acetylcholine receptor subunit alpha-like

Overview
Nameacetylcholine receptor subunit alpha-like
Smed IDSMED30008748
Length (bp)1782
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of acetylcholine receptor subunit alpha-like (SMED30008748) t-SNE clustered cells

Violin plots show distribution of expression levels for acetylcholine receptor subunit alpha-like (SMED30008748) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of acetylcholine receptor subunit alpha-like (SMED30008748) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for acetylcholine receptor subunit alpha-like (SMED30008748) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008748

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30008748SMESG000020665.1 dd_Smed_v4_9799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008748SMESG000020665.1 dd_Smed_v4_9799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30008748SMESG000020665.1 dd_Smed_v4_9799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30008748SMESG000020665.1 dd_Smed_v4_9799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008748SMESG000020665.1 dd_Smed_v6_9799_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 337.806 bits (865), Expect = 4.773e-109
Identity = 191/499 (38.28%), Postives = 295/499 (59.12%), Query Frame = 3
Query:  159 IVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQD--------------------YRDNETDDIPETF-----------HEDETDSNIQDKWSTRRAAVSGDNVVN------EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNA 1544
            + + ++   RL++ L     Y+  +RPV + +  V+++  +S+ Q++ VDE NQI+  N+W+ Q WND    W+P+DYG    + +P+++IW PD+VLYNNA GD+ +     TK ++ + G V W PP IFKS C I+V +FPFD Q C +K G+W+++   IDL                   I  +++L  Y  + EW +++    ++   Y CC E Y DI++++ +RR  LFY INLI PCL ISFLT+LVFYLP+D GEKV+L IS+LLSLTVF L+I +  P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WV++VF + LP+++FM +P  +                    +   E+    E +           H     SN     +   ++ S D V++      EI+ A++ V+ I  ++K +N    ++DDWKYVA+V+DR+FLW+F++  I+G  G+F+Q     ++A
Sbjct:   28 VARASEAEHRLFERLFE--DYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQV--DDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL-----------------VLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQPLMAREDA 505          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 337.806 bits (865), Expect = 4.773e-109
Identity = 191/499 (38.28%), Postives = 295/499 (59.12%), Query Frame = 3
Query:  159 IVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQD--------------------YRDNETDDIPETF-----------HEDETDSNIQDKWSTRRAAVSGDNVVN------EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNA 1544
            + + ++   RL++ L     Y+  +RPV + +  V+++  +S+ Q++ VDE NQI+  N+W+ Q WND    W+P+DYG    + +P+++IW PD+VLYNNA GD+ +     TK ++ + G V W PP IFKS C I+V +FPFD Q C +K G+W+++   IDL                   I  +++L  Y  + EW +++    ++   Y CC E Y DI++++ +RR  LFY INLI PCL ISFLT+LVFYLP+D GEKV+L IS+LLSLTVF L+I +  P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WV++VF + LP+++FM +P  +                    +   E+    E +           H     SN     +   ++ S D V++      EI+ A++ V+ I  ++K +N    ++DDWKYVA+V+DR+FLW+F++  I+G  G+F+Q     ++A
Sbjct:   28 VARASEAEHRLFERLFE--DYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQV--DDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL-----------------VLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILGTAGLFLQPLMAREDA 505          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 335.88 bits (860), Expect = 2.729e-108
Identity = 201/487 (41.27%), Postives = 285/487 (58.52%), Query Frame = 3
Query:  171 TKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQ--DYRDNETDDIPETFHEDETD---------SNIQDKWSTR----------------RAAVSG---DNVVNEIEL--------ALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFM 1517
            T+   RL+  L R  GY+   RPV + +  V++   LS+ Q++DVDEKNQ++  N+W+ QEW+D    W+P D+GN+T L +PS  IW PD+VLYNNA G  + A +  TK  +   G+V W PP I+KS C I+V FFPFD+Q C +K G+WT++   IDL    Q                  +DL  Y  + EW ++  +   N + Y CC E Y D+++   +RR  LFY INLI PCL IS LT+LVFYLP+D GEK++L IS+LLSLTVF LLI +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H RSP TH M  WVR      +P+ L M +P    +        +  ++H  E++            +D+W+                   +  SG   + ++ E EL        ALEGV  I  H++ E++ S++++DWKYVA+V+DR+FLWLF I   +G +G+F+
Sbjct:   34 TETEDRLFKHLFR--GYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADG--EFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQ-----------------TVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEEDRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFL 499          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 335.88 bits (860), Expect = 5.998e-108
Identity = 201/487 (41.27%), Postives = 285/487 (58.52%), Query Frame = 3
Query:  171 TKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQ--DYRDNETDDIPETFHEDETD---------SNIQDKWSTR----------------RAAVSG---DNVVNEIEL--------ALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFM 1517
            T+   RL+  L R  GY+   RPV + +  V++   LS+ Q++DVDEKNQ++  N+W+ QEW+D    W+P D+GN+T L +PS  IW PD+VLYNNA G  + A +  TK  +   G+V W PP I+KS C I+V FFPFD+Q C +K G+WT++   IDL    Q                  +DL  Y  + EW ++  +   N + Y CC E Y D+++   +RR  LFY INLI PCL IS LT+LVFYLP+D GEK++L IS+LLSLTVF LLI +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H RSP TH M  WVR      +P+ L M +P    +        +  ++H  E++            +D+W+                   +  SG   + ++ E EL        ALEGV  I  H++ E++ S++++DWKYVA+V+DR+FLWLF I   +G +G+F+
Sbjct:   56 TETEDRLFKHLFR--GYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADG--EFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQ-----------------TVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEEDRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFL 521          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Human
Match: CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit [Source:HGNC Symbol;Acc:HGNC:15963])

HSP 1 Score: 333.569 bits (854), Expect = 1.484e-107
Identity = 191/480 (39.79%), Postives = 278/480 (57.92%), Query Frame = 3
Query:  168 GTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIP----------------------ETFHEDETDSNIQDKWSTRRAA-------VSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
            G     RL+  L     Y+  +RPV++ +  V ++  +++ Q+ +VDE NQI+  N+W+   WND    WDP +Y  +  L +P+ +IW PD+VLYNNA GD+ +     TK ++ ++G + W PP IFKS C +++ FFPFD Q C LK G+WT++   IDL     K                 +D++ +  N EW++++ S  ++   Y CC E Y DI+++  +RR  +FY INLI PCL ISFLT+LVFYLP+D GEKV+L IS+LLSLTVF L+I +  P TS+VVPL+ +YLLFTMI VTLS++ TV VLNIH+R+P TH M  WV++VF   LP++L M+ P    R   +D +P                      E FH  +++     K   RR +       V       E+E  +  V+ I  ++K  N    + DDWKYVA+V+DR+FLW+F I  + G  G+F+Q
Sbjct:   30 GCATEERLFHKLFSH--YNQFIRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQV--EGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSK-----------------VDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSK---RRLSHQPLQWVVENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQ 485          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: unc-38 (Acetylcholine receptor subunit alpha-type unc-38 [Source:UniProtKB/Swiss-Prot;Acc:Q23022])

