS-----PVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSR--LVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRA---VVLQKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            +TKP      N L P+++ SVP R     +T  + V  G        E+ P RE+EF +IY F+   L + T  CM+ISG+PGTGKTA+V+    A++ + +   TF+K+ +N M V++P+QVY +I Q L    + A +A   LERE  S+G     R      PV++VIDE+D LC ++QDVLY +F W      R  L++L I+NTMDL  R+L  +V SRLG+++L F PYS +QLV IV +R+        F  KA+EL ARKVAA+SGD RRALDICRRA   V   K  K+I +  INA +KEM+++P + AI + CS YEKLFL+AL+A F+A+  EEA L   ++Q+  +C+ E  P    S++F I  SLGA+KLL  +    D  + +RL CS  D+LFAL
Sbjct:  166 VTKPP-----NSLLPKRTFSVPARKHTGIMTSANTVVVG--------ESLPGREQEFDSIYTFISGKLLQGTGGCMYISGLPGTGKTASVNAVLAAMTDVRDQRATFQKITVNGMQVNDPKQVYAQILQQLTGQLLPAKQAAQQLEREFCSSGLSQSHREKSNLPPVVLVIDELDLLCTRRQDVLYNLFDWPTRPRGRRSLIVLAIANTMDLPERLLHPRVASRLGLTRLTFAPYSHEQLVHIVQSRLIGSGSS-SFQEKALELAARKVAAVSGDVRRALDICRRAAEMVPQSKSKKEIGIEHINAALKEMFTTPKLCAI-QACSLYEKLFLRALIAEFQARSTEEARLDRCILQMCALCRLEGFPCPTTSEVFDICSSLGAHKLLLTEPSRRDTSMLVRLNCSKSDVLFAL 562          
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Match: A0A183P0K1 (Origin recognition complex subunit 1 OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS7887 PE=3 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 7.110e-99
Identity = 176/396 (44.44%), Postives = 249/396 (62.88%), Query Frame = 2
Query:  524 SAVTRGK--LHVGSIPENF---PCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLE----ETGL-----TFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRS-----PVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSR--LVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAV----VLQKEDKKIDLASINAVIKEMYSSPIIIAIRKC-CSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDDAP 1633
            S V+RG+  L++ S    +   P RE+EF NIY F+ + LS+ +  CM+ISG+PGTGKTA+V   +S +     ++GL     TF+ +++N M VS+P+QVY+ IY+ L      A  A   LE+E F    +    S     PV++VIDE+D LC ++QD+LY +F W    N+   L++L I+NTMDL  R+L  +V SRLG+++L F PYS +QL QIV  R     L   F PKA+EL ARKVAA+SGD RRALDIC+RA      + K +K+ID++ INA +KEM+++P   AI  C CS YEKLFL+A++A F+A   EEA L   + Q+  +C+ E VP    S++FAI  SLGA+KLL  +    DI + +RL C+  DIL+ L+  P
Sbjct:   15 SQVSRGESFLNLSSTNSEYGWLPGREQEFENIYTFILNKLSQNSGGCMYISGIPGTGKTASVQAVLSTMHKLVADSGLESQIPTFQVIYVNGMRVSDPKQVYVEIYEQLTGLTATAKCASDLLEKEFFHNVIKKVSHSKVSEKPVVLVIDELDLLCTRRQDILYSLFDWPTRHNNHRVLIVLAIANTMDLPERLLHPRVASRLGLTRLTFAPYSHEQLAQIV--RHHLSSLSNMFQPKALELAARKVAAVSGDVRRALDICKRAAEIVSCIGKGNKEIDISHINAALKEMFTTPKSEAI--CACSLYEKLFLRAVIAEFQAHSTEEARLDRCIRQMFALCRLEGVPCPTTSEVFAICASLGAHKLLLTERSRCDISMLVRLNCTKSDILYCLNQQP 406          
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Match: A0A095C746 (Origin recognition complex subunit 1 OS=Schistosoma haematobium OX=6185 GN=MS3_06272 PE=3 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 4.003e-96
Identity = 174/397 (43.83%), Postives = 251/397 (63.22%), Query Frame = 2
Query:  521 PSAVTRGK--LHVGSIPENF---PCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLE----ETGL-----TFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRS-----PVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSR--LVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAV----VLQKEDKKIDLASINAVIKEMYSSPIIIAIRKC-CSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDDAP 1633
            PS V+RG+  L++ S    +   P RE+EF NIY F+ + LS+ +  CM+ISG+PGTGKTA+V   +S +     ++GL     TF+ +++N M VS+P+QVY+ IY+ L      A  A   LE+E      +    S     PV++VIDE+D LC ++Q++LY +F W    N+   L++L I+NTMDL  R+L  +V SRLG+++L F PYS +QL QIV   ++   L   F PKA+EL ARKVAA+SGD RRALDIC+RA      + K +K+ID++ INA +KEM+++P   AI  C CS YEKLFL+A++A F+A+  EEA L   + Q+  +C+ E VP    S++FAI  SLGA+KLL  +    DI + +RL C+  DIL+ L+  P
Sbjct:  185 PSQVSRGESFLNLSSTNSEYGWLPGREQEFENIYTFILNKLSQNSGGCMYISGIPGTGKTASVQAVLSTMHKLVADSGLESQIPTFQVIYVNGMRVSDPKQVYVEIYEQLTGLTATAKCASDLLEKEFCHNVIKKVSHSKVSEKPVVLVIDELDLLCTRRQNILYSLFDWPTRHNNHRVLIVLAIANTMDLPERLLHPRVASRLGLTRLTFAPYSHEQLAQIVRHHLS--SLSNMFQPKALELAARKVAAVSGDVRRALDICKRAAEIVSSIGKGNKEIDISHINAALKEMFTTPKSEAI--CACSLYEKLFLRAVIAEFQARSTEEARLDRCIRQMFALCRLEGVPCPTTSEVFAICASLGAHKLLLTERSRCDISMLVRLNCTKSDILYCLNQQP 577          
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Match: A0A183LHH0 (Origin recognition complex subunit 1 OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS3245 PE=3 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 7.372e-96
Identity = 166/374 (44.39%), Postives = 237/374 (63.37%), Query Frame = 2
Query:  572 FPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLE----ETGL-----TFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRS-----PVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSR--LVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAV----VLQKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDDAP 1633
             P RE+EF NIY F+ + LS+ +  CM+ISG+PGTGKTA+V   +S +     ++GL     TF+ +++N M VS+P+QVY+ IY+ L      A  A   LE+E      +    S     PV++VIDE+D LC ++QD+LY +F W    N+   L++L I+NTMDL  R+L  +V SRLG+++L F PYS +QL QIV   ++   L   F PKA+EL ARKVAA+SGD RRALDIC+RA      + K +K+ID++ INA +KEM+++P   AI  C S YEKLFL+A++A F+ +  EEA L   + Q+  +C+ E VP    S++FAI  SLGA+KLL  +    DI + +RL C+  DIL+ L+  P
Sbjct:   27 LPGREQEFENIYTFILNKLSQNSGGCMYISGIPGTGKTASVQAVLSTMHKLVADSGLESQIPTFQVIYVNGMRVSDPKQVYVEIYEQLTGLTATAKCASDLLEKEFCHNVIKKVSHSKVSEKPVVLVIDELDLLCTRRQDILYSLFDWPTRHNNHRVLIVLAIANTMDLPERLLHPRVASRLGLTRLTFAPYSHEQLAQIVRHHLS--SLSNMFQPKALELAARKVAAVSGDVRRALDICKRAAEIVSSIGKGNKEIDISHINAALKEMFTTPKSEAICAC-SLYEKLFLRAVIAEFQTRSTEEARLDRCIRQMFALCRLEGVPCPTTSEVFAICASLGAHKLLLTERSRCDISMLVRLNCTKSDILYCLNQQP 397          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Cavefish
Match: orc1 (origin recognition complex, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6960])

HSP 1 Score: 264.233 bits (674), Expect = 2.167e-78
Identity = 155/373 (41.55%), Postives = 235/373 (63.00%), Query Frame = 2
Query:  536 RGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKK------IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            R +LHV S+PE+ PCRE+EF +IYNF+   +   T  CM+ISGVPGTGKTATV   I  L++         F  + IN M +++P Q Y++I Q L   K  A+ A A LE+  FS  A  +     ++++DE+D L  +KQ+V+Y +F W    ++RLV+LTI+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F+  A++LV+RKVAA+SGDARR LDICRRA  + +   +      + ++ +   + EM+SS  I AIR C S  E+LFL+A++A F+  G EEAT Q V +Q   +C+ E +  ++ S+  A+   LGA +LL  +    D+ L++RL  S  D+L+AL
Sbjct:  446 RLRLHVSSVPESLPCREQEFQDIYNFVESKVMDGTGGCMYISGVPGTGKTATVHEVIRSLQQAAEQDEIPHFNFIEINGMKMTDPHQAYVQILQKLTNQKATADHAAALLEKR-FSMPAPKK--ETTVLLVDELDLLWTRKQNVMYNLFDWPTRRHARLVVLTIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNKVKA---FEEDALQLVSRKVAALSGDARRCLDICRRATEICEYSSQRSSTGLVGMSHVMEALDEMFSSSYIAAIR-CTSLQEQLFLRAVIAEFRRLGLEEATFQQVFVQHQALCRMEGLQPVSVSEGLAVCQRLGACRLLLLEPSRLDLLLRVRLNVSQDDVLYAL 811          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Cavefish
Match: cdc6 (cell division cycle 6 [Source:NCBI gene;Acc:103046129])

HSP 1 Score: 156.762 bits (395), Expect = 8.544e-41
Identity = 102/253 (40.32%), Postives = 140/253 (55.34%), Query Frame = 2
Query:  545 LHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRIL---QYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKKIDLAS 1294
            LH  ++PE    RE E   I +FL +++     S ++ISG PGTGKTA ++  +   +      + V IN M +     ++  + + L TSK  +      LE+ L S+G        VL+V+DE+DQL  K QDVLY IF+W   S SRL L+ I+N +DL+ RIL   Q K   R  +  L F PYS Q+L  IV  R+     E   D  AI+  ARKV+A+SGDAR+ALDICRRAV + +   K   AS
Sbjct:  211 LHT-AVPERLLSREAERATIVSFLENHVVPGKPSSLYISGAPGTGKTACLNCVLQEQKALLKGVQTVVINCMTLRSSHSIFPLLAEKLKTSKSSSG---GKLEKLLTSSGPT------VLLVLDEMDQLDSKSQDVLYTIFEWPYLSKSRLCLIGIANALDLTDRILPRLQTKPHCRPQL--LHFPPYSRQELTAIVQDRLAQVSGEGVLDGAAIQFCARKVSAVSGDARKALDICRRAVEMVESKNKSKEAS 451          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Sea Lamprey
Match: cdc6 (cell division cycle 6 homolog (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-050506-131])