HSP 1 Score: 349.747 bits (896), Expect = 5.444e-114
Identity = 221/509 (43.42%), Postives = 315/509 (61.89%), Query Frame = 3
Query:  129 CLGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLID-------LRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYP-CCTE-PYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRD-------NETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIEL------ALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPMTADNCPSVSSIN 1589
            C+ F    I + +G +DA+RLYDDLM    Y+   RP  S    + + + L L QI+DV E +QI+  ++W+ Q W D    WDP +YG V  L +P   IW PD+VLYNNA  ++++  S  TK  +++ G V W+PP IFKS C I+V +FPFD+Q C LK G+WT +  L+        LR+  + ++ +   DN     D  IDLS Y  +VEWD++   AKR  + YP CC +  Y+D+++ + LRR+ LFY +NL+ PC+ ISFLTILVFYLP+DSGEKV+L ISIL++LT+FFLL+ +I P TSI +PLI KYLLFTM++VTLSV+ TV+ LN+H+R+P TH M  WV+ VF   LPKLLFM++P  DY +        +   I  + H     SN+ +  + R A +  D+ + ++        A E +  I   +KK++    + +DWKYVA+VLDRLFL +FSIA  +G + I ++APTL D   P+     P+  S N
Sbjct:   14 CISF----IKLTEGNEDAKRLYDDLMV--NYNRHRRPSTSPNKPLTIKLKLRLSQIIDVHEIDQIMTCSVWLKQTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNADSNYNITIS--TKATLHYTGEVTWEPPAIFKSMCQIDVRWFPFDEQQCHLKFGSWTFSENLLSVELNEPSLRYEEEIDE-KGIIDNVTVAED-GIDLSDYYPSVEWDIMSRVAKRRAKNYPSCCPQSAYIDVTYYLQLRRKPLFYTVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLIGKYLLFTMVMVTLSVVVTVISLNLHFRTPTTHLMPNWVKKVFLKWLPKLLFMRRPIDDYEEKFDDKKKPKDGKIALSVHAHRV-SNVGN--NIRNATI--DDTIQKMYYSPPVVKAFENICFIAELLKKKDRDDKIDEDWKYVAMVLDRLFLLIFSIACFVGTVIILLRAPTLYDTRQPIDLQYRPANLSAN 507          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: unc-63 (Acetylcholine receptor subunit alpha-type unc-63 [Source:UniProtKB/Swiss-Prot;Acc:Q9N587])

HSP 1 Score: 347.821 bits (891), Expect = 2.102e-113
Identity = 213/498 (42.77%), Postives = 301/498 (60.44%), Query Frame = 3
Query:  135 GFLFGLIFIV-----QGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAK---------IDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPD----QDYRDNETDDIPETF----------HEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNA 1544
            GF + LIF++        +DA RL++DL+    Y+  VRPV     T+++   L L Q+LDV EKNQI+  N+W+   W D    WDP +YG V  L +PS  IW PD+VLYNNA G++ +  +  TK  + ++G+V W PP I+KS C I+VEFFPFD+Q C++K G+WT+ G  +DL+H  +  + +   D              +D  IDLS Y  +VEWD+L V  KR+ + YPCC  P++DI++ + LRR+TLFY +NLI P + ISFLT LVFYLP+D GEK+SL ISIL+SLTVFFLL+ +I P TS+V+PLI KYLLFTM+LVTLSV+ TV+ LN+H+RSP TH M  W++ +F   LPK L M +P         + + D    TF          + +     +          +  DN  + +  A+E V  I  H+K E     + +DWKY++VV+DR+FL  F+ A   G + I  +AP++ DN 
Sbjct:    7 GFAYILIFLLLSPPTHANRDANRLFEDLIA--DYNKLVRPVSENGETLVVTFKLKLSQLLDVHEKNQIMTTNVWLQHSWMDYKLRWDPVEYGGVEVLYVPSDTIWLPDVVLYNNADGNYQV--TIMTKAKLTYNGTVEWAPPAIYKSMCQIDVEFFPFDRQQCEMKFGSWTYGGLEVDLQHRDKHLEKEIEEDVEGVDGPTKEIVWVVDRGIDLSDYYPSVEWDILNVPGKRHSKRYPCCESPFIDITYEIHLRRKTLFYTVNLIFPSVGISFLTALVFYLPSDGGEKISLCISILISLTVFFLLLVEIIPSTSLVIPLIGKYLLFTMVLVTLSVVVTVVTLNVHYRSPTTHTMPKWMKRLFVDFLPKYLLMTRPQPPGHHSKPNRKFDSRASTFSIGVNHVLGQNSELLSPGLNSNREESSFTLPRDN--SPVRSAVESVAYIADHLKNEEDDKQVIEDWKYISVVMDRIFLITFTFACAFGTVVIIARAPSIYDNT 498          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-16 (Acetylcholine receptor subunit alpha-type acr-16 [Source:UniProtKB/Swiss-Prot;Acc:P48180])

HSP 1 Score: 315.079 bits (806), Expect = 9.498e-101
Identity = 182/502 (36.25%), Postives = 285/502 (56.77%), Query Frame = 3
Query:  168 GTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETF------HEDETDSNIQD-KWSTRRA-------------------------------AVSGDNVVNEI--ELALEGVRRIVHHIK-------KENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTL 1532
            G+   RRLY+DLMR   Y+   RPV +++  V +++ ++L QI+DVDEKNQ++ +N W++  WND N VWD  +YGN+T++  P+ +IW PD++LYN+   ++D  S+  T +IV   G V W PP IFK  C I++++FPFD+Q C  K G+WT++G+ +DL+                       D+S+Y++N EW L   + +RN +FY CC EPY D+ F + +RRRTL+YG NLI PC+  + +T+L F LP D+GEK++L I++LLS+  F  ++ ++SPPTS  VPL+  +    MI+VT S + TV VLN+H+R+P+TH M PW R++    +P +L MK+P  +        +P  F      H +    NI+D + S  RA                                +S +    ++  +  L  + RI H +K       + +      ++WK+ A+V+DRL L++F+I  I+  +GIF  AP L
Sbjct:   19 GSLQERRLYEDLMR--NYNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFD--STYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQPATG-----------------GFDISEYISNGEWALPLTTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETHDMGPWTRNLLLYWIPWILRMKRPGHNL---TYASLPSLFSTKPNRHSESLIRNIKDNEHSLSRANSFDADCRLNQYIMTQSVSNGLTSLGSIPSTMISSNGTTTDVSQQATLLILHRIYHELKIVTKRMIEGDKEEQACNNWKFAAMVVDRLCLYVFTIFIIVSTIGIFWSAPYL 496          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-11 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:P91197])

HSP 1 Score: 311.997 bits (798), Expect = 5.157e-100
Identity = 173/462 (37.45%), Postives = 276/462 (59.74%), Query Frame = 3
Query:  159 IVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIP--SREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRD----NETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAP 1526
            +  G+    +L+ DL++  GY+P  RPV++ +  + + + L L QILDVDEKNQI+ +N W++  W D    W+P  YG + ++  P  S  IW PD++LYN+A  D+D    SN  ++  H G+V+W PP + K  C ++V +FPFD Q+C++K G+WT +G+ IDL+     N +Q+            +DLS Y+ N EW ++  +AKR + +Y CC EPY  +++ + +RRRTL+YG NLI P L IS + IL F  P D+GEK++L ++ILL++  F  ++ +++PPTS  VPLI  +    M++V+ SV+ T++VLN+H+RS D+H+M P VR V    LP LLFM +P   +      + TD +P+   ++  D N+    +   A +   + V+        +RR+V    KE     ++ DW++ A+V+DR  L LF++  +I +L I M AP
Sbjct:   19 LCDGSVAETKLFTDLLK--GYNPLERPVQNSSQPLEVKIKLFLQQILDVDEKNQIVSVNAWLSYTWFDHKLQWEPKKYGGIQDIRFPGSSDHIWKPDVLLYNSAAEDFDSTFKSN--LLTYHTGTVVWIPPGVLKFVCQLDVTWFPFDDQVCEMKFGSWTFHGYAIDLQIDDDTNGTQS------------MDLSTYLVNGEWQVISTNAKRVVSYYKCCPEPYPTVNYYLHIRRRTLYYGFNLIIPSLLISLMAILGFMFPPDAGEKITLEVTILLAIVFFLSMVSEMTPPTSEAVPLIGVFFSCCMLVVSASVVFTIVVLNLHFRSADSHEMNPLVRRVLLEFLPWLLFMSRPGYKFVKANVIDSTDKMPKK-PKNPLDCNLPSNHAGYEAQILLLHSVH------TELRRVVAFYNKEEHDERIQTDWRFAAMVVDRACLLLFTVFIVISILAIMMSAP 457          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Match: acr-8 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q23355])