HSP 1 Score: 153.295 bits (386), Expect = 1.986e-40
Identity = 123/405 (30.37%), Postives = 194/405 (47.90%), Query Frame = 2
Query:  527 AVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALF-----TSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLA-FEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDIC-RRAV-----------VLQKED-----------------KKIDLASINAVIKEMYSSPIII-AIRKCCSF--YEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDD 1627
            A+ +  LH  + PE   CRE E   I  F+ +++       ++ISG PGTGKTA +   +  +++     R VF+N M ++  Q VY  +   L      T+ V +      LER +  +G        +++V+DE+DQL  + Q+VLY +F+W    NSRLVL+ ++N +DL+ RIL      R     L  F PYS  Q++ I+  R++  + E   DP A++  ARKV+AMSGDAR+ALD+C RRAV           VL                     +++ L  I+AV+ E+Y SP+   A     SF   +KL +  L+   ++    E T   +      +C+   +  L+ S+  A+   L A  +L   +      +K+ L     D+  AL D
Sbjct:  168 ALAKKALHTAN-PERLLCRERETAAIVAFVEEHVVARVPGSIYISGAPGTGKTACLKHILHSMKKRLSNARVVFLNCMPLTSSQAVYPAVLSKLGEAGEKTAGVGSRDHARQLERIVTKSGPM------IVLVLDEMDQLDSRAQEVLYTMFEWPALPNSRLVLIGVANALDLTDRILPRLQALRSHQPHLINFPPYSRDQILAILQDRLSGLK-EGVVDPAAVQFCARKVSAMSGDARKALDVCSRRAVEKLGGEIRKQTVLSPNGEGFLCASAGPVPTTTVPRRVTLPQISAVLSEVYGSPMASRAGDHGGSFPLQQKLLVITLLMLVRSGKVREFTFGKIHETYTGVCQRHQMARLHQSECMALCSLLEARGILTIKNSKEARLMKVSLKIDQSDVEHALQD 564          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Yeast
Match: ORC1 (Largest subunit of the origin recognition complex; involved in directing DNA replication by binding to replication origins; also involved in transcriptional silencing; exhibits ATPase activity; ORC1 has a paralog, SIR3, that arose from the whole genome duplication [Source:SGD;Acc:S000004530])

HSP 1 Score: 136.732 bits (343), Expect = 2.668e-34
Identity = 97/409 (23.72%), Postives = 178/409 (43.52%), Query Frame = 2
Query:  497 SRLEELTDPSAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGL-----TFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMT--------------------------------PQE---LELRFDPKAIELVARKVAAMSGDARRALDICRRAV----------------------------VLQKEDKK----------------------IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQL 1453
            S++++  + S V    L   +  +  P RE EF +IY   Y  +   +++ ++++G PG GKT TV   +  L  +        F  V IN + + +P   Y  ++  +   ++    ++ +LE   +        +  +++++DE+D +  K QD++Y  F W    N++L+++ ++NTMDL  R L  K+TSR+G +++ F  Y+ ++L  I+  R+                                 P++   + LR    AIE+ +RKVA++SGDARRAL +C+RA                             +   EDK                       + +  +   + E  +S +I  + +  SF  KLF+ AL+   K  G +E  L D+V ++
Sbjct:  424 SKVKKQLNSSYVKEEILKSANFQDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMESLE--FYFKRVPKNKKKTIVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVANTMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRLKGLNDSFFYVDTKTGNAILIDAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAEKHYMAKHGYGYDGKTVIEDENEEQIYDDEDKDLIESNKAKDDNDDDDDNDGVQTVHITHVMKALNETLNSHVITFMTR-LSFTAKLFIYALLNLMKKNGSQEQELGDIVDEI 829          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Yeast
Match: CDC6 (Essential ATP-binding protein required for DNA replication; component of the pre-replicative complex (pre-RC) which requires ORC to associate with chromatin and is in turn required for Mcm2-7p DNA association; homologous to S. pombe Cdc18p; relocalizes from nucleus to cytoplasm upon DNA replication stress; degraded in response to plasma membrane stress [Source:SGD;Acc:S000003730])

HSP 1 Score: 82.0333 bits (201), Expect = 5.529e-17
Identity = 70/291 (24.05%), Postives = 128/291 (43.99%), Query Frame = 2
Query:  572 FPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAI-------------------------------------SRLEETGLTFRKVFINAMHVSEPQQVYLRIYQAL--FTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQL----CKKKQDV--LYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISK------LAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKKIDLA 1291
             P R  E+  + NFL   +S   S  ++I+G PGTGKTA +D  I                                      RLE   +T     IN + + EP  ++ +I+ +           K +  L++ L         ++  ++V+DE+D+L      + Q V  + ++F   K      VL+ ++N++D+  R L     SRL + +      + F+PY+ +Q+ +IV  +M+     + F P AI+  A+K A  +GD R+  D+ R ++ + + +K+  L+
Sbjct:   78 LPARTAEYEQVMNFLAKAISEHRSDSLYITGPPGTGKTAQLDMIIRQKFQSLPLSLSTPRSKDVLRHTNPNLQNLSWFELPDGRLESVAVTS----INCISLGEPSSIFQKIFDSFQDLNGPTLQIKNMQHLQKFL----EPYHKKTTFVVVLDEMDRLLHANTSETQSVRTILELFLLAKLPTVSFVLIGMANSLDMKDRFL-----SRLNLDRGLLPQTIVFQPYTAEQMYEIVIQKMSSLP-TIIFQPMAIKFAAKKCAGNTGDLRKLFDVLRGSIEIYELEKRFLLS 354          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Nematostella
Match: EDO32960 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STK3])