HSP 1 Score: 313.538 bits (802), Expect = 1.020e-99
Identity = 183/483 (37.89%), Postives = 297/483 (61.49%), Query Frame = 3
Query:  147 GLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYP-CCTEP-YLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQD---YRDNETDDI--------PETFHEDETDSNIQDKWST-RRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPM 1553
            GL F V   + A ++Y+DL+    Y+ +VRP+K+ + +V +    SL++I+DVDE NQ++  N+W+  +W D   +WDP  +G + +L++P  +IW PD++LYNNA G+  +   S+   IV ++G V+WKPP I+KS C I++E+FP+D Q C +K G WT+NGFL+D+R    +  +            +A  +S +  ++EWDL+E+++ R+ + Y  CC +  Y+DI+F + +RR+TLFY INL+ PC   + LT +VFY+P     K++ SISIL++LTVF+L++ D+ PPTS+V+PLI KYLLFTM LV++S+M +V+ LN + R   +  M  W++ VF  TLP+ + +K  ++D    R +   DI        P  F     +  +  + S  ++  +  D + N I+  +E +    + +KKE+  S   +DW YVA V+DR+FL +FSI  ++G   I + +P L DN  P+
Sbjct:   14 GLFFYVNPNRYADQMYEDLLYY--YNKNVRPIKNASESVKVKFGSSLIRIIDVDEVNQVLTTNLWLEMQWFDYRLMWDPGRWGKIRKLHVPVDQIWIPDILLYNNADGEPHITIMSDA--IVYYNGLVVWKPPSIYKSFCSIDIEYFPYDTQTCWMKFGGWTYNGFLLDVRQLPVEEWTLVVTTRKLQVCAHASSISFFFRSLEWDLMELNSARHEKIYAGCCGQDFYIDITFKIEIRRKTLFYTINLMIPCTMFAILTSIVFYVPPIE-HKMTFSISILVTLTVFYLILIDLVPPTSLVIPLIGKYLLFTMFLVSISIMLSVISLNFYRRDGSSFPMPHWMKVVFIHTLPRYICIKTAEEDDGSDRGSSISDIGPFMDSRRPSPFFITVNERQLNGRLSELKKKGMHPDLIRNMIQ-NVEFIAEYFNSLKKEDKVS---EDWSYVANVIDRIFLIIFSIMNVVGTWVILLNSPALFDNRTPL 487          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0332872)

HSP 1 Score: 426.787 bits (1096), Expect = 5.333e-144
Identity = 232/486 (47.74%), Postives = 322/486 (66.26%), Query Frame = 3
Query:  162 VQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDD------------IPETFH--EDET----DSNI----QDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPM 1553
            V G  DA+RLYDDL+    Y+  VRPV + T  + + + L L Q++DV+ KNQI+  N+WV Q W D    W+P +YG V  L++PS  IW PD+VLYNNA G++++  +  TK  +  +G V WKPP I+KS C I+VE+FPFD+Q C LK G+WT++GF +DLRH  ++  S          +   +DLS++  +VEWD+LEV A RN +FY CC EPYLDI+FN+++RR+TLFY +N+I PC+ ISFLT+L FYLP+DSGEKV+LSISIL+SL VFFLL+ +I PPTS+VVPL+ KYL+F MILV++S+  TV+VLN+H+RSP THKMAPWV+ VF   LP  LF+K+P  ++  + T +            +P   H   DE     D +I             A S    + +I  +   VR I  H K +   + +++DWKYVA+VLDRLFLW+F++A ++G  GI +QAPTL D+ IP+
Sbjct:    6 VAGNPDAKRLYDDLLS--NYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFEVTLA--TKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQQGSNV--------VAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFIDFLPAFLFIKRPTYNFETSITANGPFGGSCQVHGPVPPLTHCSSDEIAAVPDMDIGPLGMKSPILNNPAFSHSKCLPKIHKSCFCVRFIAEHTKMQEDSTKVKEDWKYVAMVLDRLFLWIFTLAVVVGTAGIILQAPTLYDDRIPI 479          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRbeta2 (gene:FBgn0004118 transcript:FBtr0084681)

HSP 1 Score: 399.053 bits (1024), Expect = 5.599e-133
Identity = 221/483 (45.76%), Postives = 316/483 (65.42%), Query Frame = 3
Query:  165 QGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPD---QDYRD--------NETD------DIPETFHEDE---TDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPM 1553
            +   D +RLYDDL+    Y+  +RPV + T T+ +++ L L Q+++V+ KNQ++  N+WV Q W D    WDP +YG V +L +PS  IW PD+VLYNN  G++++  +  TK  + + G V W+PP I+KS C +NVE+FP+D+Q+C +K G+WT+NG  +DL+H  Q   S          +   IDL+++  +VEWD+LEV A +N E+YP   EP+ DI+F +++RR+TLFY +NLI PC+A++FLT+LVFYLP+DSGEKV+L ISIL+SLTVFFLL+ +I PPTS+ VPL+ KYLLFTMILV+LSV  TV VLNIH+RSP TH M+P VR +F   +PKL+ M++      DY D        NE D      D P  F + +    D+ +Q+  S     V   N+  E+  AL  VR I  HIK  +  + + +DWK+V++VLDR FLWLF+++ + G L I  Q+P+L D   P+
Sbjct:   25 EANPDTKRLYDDLLS--NYNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEV--TLMTKATLKYTGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQIPGSNL--------VQVGIDLTEFYLSVEWDILEVPATKNEEYYPDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLNIHFRSPSTHNMSPLVRKLFLHFMPKLMMMRRTQYTLPDYDDSTPSNGYTNEIDVRDSISDFPSEFKDSQDGAYDNGMQN--SVDSDNVIPRNLTPEVLQALRAVRFIAQHIKDADKDNEIVEDWKFVSMVLDRFFLWLFTLSCVFGTLAIICQSPSLYDTRSPI 493          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084639)

HSP 1 Score: 379.793 bits (974), Expect = 1.345e-124
Identity = 196/364 (53.85%), Postives = 265/364 (72.80%), Query Frame = 3
Query:  162 VQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDI 1253
            VQ   DA+RLYDDL+    Y+  +RPV + T TVL+ + L L Q++D++ K+QI+  N+W+  EW D  F WDP++YG VTEL +PS  IW PD+VLYNNA G++    ++ TK I+++ G V+W PP IFKS C I+V +FPFD+Q C +K G+WT++G  IDL+H +QKN      DN   K++  IDL +Y  +VEWD+L V A+R+ ++YPCC EPY DI FN++LRR+TLFY +NLI PC+ IS+L++LVFYLPADSGEK++L ISILLS T+FFLLI +I P TS+ +PL+ KYLLFTM+LV LSV+ T+++LNIH+R P THKM PW+RS F   LPKLL M+ P    RD   + I
Sbjct:   39 VQANPDAKRLYDDLLS--NYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEY--VVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDK----DN---KVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDLLRDLAANKI 391          

HSP 2 Score: 68.5514 bits (166), Expect = 8.005e-12
Identity = 29/66 (43.94%), Postives = 47/66 (71.21%), Query Frame = 3
Query: 1347 EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNA 1544
            E+E A+  V  I HH+++++ ++A   DW +VA+V+DRLFLWLF IA+++G   I  +AP+L D+ 
Sbjct:  489 ELEKAIHNVMFIQHHMQRQDEFNAEDQDWGFVAMVMDRLFLWLFMIASLVGTFVILGEAPSLYDDT 554          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084640)

HSP 1 Score: 379.793 bits (974), Expect = 1.345e-124
Identity = 196/364 (53.85%), Postives = 265/364 (72.80%), Query Frame = 3
Query:  162 VQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDI 1253
            VQ   DA+RLYDDL+    Y+  +RPV + T TVL+ + L L Q++D++ K+QI+  N+W+  EW D  F WDP++YG VTEL +PS  IW PD+VLYNNA G++    ++ TK I+++ G V+W PP IFKS C I+V +FPFD+Q C +K G+WT++G  IDL+H +QKN      DN   K++  IDL +Y  +VEWD+L V A+R+ ++YPCC EPY DI FN++LRR+TLFY +NLI PC+ IS+L++LVFYLPADSGEK++L ISILLS T+FFLLI +I P TS+ +PL+ KYLLFTM+LV LSV+ T+++LNIH+R P THKM PW+RS F   LPKLL M+ P    RD   + I
Sbjct:   39 VQANPDAKRLYDDLLS--NYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEY--VVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDK----DN---KVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDLLRDLAANKI 391          

HSP 2 Score: 68.5514 bits (166), Expect = 8.005e-12
Identity = 29/66 (43.94%), Postives = 47/66 (71.21%), Query Frame = 3
Query: 1347 EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNA 1544
            E+E A+  V  I HH+++++ ++A   DW +VA+V+DRLFLWLF IA+++G   I  +AP+L D+ 
Sbjct:  489 ELEKAIHNVMFIQHHMQRQDEFNAEDQDWGFVAMVMDRLFLWLFMIASLVGTFVILGEAPSLYDDT 554          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0346707)

HSP 1 Score: 370.163 bits (949), Expect = 1.813e-121
Identity = 193/379 (50.92%), Postives = 270/379 (71.24%), Query Frame = 3
Query:  162 VQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNE--TDDIPETFHEDETDSNI 1292
            V G  DA+RLYDDL+    Y+  VRPV + T  + + + L L Q++DV+ KNQI+  N+WV Q W D    W+P +YG V  L++PS  IW PD+VLYNNA G +++  +  TK IV ++G V+W+PP ++KS C I+VE+FP+D Q C LK+G+WT++GF +DLRH  ++  S          +   +DLS++  +VEWD+LEV A RN +FY CC EPYLDI+FN+++RR+TLFY +N+I PC+ ISFLT+L FYLP+DSGEKV+LSISIL+SL VFFLL+ +I PPTS+VVPL+ KYL+F MILV++S+  TV+VLN+H+RSP THKMAPWV+ VF   LP  LF+K+P  ++  ++    D    F+   + +NI
Sbjct:    6 VAGNPDAKRLYDDLLS--NYNKLVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGHYEV--TLMTKAIVYNNGLVIWQPPAVYKSSCSIDVEYFPYDVQTCILKLGSWTYDGFKVDLRHMDEQQGSNV--------VAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFIDFLPAFLFIKRPTYNFETSKLLLKDTHACFYPYYSATNI 372          

HSP 2 Score: 78.5666 bits (192), Expect = 6.271e-15
Identity = 35/78 (44.87%), Postives = 52/78 (66.67%), Query Frame = 3
Query: 1320 AVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPM 1553
            A S    + +I  +   VR I  H K +   + +++DWKYVA+VLDRLFLW+F++A ++G  GI +QAPTL D+ IP+
Sbjct:  442 AFSHSKCLPKIHKSCFCVRFIAEHTKMQEDSTKVKEDWKYVAMVLDRLFLWIFTLAVVVGTAGIILQAPTLYDDRIPI 519          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 340.887 bits (873), Expect = 3.350e-110
Identity = 201/485 (41.44%), Postives = 287/485 (59.18%), Query Frame = 3
Query:  216 GYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDI--PETFHEDET--------DSNIQDKWSTRRAAVSG---------------------------------DNVVNEIEL--------ALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFM 1517
            GY+   RPV++ +  V++   LS+ Q++DVDEKNQ++  N+W+ QEWND    W+P+++ NVT + +PS  IW PD+VLYNNA G  + A +  TK  + H G V W PP I+KS C I+V FFPFD+Q C +K G+WT++   IDL                  +I+  +DL  Y  + EW ++      N + Y CC E Y DI++   +RR  LFY INLI PCL IS LT+LVFYLP+D GEK++L IS+LLSLTVF LLI +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H RSP TH M  WV SVF   +P+ LFM++P+ + +  +T ++   +++ + ET        D       ST  ++ S                                   N+V+E  L        ALEGVR I  H++ E+   ++++DWKYVA+V+DR+FLW+F I  ++G +G+F+
Sbjct:   47 GYNKWSRPVRNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPSEFDNVTSIRVPSEMIWVPDIVLYNNADG--EFAVTHMTKAHLFHTGKVSWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE-----------------QIEGTVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHSMPRWVHSVFLDHIPRWLFMRRPEPEKKPKKTANLSTSKSWFQQETGVDGLVCQDMEFGIGLSTSISSPSATSLHLSDSEPLLQKYELQHLGHVVNLCQHPAKLGNLVSEPGLLFSPCVLRALEGVRYIADHLRAEDEDFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTIGLFL 512          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrnb5a (cholinergic receptor, nicotinic, beta 5a [Source:ZFIN;Acc:ZDB-GENE-090312-169])