HSP 1 Score: 266.544 bits (680), Expect = 1.335e-83
Identity = 158/410 (38.54%), Postives = 243/410 (59.27%), Query Frame = 2
Query:  470 RKSI------SVPTRSR-LEELTDPSAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEET-GLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFST--GARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVL----------QKEDKKIDLAS---INAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDDA 1630
            RKSI      S+P+R +  +    P    R +LHV ++P + PCRE+EF +I+ F+   L+ +   CM+ISGVPGTGKTATV   I  L E+    FR V +N M ++EP Q+Y     ++   K+   KA  A   EL      + +  R  V++++DE+D L  +KQ V+Y +F+W    +S+L++L I+NTMDL  R++  +V SRLG++++ F+PY+  QL +IV +R+  Q+L + FDP A++LVARKVAA+SGDARR LDICRRAV +           K  K + L     ++  ++EM+SSP I  +    S +E L +KA++A FK  G EEA   +V  QL N+C+ E +   + ++   I   LGA +LL  +    D + ++RL  +  D+++AL +A
Sbjct:   22 RKSIPSTCTPSMPSRQQPCKTPRTPLQEARTRLHVSAVPPSLPCREDEFSDIFGFVEGKLTDSEGGCMYISGVPGTGKTATVHEVIRLLSESIEDDFRFVELNGMKMTEPNQIY-----SMLLKKLTGQKATPAHASELLDKMFSSNSSQRDCVVLMVDELDLLWTRKQGVMYNLFEWPSRRHSKLIVLAIANTMDLPERMMINRVQSRLGLTRITFQPYTHAQLQRIVLSRI--QDLNV-FDPDAMQLVARKVAAVSGDARRCLDICRRAVEIADLQTSKKATPKSKKPLSLVGMIHVDQALQEMFSSPKIKVMMN-LSMFEGLLMKAVLAEFKRSGVEEAAFSEVYCQLGNLCRLEGLTPPSTTEASIITSRLGATRLLLVEPGRLDQQRRIRLNVNQDDVIYALRNA 422          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Nematostella
Match: EDO49496 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGA8])

HSP 1 Score: 150.984 bits (380), Expect = 2.345e-40
Identity = 101/302 (33.44%), Postives = 154/302 (50.99%), Query Frame = 2
Query:  524 SAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQAL-FTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRIL-QYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELR-FDPKAIELVARKVAAMSGDARRALDICRRAVVLQKED----------------------------KKIDLASINAVIKEMYSSPII 1336
            SAV +  LH G+ P+N  CR+ E   +  FL  ++ +     ++ISG PGTGKTA +   I  ++         FIN M +     ++ +I + L    KV    A   LER+  + G    MR   ++++DE+DQL  K +DVLY +F+W     S+LVL+ I+N +DL+ RIL + +   +     L F PY+  Q+  I+  R++  E E    D  AI+  ARKVAA++GD R+ALDICRRAV + + D                            KK+ L  I +V+ ++Y S I+
Sbjct:    5 SAVKKA-LHTGA-PDNILCRDTEIKAVTKFLEKHVQKKKPGSLYISGAPGTGKTACLTMVIRDMKVNVSDCPVTFINCMSLQHSHAIFAKIIEELGIEEKVATKDAQKVLERKFTAPGP---MR---ILILDEMDQLETKNRDVLYTMFEWPSLPKSKLVLIGIANALDLTDRILPRLQARPKCKPELLNFPPYTRNQISTILQQRISQTEGETPVLDTPAIQFCARKVAAVAGDIRKALDICRRAVEVVESDVRKQHILQPTKYENAQTQGELNSPTPTAKKVSLGHIASVVSDVYGSRIM 298          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Match: orc1 (origin recognition complex subunit 1 [Source:NCBI gene;Acc:101172891])

HSP 1 Score: 266.929 bits (681), Expect = 6.486e-79
Identity = 156/411 (37.96%), Postives = 243/411 (59.12%), Query Frame = 2
Query:  434 PALKRNKNYLKPRKSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKK-------IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            P+  R   +  P    S+P  +RL     P+ V    R +LHV ++PE+ PCRE+EF +IY+F+   +   T  CM+ISGVPGTGKTATV   +  L+          F  + IN M +++P Q Y++I Q L   K  A+ A A LE+   +   R   +   ++++DE+D L  +KQ+V+Y +F W    ++RLV+L I+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F+  A++LV+RKVAA+SGDARR LDICRRA  + +           + ++ +   + EM+SS  I AI KC S  E+LFL+A++A F+  G EEAT Q V++Q   +C+ E +  +  S+  A+   LGA +LL  +     +  ++RL  S  D+L+AL
Sbjct:  490 PSTPRTPRHATP----SIP--NRLLPTRQPANVLEEARIRLHVSAVPESLPCREQEFQDIYSFVESKILDGTGGCMYISGVPGTGKTATVHEVMRCLQHAADVDEISPFHFIEINGMKMTDPHQAYVQILQKLTGQKATADHAAALLEKRFSNPAPR---KETTVLLVDELDLLWTRKQNVMYNLFDWPSRRHARLVVLAIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNKVKA---FEEDALQLVSRKVAALSGDARRCLDICRRATEICEHSAADPSAAGLVAMSHVMEALNEMFSSAYITAI-KCASLQEQLFLRAVIAEFRRLGLEEATFQQVLVQHQALCRVEGLQPIGVSESLAVCQRLGACRLLLLEPSRLGVLQRVRLNVSQDDVLYAL 887          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Match: orc1 (origin recognition complex subunit 1 [Source:NCBI gene;Acc:101172891])