HSP 1 Score: 325.479 bits (833), Expect = 5.953e-105
Identity = 197/493 (39.96%), Postives = 290/493 (58.82%), Query Frame = 3
Query:  147 GLIFIVQGTKDA---RRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEP-YLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQD----------YRDNETDDIP------ETFHEDETDSNIQDKWST----------RRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLT 1535
            GL   V G+  A    RL D L+    Y+  +RP  + +  V + + +SL Q++ V+E+ QI+  N+W+ QEWND   VWDPN+Y  + +L IPSR IW PD+VLYNNA G ++++   N   +V++ G + W PP I+KS C I V  FPFD+Q C LK  +WT++   +DL  T+                D+A     Y  + EWD++ +  +RN +     ++P YLD++++  ++R+ LFY INLI PC+ I+ L ILVFYLP+D GEK++L IS+LL+LTVF LLI  I PPTS+ VPLI KYL+FTM+LVT S++ +V VLN+H RSP TH+M  WV+ VF   LP  L M++P +            R + + D        +++   +    +   W            +R  V  D  V+E   A+EGVR I  H+K E+    + +DWKYVA+V+DRLFLW+F +  ++G LG+F+Q   L+
Sbjct:    2 GLRLEVIGSLAADAEERLVDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWNDYRLVWDPNEYEGIKKLRIPSRHIWLPDIVLYNNADGVYEVSFYCNA--VVSNTGDIFWLPPAIYKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDLYLTS----------------DFA-SRDDYTPSGEWDIVSLPGRRNEDL----SDPTYLDVTYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHRMPEWVKRVFLHKLPFFLLMRRPGRSNVRERFRRKHQRKSFSSDTKGLRLDGDSYFLSDDPGRVCGAWRVGDLPEGSEFRQRVKVRHDPDVDE---AIEGVRFIAEHMKIEDDDEGIIEDWKYVAMVIDRLFLWIFILVCVVGTLGLFVQPHALS 468          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 327.791 bits (839), Expect = 8.927e-105
Identity = 196/513 (38.21%), Postives = 292/513 (56.92%), Query Frame = 3
Query:  150 LIFIVQG---TKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDY---------------------RDNETDDIPETFHE-------------------DETDSNIQDKWSTRRAAVSGDN------VVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDN 1541
            L F++ G   ++   RL+  +     Y+  +RPV++ +  V++   +S+ Q++ VDE NQI+  N+W+   WND    WDP D+G V  + +PS +IW PD+VLYNNA GD+ +     TK ++  +G V W PP IFKS C I+V +FPFD Q C +K G+WT++   IDL                   I   I+L  +  + EW +++    ++   Y CC E Y DI++++ +RR  LFY IN+I PCL ISFLT+LVFYLP+D GEKV+L IS+LLSLTVF L+I +  P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WVR VF S LP+++FM +P++D                      R  +    P   +E                   + T    +D  S   ++ S D       V  ++  A+E V+ I  +++ +N    ++DDWKYVA+V+DR+FLW+F +  I+G  G+F+Q   L ++
Sbjct:   51 LCFLLSGVCCSEAEHRLFSVIFS--SYNQYIRPVENVSDPVVVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNKIWKPDIVLYNNAVGDFQV--DDKTKALLRFNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDL-----------------VLIGSTINLKDFWESGEWTIIDAPGYKHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRRVFLSLLPRVMFMTRPEKDQEVPAKQCSVHPPVSSKQTSVCRGPQLLLCPTELNEASRTAFLCREHHCWKKHISNMTSEGAEDGGSPCSSSESLDGFLCMSAVSPQVREAIESVKYIAENMRLQNEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQPLLLGED 542          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrnb5a (cholinergic receptor, nicotinic, beta 5a [Source:ZFIN;Acc:ZDB-GENE-090312-169])

HSP 1 Score: 325.479 bits (833), Expect = 1.380e-104
Identity = 194/493 (39.35%), Postives = 289/493 (58.62%), Query Frame = 3
Query:  126 ICLGFLFGLIFIVQGTKDAR-RLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEP-YLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQD----------YRDNETDDIP------ETFHEDETDSNIQDKWST----------RRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
            +C+     +  +     DA  RL D L+    Y+  +RP  + +  V + + +SL Q++ V+E+ QI+  N+W+ QEWND   VWDPN+Y  + +L IPSR IW PD+VLYNNA G ++++   N   +V++ G + W PP I+KS C I V  FPFD+Q C LK  +WT++   +DL  T+                D+A     Y  + EWD++ +  +RN +     ++P YLD++++  ++R+ LFY INLI PC+ I+ L ILVFYLP+D GEK++L IS+LL+LTVF LLI  I PPTS+ VPLI KYL+FTM+LVT S++ +V VLN+H RSP TH+M  WV+ VF   LP  L M++P +            R + + D        +++   +    +   W            +R  V  D  V+E   A+EGVR I  H+K E+    + +DWKYVA+V+DRLFLW+F +  ++G LG+F+Q
Sbjct:   11 VCICVCMYVCVLGSLAADAEERLVDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWNDYRLVWDPNEYEGIKKLRIPSRHIWLPDIVLYNNADGVYEVSFYCNA--VVSNTGDIFWLPPAIYKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDLYLTS----------------DFA-SRDDYTPSGEWDIVSLPGRRNEDL----SDPTYLDVTYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHRMPEWVKRVFLHKLPFFLLMRRPGRSNVRERFRRKHQRKSFSSDTKGLRLDGDSYFLSDDPGRVCGAWRVGDLPEGSEFRQRVKVRHDPDVDE---AIEGVRFIAEHMKIEDDDEGIIEDWKYVAMVIDRLFLWIFILVCVVGTLGLFVQ 477          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Match: chrnb5a (cholinergic receptor, nicotinic, beta 5a [Source:ZFIN;Acc:ZDB-GENE-090312-169])

HSP 1 Score: 325.094 bits (832), Expect = 1.504e-104
Identity = 196/490 (40.00%), Postives = 289/490 (58.98%), Query Frame = 3
Query:  141 LFGLIFIVQGTKDA---RRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEP-YLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQD----------YRDNETDDIP------ETFHEDETDSNIQDKWST----------RRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
            L  L FI + +  A    RL D L+    Y+  +RP  + +  V + + +SL Q++ V+E+ QI+  N+W+ QEWND   VWDPN+Y  + +L IPSR IW PD+VLYNNA G ++++   N   +V++ G + W PP I+KS C I V  FPFD+Q C LK  +WT++   +DL  T+                D+A     Y  + EWD++ +  +RN +     ++P YLD++++  ++R+ LFY INLI PC+ I+ L ILVFYLP+D GEK++L IS+LL+LTVF LLI  I PPTS+ VPLI KYL+FTM+LVT S++ +V VLN+H RSP TH+M  WV+ VF   LP  L M++P +            R + + D        +++   +    +   W            +R  V  D  V+E   A+EGVR I  H+K E+    + +DWKYVA+V+DRLFLW+F +  ++G LG+F+Q
Sbjct:    5 LIKLCFIARWSLAADAEERLVDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWNDYRLVWDPNEYEGIKKLRIPSRHIWLPDIVLYNNADGVYEVSFYCNA--VVSNTGDIFWLPPAIYKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDLYLTS----------------DFA-SRDDYTPSGEWDIVSLPGRRNEDL----SDPTYLDVTYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHRMPEWVKRVFLHKLPFFLLMRRPGRSNVRERFRRKHQRKSFSSDTKGLRLDGDSYFLSDDPGRVCGAWRVGDLPEGSEFRQRVKVRHDPDVDE---AIEGVRFIAEHMKIEDDDEGIIEDWKYVAMVIDRLFLWIFILVCVVGTLGLFVQ 468          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 350.903 bits (899), Expect = 4.239e-114
Identity = 209/515 (40.58%), Postives = 302/515 (58.64%), Query Frame = 3
Query:  117 FTMICLGFLFGLIFIVQGTKD--ARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETD-DIPE---TFHEDETDSNIQDKWSTRRAAVSGDNVVN------------------------------------------EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFM 1517
             +++C    F  +  ++ T+     RL+  L    GY+   RPV + +  V++   LS+ Q++DVDEKNQ++  N+W+ QEWND    W+P DY NVT + +PS  IW PD+VLYNNA G  + A +  TK  + H+G V W PP I+KS C I+V FFPFD+Q C +K G+WT++   +DL  + ++N                +DL  Y  + EW ++    K N + Y CCTE Y DI++   +RR  LFY INLI PCL IS LT+LVFYLP+D GEK++L IS+LLSLTVF LLI +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H RSP THKM  WVRSVF   +P+ LFMK+P     +  +  D PE   +  +   ++++ DKW+   A +   +V +                                           +  ALEGV  I +H++ E++  ++++DWKYVA+V+DR+FLW+F I  ++G +G+F+
Sbjct:    9 LSILCWIITFTTVSCMERTRTHAEERLFKRLFT--GYNRWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADG--EFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLE-SMERN----------------VDLKDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVRSVFLDHIPRWLFMKRPPAPVEEVVSQYDAPELKLSTSKYWMETDVDDKWAEPEAELQTCHVRHMTTHNQSLQYRYDYNHHVSGGQSQTPRHSSTETAESSFLLSPSVLKALEGVHYIANHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFL 502          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 343.969 bits (881), Expect = 1.238e-111
Identity = 199/482 (41.29%), Postives = 290/482 (60.17%), Query Frame = 3
Query:  183 RRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPD--------QDYRDNETDDIP----ETFHEDETDSNIQDKW---------STRRAAV---------SGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTD 1538
             RLY+DL++   Y+P +RPV + +  V+L+  +S+ Q++ VDE NQI+  N+W+   WND    W+P+DYG +  L IP+ +IW PD+VLYNNA G + +      K +V + G V W PP IFKS C I+V FFPFD Q C LK G+WT++   I+L     K                 I+L ++  + EW ++     ++   Y CC E Y DI++++ +RR  LFY I +I PCL IS LTILVFYLP+D GEKV+L +S+LLSLTVF L+I +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WV+  F   LPK++FM +P+        Q Y D  + +I     + F++D + +  Q K           TR +++         SG  +  EI  A+E V  I  ++K ++    ++DDWKYVA+V+DR+FLW+F +  I+G  G+F+Q    +D
Sbjct:   26 HRLYEDLLK--SYNPYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHV--DDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGSK-----------------INLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPEIREAIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQPLLFSD 486          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 343.584 bits (880), Expect = 1.304e-111
Identity = 199/482 (41.29%), Postives = 290/482 (60.17%), Query Frame = 3
Query:  183 RRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPD--------QDYRDNETDDIP----ETFHEDETDSNIQDKW---------STRRAAV---------SGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTD 1538
             RLY+DL++   Y+P +RPV + +  V+L+  +S+ Q++ VDE NQI+  N+W+   WND    W+P+DYG +  L IP+ +IW PD+VLYNNA G + +      K +V + G V W PP IFKS C I+V FFPFD Q C LK G+WT++   I+L     K                 I+L ++  + EW ++     ++   Y CC E Y DI++++ +RR  LFY I +I PCL IS LTILVFYLP+D GEKV+L +S+LLSLTVF L+I +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WV+  F   LPK++FM +P+        Q Y D  + +I     + F++D + +  Q K           TR +++         SG  +  EI  A+E V  I  ++K ++    ++DDWKYVA+V+DR+FLW+F +  I+G  G+F+Q    +D
Sbjct:   21 HRLYEDLLK--SYNPYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHV--DDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGSK-----------------INLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPEIREAIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQPLLFSD 481          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 343.584 bits (880), Expect = 1.700e-111
Identity = 199/482 (41.29%), Postives = 290/482 (60.17%), Query Frame = 3
Query:  183 RRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPD--------QDYRDNETDDIP----ETFHEDETDSNIQDKW---------STRRAAV---------SGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTD 1538
             RLY+DL++   Y+P +RPV + +  V+L+  +S+ Q++ VDE NQI+  N+W+   WND    W+P+DYG +  L IP+ +IW PD+VLYNNA G + +      K +V + G V W PP IFKS C I+V FFPFD Q C LK G+WT++   I+L     K                 I+L ++  + EW ++     ++   Y CC E Y DI++++ +RR  LFY I +I PCL IS LTILVFYLP+D GEKV+L +S+LLSLTVF L+I +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WV+  F   LPK++FM +P+        Q Y D  + +I     + F++D + +  Q K           TR +++         SG  +  EI  A+E V  I  ++K ++    ++DDWKYVA+V+DR+FLW+F +  I+G  G+F+Q    +D
Sbjct:   29 HRLYEDLLK--SYNPYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHV--DDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGSK-----------------INLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPEIREAIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQPLLFSD 489          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 342.813 bits (878), Expect = 3.534e-111
Identity = 198/476 (41.60%), Postives = 288/476 (60.50%), Query Frame = 3
Query:  183 RRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPD--------QDYRDNETDDIP----ETFHEDETDSNIQDKW---------STRRAAV---------SGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
             RLY+DL++   Y+P +RPV + +  V+L+  +S+ Q++ VDE NQI+  N+W+   WND    W+P+DYG +  L IP+ +IW PD+VLYNNA G + +      K +V + G V W PP IFKS C I+V FFPFD Q C LK G+WT++   I+L     K                 I+L ++  + EW ++     ++   Y CC E Y DI++++ +RR  LFY I +I PCL IS LTILVFYLP+D GEKV+L +S+LLSLTVF L+I +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WV+  F   LPK++FM +P+        Q Y D  + +I     + F++D + +  Q K           TR +++         SG  +  EI  A+E V  I  ++K ++    ++DDWKYVA+V+DR+FLW+F +  I+G  G+F+Q
Sbjct:   32 HRLYEDLLK--SYNPYIRPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHV--DDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIGSK-----------------INLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQDSSCACGQLKRLYTSDTACNVTRGSSLESMYNLGLHSGSGLSPEIREAIEDVHFIAENMKAQDEAKEVQDDWKYVAMVIDRIFLWVFVLVCILGTAGLFLQ 486          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 334.339 bits (856), Expect = 1.074e-107
Identity = 203/518 (39.19%), Postives = 294/518 (56.76%), Query Frame = 3
Query:  102 QFELIFTMICLGFLFGLIFIVQG--TKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKK--PDQDYRDNETDDIPETFHEDETDSNIQDKWS---------------------TRRAAVSGDNVVN---------------------EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFM 1517
            QF +   + CL  L   +   QG  T    RL+  L    GY+   RPV + +  V++   LS+ Q++DVDEKNQ++  N+W+ QEWND    WDP ++GN+T L +PS  IW PD+VLYNNA G  + A +  TK  +   G+V W PP I+KS C I+V FFPFD+Q C +K G+WT++   IDL                  +++  +DL  Y  + EW ++  +   N + Y CC E Y D+++   +RR  LFY INLI PCL IS LT+LVFYLP++ GEK++L IS+LLSLTVF LLI +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H RSP TH M  WVR      +P+ L M +  P  +   +    +  T+H  ET+ + +++                       +    + G   ++                     +I+ ALEGV  I  H++ E++ S++++DWKYVA+V+DR+FLWLF I   +G +G+F+
Sbjct:    9 QFWIHLYLWCL-LLMPAVLAQQGSHTHAEDRLFKHLFG--GYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADG--EFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE-----------------QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRPLPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLPDSSMGVLYGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFL 504          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 334.339 bits (856), Expect = 1.074e-107
Identity = 203/518 (39.19%), Postives = 294/518 (56.76%), Query Frame = 3
Query:  102 QFELIFTMICLGFLFGLIFIVQG--TKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKK--PDQDYRDNETDDIPETFHEDETDSNIQDKWS---------------------TRRAAVSGDNVVN---------------------EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFM 1517
            QF +   + CL  L   +   QG  T    RL+  L    GY+   RPV + +  V++   LS+ Q++DVDEKNQ++  N+W+ QEWND    WDP ++GN+T L +PS  IW PD+VLYNNA G  + A +  TK  +   G+V W PP I+KS C I+V FFPFD+Q C +K G+WT++   IDL                  +++  +DL  Y  + EW ++  +   N + Y CC E Y D+++   +RR  LFY INLI PCL IS LT+LVFYLP++ GEK++L IS+LLSLTVF LLI +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H RSP TH M  WVR      +P+ L M +  P  +   +    +  T+H  ET+ + +++                       +    + G   ++                     +I+ ALEGV  I  H++ E++ S++++DWKYVA+V+DR+FLWLF I   +G +G+F+
Sbjct:    9 QFWIHLYLWCL-LLMPAVLAQQGSHTHAEDRLFKHLFG--GYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADG--EFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE-----------------QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMNRPLPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEEDENICMCAGLPDSSMGVLYGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHYIADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFL 504          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 330.102 bits (845), Expect = 2.802e-106
Identity = 190/494 (38.46%), Postives = 287/494 (58.10%), Query Frame = 3
Query:  126 ICL---GFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRD----------------------NETDDIPETFH-EDETDSNIQDKWSTRRAA---VSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
            +CL   GFL  L     G +   +L+  L     Y+  +RPV++ +  V ++  L++ Q+ +VDE NQI+  N+W+   W D    WDP +Y  +  L +P+  IW PD+VLYNNA GD+ +     TK ++ +DG + W PP IFKS C +++ FFPFD Q C LK G+WT++   IDL     K                 +D++ +  N EW++++ S  ++   Y CC E Y DI+++  +RR  +FY INLI PCL ISFLT+LVFYLP+D GEKV+L IS+LLSLTVF L+I +  P TS+V+PL+ +YLLFTMI VTLS++ TV VLNIH+R+P TH M  WV+++F    P +L M+KP    ++                       E+  + E  H +  +D     + S+++ A          +++E  +E V+ I  ++K  N  + + DDWKY+A+V+DR+FLW+F I  + G +G+F+Q
Sbjct:   14 LCLWLCGFL-ALFKGSTGCESEEQLFHRLFAH--YNRFIRPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQV--EGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSK-----------------VDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMMRKPLDKTKEAGGVKDPKSHTKRPAKVKFTHRGESKLLKECHHCQKSSDIAPGKRRSSQQPARWVAENSEHSSDVEDVIESVQFIAENMKSHNETNEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVGLFLQ 485          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 329.331 bits (843), Expect = 5.862e-106
Identity = 190/491 (38.70%), Postives = 285/491 (58.04%), Query Frame = 3
Query:  159 IVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRD--------------------NETDDIPETF-----------HEDETDSNIQDKWSTRRAAVSGDNVVN------EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
            +   ++   RL+  L     Y+  +RPV + +  V++   +S+ Q++ VDE NQI+  N+W+ Q WND    W P+DY  V  + +P+ +IW PD+VLYNNA GD+ +     TK ++ + G V W PP IFKS C I+V +FPFD Q C +K G+W+++   IDL                   I  +++L  Y  + EW +++    ++   Y CC E Y DI++++ +RR  LFY INLI PCL ISFLT+LVFYLP+D GEKV+L IS+LLSLTVF L+I +  P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WV++VF + LP+++FM +P     D                     ++    E +           H     SN     +   ++ S D V++      EI+ A++ V+ I  ++K +N    ++DDWKYVA+V+DR+FLW+F +  I+G  G+F+Q
Sbjct:   22 VASASEAEHRLFQYLFE--DYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQV--DDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL-----------------VLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKTRNFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGTAGLFLQ 491          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 329.331 bits (843), Expect = 6.305e-106
Identity = 190/491 (38.70%), Postives = 285/491 (58.04%), Query Frame = 3
Query:  159 IVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRD--------------------NETDDIPETF-----------HEDETDSNIQDKWSTRRAAVSGDNVVN------EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
            +   ++   RL+  L     Y+  +RPV + +  V++   +S+ Q++ VDE NQI+  N+W+ Q WND    W P+DY  V  + +P+ +IW PD+VLYNNA GD+ +     TK ++ + G V W PP IFKS C I+V +FPFD Q C +K G+W+++   IDL                   I  +++L  Y  + EW +++    ++   Y CC E Y DI++++ +RR  LFY INLI PCL ISFLT+LVFYLP+D GEKV+L IS+LLSLTVF L+I +  P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WV++VF + LP+++FM +P     D                     ++    E +           H     SN     +   ++ S D V++      EI+ A++ V+ I  ++K +N    ++DDWKYVA+V+DR+FLW+F +  I+G  G+F+Q
Sbjct:   27 VASASEAEHRLFQYLFE--DYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQV--DDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDL-----------------VLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKTRNFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILVCILGTAGLFLQ 496          
BLAST of acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P91766|ACH1_MANSE (Acetylcholine receptor subunit alpha-like OS=Manduca sexta OX=7130 GN=ARA1 PE=2 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 2.019e-138
Identity = 228/501 (45.51%), Postives = 321/501 (64.07%), Query Frame = 3
Query:  138 FLFGLIFIVQGTK---DARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNET------DDIPETFHEDETDSNIQDKWSTRRA--------------------AVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPM 1553
            +L G++    G     DA+RLYDDL+    Y+  VRPV + +  + + + L L Q++DV+ KNQI+  N+WV Q W D    W+P +YG V  L++PS  IW PD+VLYNNA G++++  +  TK  +N+ G V W+PP I+KS C I+VE+FPFD+Q C +K G+WT++GF +DLRH  +   +          ++  +DLS++  +VEWD+LEV A RN +FY CC EPYLDI+FN+++RR+TLFY +NLI PC+ ISFLT+LVFYLP+DSGEKVSLSISILLSLTVFFLL+ +I PPTS+VVPL+ K++LFTMIL T S+  TV+VLN+H+RSP TH M+PWVR VF   LP+LL M++P      + +          ET   DE    +                             A+   +   E+  A++G+  I    +KE   + +++DWKYVA+VLDR FLW+F++A ++G  GI +QAPTL D   P+
Sbjct:    8 YLHGVVLFATGCAGNPDAKRLYDDLLS--NYNKLVRPVLNVSDALTVRIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLSWEPREYGGVEMLHVPSDHIWRPDIVLYNNADGNFEVTLA--TKATLNYTGRVEWRPPAIYKSSCEIDVEYFPFDQQTCVMKFGSWTYDGFQVDLRHIDEVRGTNV--------VELGVDLSEFYTSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFLTVLVFYLPSDSGEKVSLSISILLSLTVFFLLLAEIIPPTSLVVPLLGKFVLFTMILDTFSICVTVVVLNVHFRSPQTHTMSPWVRRVFIHVLPRLLVMRRPHYRLDPHRSRFAGLVTGAGETTLWDEGSPGVPAPPRPPPCAPPLAPCAACAPAEAPALCDALRRWHRCPELHKAIDGINYIADQTRKEEESTRVKEDWKYVAMVLDRPFLWIFTLAVVVGSAGIILQAPTLYDERAPI 496          
BLAST of acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P25162|ACH4_DROME (Acetylcholine receptor subunit beta-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRbeta2 PE=2 SV=3)