HSP 1 Score: 266.544 bits (680), Expect = 1.104e-78
Identity = 156/411 (37.96%), Postives = 243/411 (59.12%), Query Frame = 2
Query:  434 PALKRNKNYLKPRKSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKK-------IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            P+  R   +  P    S+P  +RL     P+ V    R +LHV ++PE+ PCRE+EF +IY+F+   +   T  CM+ISGVPGTGKTATV   +  L+          F  + IN M +++P Q Y++I Q L   K  A+ A A LE+   +   R   +   ++++DE+D L  +KQ+V+Y +F W    ++RLV+L I+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F+  A++LV+RKVAA+SGDARR LDICRRA  + +           + ++ +   + EM+SS  I AI KC S  E+LFL+A++A F+  G EEAT Q V++Q   +C+ E +  +  S+  A+   LGA +LL  +     +  ++RL  S  D+L+AL
Sbjct:  511 PSTPRTPRHATP----SIP--NRLLPTRQPANVLEEARIRLHVSAVPESLPCREQEFQDIYSFVESKILDGTGGCMYISGVPGTGKTATVHEVMRCLQHAADVDEISPFHFIEINGMKMTDPHQAYVQILQKLTGQKATADHAAALLEKRFSNPAPR---KETTVLLVDELDLLWTRKQNVMYNLFDWPSRRHARLVVLAIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNKVKA---FEEDALQLVSRKVAALSGDARRCLDICRRATEICEHSAADPSAAGLVAMSHVMEALNEMFSSAYITAI-KCASLQEQLFLRAVIAEFRRLGLEEATFQQVLVQHQALCRVEGLQPIGVSESLAVCQRLGACRLLLLEPSRLGVLQRVRLNVSQDDVLYAL 908          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Match: orc1 (origin recognition complex subunit 1 [Source:NCBI gene;Acc:101172891])

HSP 1 Score: 266.544 bits (680), Expect = 1.104e-78
Identity = 156/411 (37.96%), Postives = 243/411 (59.12%), Query Frame = 2
Query:  434 PALKRNKNYLKPRKSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKK-------IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            P+  R   +  P    S+P  +RL     P+ V    R +LHV ++PE+ PCRE+EF +IY+F+   +   T  CM+ISGVPGTGKTATV   +  L+          F  + IN M +++P Q Y++I Q L   K  A+ A A LE+   +   R   +   ++++DE+D L  +KQ+V+Y +F W    ++RLV+L I+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F+  A++LV+RKVAA+SGDARR LDICRRA  + +           + ++ +   + EM+SS  I AI KC S  E+LFL+A++A F+  G EEAT Q V++Q   +C+ E +  +  S+  A+   LGA +LL  +     +  ++RL  S  D+L+AL
Sbjct:  511 PSTPRTPRHATP----SIP--NRLLPTRQPANVLEEARIRLHVSAVPESLPCREQEFQDIYSFVESKILDGTGGCMYISGVPGTGKTATVHEVMRCLQHAADVDEISPFHFIEINGMKMTDPHQAYVQILQKLTGQKATADHAAALLEKRFSNPAPR---KETTVLLVDELDLLWTRKQNVMYNLFDWPSRRHARLVVLAIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNKVKA---FEEDALQLVSRKVAALSGDARRCLDICRRATEICEHSAADPSAAGLVAMSHVMEALNEMFSSAYITAI-KCASLQEQLFLRAVIAEFRRLGLEEATFQQVLVQHQALCRVEGLQPIGVSESLAVCQRLGACRLLLLEPSRLGVLQRVRLNVSQDDVLYAL 908          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Match: orc1 (origin recognition complex subunit 1 [Source:NCBI gene;Acc:101172891])

HSP 1 Score: 248.44 bits (633), Expect = 3.135e-72
Identity = 146/411 (35.52%), Postives = 225/411 (54.74%), Query Frame = 2
Query:  434 PALKRNKNYLKPRKSISVPTRSRLEELTDPSAV---TRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETG-----LTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKK-------IDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFAL 1621
            P+  R   +  P    S+P  +RL     P+ V    R +LHV ++PE+ PCRE+EF +IY+F+   +   T  CM+ISGVPGTGKTATV   +  L+          F  + IN M +++P Q Y++I Q                                       +D L  +KQ+V+Y +F W    ++RLV+L I+NTMDL  RI+  +V SRLG+++++F+PY+ +QL QI+ +R+   +    F+  A++LV+RKVAA+SGDARR LDICRRA  + +           + ++ +   + EM+SS  I AI KC S  E+LFL+A++A F+  G EEAT Q V++Q   +C+ E +  +  S+  A+   LGA +LL  +     +  ++RL  S  D+L+AL
Sbjct:  511 PSTPRTPRHATP----SIP--NRLLPTRQPANVLEEARIRLHVSAVPESLPCREQEFQDIYSFVESKILDGTGGCMYISGVPGTGKTATVHEVMRCLQHAADVDEISPFHFIEINGMKMTDPHQAYVQILQ---------------------------------------LDLLWTRKQNVMYNLFDWPSRRHARLVVLAIANTMDLPERIMINRVASRLGLTRMSFQPYTFKQLQQIITSRLNKVKA---FEEDALQLVSRKVAALSGDARRCLDICRRATEICEHSAADPSAAGLVAMSHVMEALNEMFSSAYITAI-KCASLQEQLFLRAVIAEFRRLGLEEATFQQVLVQHQALCRVEGLQPIGVSESLAVCQRLGACRLLLLEPSRLGVLQRVRLNVSQDDVLYAL 872          
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Match: cdc6 (cell division cycle 6 [Source:NCBI gene;Acc:101159640])