HSP 1 Score: 399.053 bits (1024), Expect = 5.612e-132
Identity = 221/483 (45.76%), Postives = 316/483 (65.42%), Query Frame = 3
Query:  165 QGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPD---QDYRD--------NETD------DIPETFHEDE---TDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPM 1553
            +   D +RLYDDL+    Y+  +RPV + T T+ +++ L L Q+++V+ KNQ++  N+WV Q W D    WDP +YG V +L +PS  IW PD+VLYNN  G++++  +  TK  + + G V W+PP I+KS C +NVE+FP+D+Q+C +K G+WT+NG  +DL+H  Q   S          +   IDL+++  +VEWD+LEV A +N E+YP   EP+ DI+F +++RR+TLFY +NLI PC+A++FLT+LVFYLP+DSGEKV+L ISIL+SLTVFFLL+ +I PPTS+ VPL+ KYLLFTMILV+LSV  TV VLNIH+RSP TH M+P VR +F   +PKL+ M++      DY D        NE D      D P  F + +    D+ +Q+  S     V   N+  E+  AL  VR I  HIK  +  + + +DWK+V++VLDR FLWLF+++ + G L I  Q+P+L D   P+
Sbjct:   25 EANPDTKRLYDDLLS--NYNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEV--TLMTKATLKYTGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQIPGSNL--------VQVGIDLTEFYLSVEWDILEVPATKNEEYYPDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLNIHFRSPSTHNMSPLVRKLFLHFMPKLMMMRRTQYTLPDYDDSTPSNGYTNEIDVRDSISDFPSEFKDSQDGAYDNGMQN--SVDSDNVIPRNLTPEVLQALRAVRFIAQHIKDADKDNEIVEDWKFVSMVLDRFFLWLFTLSCVFGTLAIICQSPSLYDTRSPI 493          
BLAST of acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P17644|ACH2_DROME (Acetylcholine receptor subunit alpha-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha2 PE=2 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 1.349e-123
Identity = 196/364 (53.85%), Postives = 265/364 (72.80%), Query Frame = 3
Query:  162 VQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDI 1253
            VQ   DA+RLYDDL+    Y+  +RPV + T TVL+ + L L Q++D++ K+QI+  N+W+  EW D  F WDP++YG VTEL +PS  IW PD+VLYNNA G++    ++ TK I+++ G V+W PP IFKS C I+V +FPFD+Q C +K G+WT++G  IDL+H +QKN      DN   K++  IDL +Y  +VEWD+L V A+R+ ++YPCC EPY DI FN++LRR+TLFY +NLI PC+ IS+L++LVFYLPADSGEK++L ISILLS T+FFLLI +I P TS+ +PL+ KYLLFTM+LV LSV+ T+++LNIH+R P THKM PW+RS F   LPKLL M+ P    RD   + I
Sbjct:   39 VQANPDAKRLYDDLLS--NYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEY--VVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDK----DN---KVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDLLRDLAANKI 391          