HSP 1 Score: 149.058 bits (375), Expect = 3.198e-38
Identity = 96/276 (34.78%), Postives = 143/276 (51.81%), Query Frame = 2
Query:  545 LHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKL--AFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDK--------------KIDLASINAVIKEMYS 1324
            LH  ++PE    RE E  +I  FL + + +     ++ISG PGTGKTA ++  +  ++      + V +N M +     ++      L   K+ A      L+R L  +G        VL+V+DE+DQL  K QDVLY IF+W     SRL L+ I+N +DL+ RIL  ++ +RL    L   F PYS  +L  IV  R+     E   D  A++  ARKV+A+SGDAR+ALDICRRAV + + D+              ++ L  +  V+ E+Y 
Sbjct:  189 LHT-AVPERLLSREAEQASIRRFLQEKVLQRRPGSLYISGAPGTGKTACLNCVLQEMKGELAGVQAVTVNCMSLRSSHAIF-----PLLADKLRAPGGQNGLQRFLTGSGPA------VLLVLDEMDQLDSKAQDVLYTIFEWPFLPKSRLCLIGIANALDLTDRIL-PRLQARLHCRPLLLHFAPYSRDELTAIVKDRLAQVSAEGVLDASAVQFCARKVSAVSGDARKALDICRRAVEMVESDQRKKKLQPENESPASRVGLPQVARVLSEVYG 451          
BLAST of Origin recognition complex subunit 1 vs. Planmine SMEST
Match: SMESG000072187.1 (SMESG000072187.1)

HSP 1 Score: 965.296 bits (2494), Expect = 0.000e+0
Identity = 524/532 (98.50%), Postives = 525/532 (98.68%), Query Frame = 2
Query:   38 MKNEIHNFLTPLVPSRQRSVRESKDKANLKIALSFDNELVRSTKVTRRKTVMVSESIIRRVKSQLNIKINQHVDQAESTNEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNITKPALKRNKNYLKPRKSISVPTRSRLEELTDPSAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDDAP 1633
            MKNEIHNFLTPLVPSRQRSVRESKDKANLKIALSFDNELVRSTKVTRRKTVMVSESIIRRVKSQLNIKINQHVDQAE      Y+CYSDDDNDDDSSECISESIESSESDSNVSSDSLELSSRISRSTNITKPALKRNKNYLKPRKSISVPTRSRLEELTDPSAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKV ANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDDAP
Sbjct:    1 MKNEIHNFLTPLVPSRQRSVRESKDKANLKIALSFDNELVRSTKVTRRKTVMVSESIIRRVKSQLNIKINQHVDQAEE-----YMCYSDDDNDDDSSECISESIESSESDSNVSSDSLELSSRISRSTNITKPALKRNKNYLKPRKSISVPTRSRLEELTDPSAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVPANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALDICRRAVVLQKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKALVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYKLLAHDSINNDIRLKLRLLCSCQDILFALDDAP 527          
BLAST of Origin recognition complex subunit 1 vs. Planmine SMEST
Match: SMESG000070150.1 (SMESG000070150.1)

HSP 1 Score: 108.612 bits (270), Expect = 7.569e-25
Identity = 83/263 (31.56%), Postives = 134/263 (50.95%), Query Frame = 2
Query:  476 SISVPTRSRLEELTDPSAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRATSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVYLRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCKKKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLAFEPYSPQQLVQIVGARMTPQELELRFDPK---AIELVARKVAAMSGDARRALDICRRAV 1255
            S   P +SR      PS   +       I      R  E   +  FL  N+S  ++S ++ISG PGTGKT  V   +  L    L  +  FIN M +S P  +Y  +   L T  +  N   AA E E++   +R      ++ V+DEIDQL  +   +L +IF+W+  + SRL+++ I+N++DL  ++L            + F+PY+ Q++  I+ +++T        DPK   A++  ++K++A SGDAR ALD+ +RAV
Sbjct:   72 SFKTPRKSRA-----PSIRIKNPTETAKISNKLIGRTAERNQLTEFLTSNISNHSNSNIYISGFPGTGKTFVVTEVMKNLVYQKLC-KYHFINCMDLSNPNLIYREMLSQL-TGTLLTNYQKAATEIEIY-LKSRPMNSLALVFVLDEIDQLIDRNNLILNRIFKWVDMTPSRLIIVGIANSLDLVEKMLPNLTLQSCRPHCMNFQPYNEQEINAILLSQITETP-----DPKQLIAVKYCSKKISAGSGDARAALDLYKRAV 321          
The following BLAST results are available for this feature:
BLAST of Origin recognition complex subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ORC11.700e-8441.08origin recognition complex subunit 1 [Source:HGNC ... [more]
ORC11.700e-8441.08origin recognition complex subunit 1 [Source:HGNC ... [more]
CDC67.136e-4228.97cell division cycle 6 [Source:HGNC Symbol;Acc:HGNC... [more]
CDC67.136e-4228.97cell division cycle 6 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
orc-15.873e-4836.95Origin recognition complex subunit 1 [Source:UniP... [more]
orc-15.873e-4836.95Origin recognition complex subunit 1 [Source:UniP... [more]
cdc-62.272e-3131.42Cell division control protein [Source:UniProtKB/T... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Orc13.659e-8040.97gene:FBgn0286788 transcript:FBtr0088959[more]
Cdc66.662e-3733.78gene:FBgn0035918 transcript:FBtr0076647[more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
orc19.849e-8138.93origin recognition complex, subunit 1 [Source:ZFIN... [more]
orc11.026e-8038.93origin recognition complex, subunit 1 [Source:ZFIN... [more]
orc11.724e-8038.93origin recognition complex, subunit 1 [Source:ZFIN... [more]
orc11.800e-8038.93origin recognition complex, subunit 1 [Source:ZFIN... [more]
orc11.949e-8038.93origin recognition complex, subunit 1 [Source:ZFIN... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klk11.566e-8338.54kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648][more]
klk15.434e-8338.54kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648][more]
klk16.051e-8340.27kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648][more]
klk17.902e-8340.27kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648][more]
klk11.050e-8240.21kallikrein 1 [Source:Xenbase;Acc:XB-GENE-5894648][more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Orc15.867e-8241.91origin recognition complex, subunit 1 [Source:MGI ... [more]
Cdc64.133e-4228.97cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1... [more]
Cdc64.776e-4228.97cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1... [more]
Cdc67.292e-4035.80cell division cycle 6 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80Z32|ORC1_RAT1.523e-8441.26Origin recognition complex subunit 1 OS=Rattus nor... [more]
sp|Q9JI69|ORC1_CRIGR3.153e-8439.95Origin recognition complex subunit 1 OS=Cricetulus... [more]
sp|Q13415|ORC1_HUMAN8.166e-8441.08Origin recognition complex subunit 1 OS=Homo sapie... [more]
sp|Q58DC8|ORC1_BOVIN1.948e-8342.82Origin recognition complex subunit 1 OS=Bos taurus... [more]
sp|Q9Z1N2|ORC1_MOUSE4.104e-8141.91Origin recognition complex subunit 1 OS=Mus muscul... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZP462.582e-10243.93Origin recognition complex subunit 1 OS=Opisthorch... [more]
A0A3R7GUT92.520e-10143.93Cell division control protein OS=Clonorchis sinens... [more]
A0A183P0K17.110e-9944.44Origin recognition complex subunit 1 OS=Schistosom... [more]
A0A095C7464.003e-9643.83Origin recognition complex subunit 1 OS=Schistosom... [more]
A0A183LHH07.372e-9644.39Origin recognition complex subunit 1 OS=Schistosom... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
orc12.167e-7841.55origin recognition complex, subunit 1 [Source:ZFIN... [more]
cdc68.544e-4140.32cell division cycle 6 [Source:NCBI gene;Acc:103046... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdc61.986e-4030.37cell division cycle 6 homolog (S. cerevisiae) [Sou... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ORC12.668e-3423.72Largest subunit of the origin recognition complex;... [more]
CDC65.529e-1724.05Essential ATP-binding protein required for DNA rep... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO329601.335e-8338.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494962.345e-4033.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
orc16.486e-7937.96origin recognition complex subunit 1 [Source:NCBI ... [more]
orc11.104e-7837.96origin recognition complex subunit 1 [Source:NCBI ... [more]
orc11.104e-7837.96origin recognition complex subunit 1 [Source:NCBI ... [more]
orc13.135e-7235.52origin recognition complex subunit 1 [Source:NCBI ... [more]
cdc63.198e-3834.78cell division cycle 6 [Source:NCBI gene;Acc:101159... [more]
back to top
BLAST of Origin recognition complex subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072187.10.000e+098.50SMESG000072187.1[more]
SMESG000070150.17.569e-2531.56SMESG000070150.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008750 ID=SMED30008750|Name=Origin recognition complex subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1688bp
TTCCGATCTCTTTATTTGAACTTGAAATTTTTTTCAAATGAAAAATGAAA
TTCATAATTTTTTAACTCCATTGGTCCCTAGTCGGCAAAGATCAGTTCGC
GAATCAAAAGATAAAGCTAATTTAAAAATCGCTTTGTCTTTTGACAATGA
ATTAGTTAGATCAACAAAGGTTACTAGACGTAAGACAGTTATGGTGTCTG
AATCTATTATAAGGCGTGTAAAATCACAATTGAACATAAAAATTAATCAA
CATGTTGATCAAGCAGAATCAACCAATGAAGAGGAATATATATGTTACAG
TGATGATGATAACGATGACGATTCATCTGAATGCATTAGTGAATCAATCG
AGTCCAGCGAATCTGATTCCAATGTTTCGTCAGATTCTCTGGAACTATCT
AGTCGTATCTCAAGATCAACCAATATAACTAAGCCTGCCCTCAAACGCAA
CAAAAACTATCTAAAGCCGAGAAAGTCGATTAGTGTGCCGACGCGGTCCA
GATTAGAGGAGTTAACAGACCCGTCAGCCGTCACCAGAGGAAAGTTACAT
GTTGGCTCTATACCTGAAAATTTTCCTTGTCGAGAGGAGGAGTTCATGAA
CATTTACAATTTTCTCTATGACAACCTCAGTCGGGCCACGAGCAGCTGCA
TGTTCATATCGGGTGTTCCTGGTACTGGCAAAACTGCCACTGTTGATGGT
GCAATCAGCCGTCTAGAGGAGACCGGCTTGACATTTCGCAAAGTCTTCAT
CAATGCAATGCACGTAAGCGAGCCGCAACAGGTCTATCTGCGCATCTACC
AGGCCCTATTTACCAGCAAGGTCCATGCAAACAAGGCAGTTGCGGCCTTG
GAGCGTGAACTATTCTCGACTGGAGCTAGAGCGAGGATGCGCTCACCCGT
TCTGATTGTAATTGACGAGATAGATCAGCTCTGCAAAAAGAAACAAGACG
TGCTGTACAAAATATTTCAGTGGCTGAAATCAAGCAACAGTCGACTAGTC
CTCCTCACCATATCCAACACAATGGACTTGTCTCACCGCATCCTTCAGTA
CAAGGTTACCAGTCGGCTTGGCATTTCAAAGCTCGCCTTTGAGCCATACT
CGCCCCAGCAGCTGGTGCAAATTGTTGGTGCTAGGATGACTCCACAGGAG
CTGGAGTTGCGATTTGATCCGAAAGCAATCGAGCTGGTAGCCCGTAAGGT
TGCCGCGATGTCAGGAGATGCCAGGCGGGCGCTGGACATTTGTCGGCGGG
CGGTTGTACTGCAGAAAGAAGACAAGAAGATCGATTTGGCCAGTATCAAC
GCTGTCATTAAGGAAATGTACTCCTCTCCTATCATCATCGCCATCAGAAA
ATGTTGCAGTTTCTATGAGAAATTGTTCCTCAAGGCGCTCGTGGCAACAT
TTAAGGCCCAAGGATTCGAGGAAGCAACATTGCAAGATGTGGTGATCCAG
TTGGATAATATGTGCAAGGCTGAAAGTGTTCCAGTACTGAATTACTCGCA
GTTGTTTGCCATTCTCGGTAGTTTGGGTGCATATAAACTTTTGGCCCATG
ACAGCATCAATAATGATATCAGATTGAAATTGCGCTTGCTGTGCAGTTGC
CAAGATATTCTGTTTGCGCTCGACGATGCTCCTTGATTAATAAAATGCAT
TTTGACTTATTTTATTATTATTCATGTATCGGGTTATG
back to top

protein sequence of SMED30008750-orf-1

>SMED30008750-orf-1 ID=SMED30008750-orf-1|Name=SMED30008750-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=533bp
MKNEIHNFLTPLVPSRQRSVRESKDKANLKIALSFDNELVRSTKVTRRKT
VMVSESIIRRVKSQLNIKINQHVDQAESTNEEEYICYSDDDNDDDSSECI
SESIESSESDSNVSSDSLELSSRISRSTNITKPALKRNKNYLKPRKSISV
PTRSRLEELTDPSAVTRGKLHVGSIPENFPCREEEFMNIYNFLYDNLSRA
TSSCMFISGVPGTGKTATVDGAISRLEETGLTFRKVFINAMHVSEPQQVY
LRIYQALFTSKVHANKAVAALERELFSTGARARMRSPVLIVIDEIDQLCK
KKQDVLYKIFQWLKSSNSRLVLLTISNTMDLSHRILQYKVTSRLGISKLA
FEPYSPQQLVQIVGARMTPQELELRFDPKAIELVARKVAAMSGDARRALD
ICRRAVVLQKEDKKIDLASINAVIKEMYSSPIIIAIRKCCSFYEKLFLKA
LVATFKAQGFEEATLQDVVIQLDNMCKAESVPVLNYSQLFAILGSLGAYK
LLAHDSINNDIRLKLRLLCSCQDILFALDDAP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR041083AAA_lid_10
IPR020793ORC1
IPR003593AAA+_ATPase
IPR003959ATPase_AAA_core
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0003682chromatin binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005664nuclear origin of replication recognition complex
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0048661positive regulation of smooth muscle cell proliferation
GO:0070318positive regulation of G0 to G1 transition
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 15..164
e-value: 1.0E-4
score: 31.7
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 19..157
e-value: 1.2E-12
score: 48.4
IPR041083AAA lid domainPFAMPF17872AAA_lid_10coord: 185..226
e-value: 1.1E-9
score: 38.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..166
e-value: 2.5E-46
score: 159.5
NoneNo IPR availableGENE3DG3DSA:1.10.8.1280coord: 182..240
e-value: 1.9E-6
score: 29.6
NoneNo IPR availablePANTHERPTHR10763CELL DIVISION CONTROL PROTEIN 6-RELATEDcoord: 2..345
NoneNo IPR availableCDDcd00009AAAcoord: 2..160
e-value: 1.98459E-6
score: 44.8295
IPR020793Origin recognition complex, subunit 1PANTHERPTHR10763:SF23ORIGIN RECOGNITION COMPLEX SUBUNIT 1coord: 2..345
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 5..223