HSP 2 Score: 68.5514 bits (166), Expect = 8.024e-11
Identity = 29/66 (43.94%), Postives = 47/66 (71.21%), Query Frame = 3
Query: 1347 EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNA 1544
            E+E A+  V  I HH+++++ ++A   DW +VA+V+DRLFLWLF IA+++G   I  +AP+L D+ 
Sbjct:  489 ELEKAIHNVMFIQHHMQRQDEFNAEDQDWGFVAMVMDRLFLWLFMIASLVGTFVILGEAPSLYDDT 554          
BLAST of acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P23414|ACH1_SCHGR (Acetylcholine receptor subunit alpha-L1 OS=Schistocerca gregaria OX=7010 PE=2 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 4.135e-122
Identity = 192/349 (55.01%), Postives = 259/349 (74.21%), Query Frame = 3
Query:  177 DARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQ 1223
            DA+RLYDDL+    Y+  +RPV + T TVL+ + L L Q++D++ K+QI+  N+W+  EW D  F WDP +YG VTEL +PS  IW PD+VLYNNA G++    ++ TK +++H G V+W PP IFKS C I+V +FPFD+Q C +K G+WT++G  IDL+H  QK      +D+   K+   IDL +Y  +VEWD+L V A+R+ ++YPCC EPY DI FN++LRR+TLFY +NLI PC+ IS+L++LVFYLPADSGEK++L ISILLS T+FFLLI +I P TS+ +PL+ KYLLFTM+LV LSV+ T++VLN+H+R P THKMAPWVR VF   LPKLL M+ P+Q
Sbjct:   26 DAKRLYDDLLS--NYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFRWDPAEYGGVTELYVPSEHIWLPDIVLYNNADGEY--VVTTMTKAVLHHTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHINQK------YDDNKVKV--GIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIVPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMVLVGLSVVITIMVLNVHYRKPSTHKMAPWVRKVFIRRLPKLLLMRVPEQ 362          

HSP 2 Score: 70.4774 bits (171), Expect = 2.337e-11
Identity = 30/69 (43.48%), Postives = 48/69 (69.57%), Query Frame = 3
Query: 1347 EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPM 1553
            E+E A+  V  I +H+++++ + A   DW +VA+VLDRLFLW+F+IA+I+G   I  +AP L D+  P+
Sbjct:  471 ELEKAIHNVLFIQNHMQRQDEFDAEDQDWGFVAMVLDRLFLWIFTIASIVGTFAILCEAPALYDDTKPI 539          
BLAST of acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Match: sp|P09478|ACH1_DROME (Acetylcholine receptor subunit alpha-like 1 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha1 PE=2 SV=2)

HSP 1 Score: 367.851 bits (943), Expect = 3.765e-119
Identity = 198/361 (54.85%), Postives = 263/361 (72.85%), Query Frame = 3
Query:  141 LFGLIFIVQ-------GTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLL 1202
            LF  +FI            DA+RLYDDL+    Y+  +RPV + +  + + M L L Q++DV+ KNQI+  N+WV QEWND    W+P+DYG V  L++PS  IW PD+VLYNNA G++++  +  TK I++H G V+WKPP I+KS C I+VE+FPFD+Q C +K G+WT++G+++DLRH  Q   S    DN    I+  IDL  Y  +VEWD++ V A RN +FY CC EPYLDI FN++LRR+TLFY +NLI PC+ ISFL++LVFYLP+DSGEK+SL ISILLSLTVFFLL+ +I PPTS+ VPL+ KYLLFTM+LVTLSV+ T+ VLN+++RSP TH+MAPWV+ +F   LPKLL
Sbjct:    5 LFAAVFIALHFATGGLANPDAKRLYDDLLSN--YNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEV--TIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADS----DN----IEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQRLFIQILPKLL 353          

HSP 2 Score: 79.7221 bits (195), Expect = 2.839e-14
Identity = 32/69 (46.38%), Postives = 51/69 (73.91%), Query Frame = 3
Query: 1347 EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPM 1553
            E+E  +EG R I  H+K ++ + ++ +DWKYVA+VLDR+FLW+F+IA ++G   I +QAP+L D + P+
Sbjct:  476 EMEKTIEGSRFIAQHVKNKDKFESVEEDWKYVAMVLDRMFLWIFAIACVVGTALIILQAPSLYDQSQPI 544          
BLAST of acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A1I8G5C2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 323/461 (70.07%), Postives = 378/461 (82.00%), Query Frame = 3
Query:  204 MRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQ----ASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPE----------TFHEDETDSN--IQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTD 1538
            M R  Y  SVRPV +Y+  VLLYMNLSL QILDVDEKNQI+ LNMWV+Q+W+DPNFVW+P  YGN+TEL+IPS +IWTPDLVLYNNAGGDWDL SS+N KV V  DG++LW+PPIIFKSQC INVEFFPFD Q C LK+GTWTHNG+LIDLRH AQK ++      +FDNC A IDYAIDLSQ+V+NVEWD+LEV+AKRNIE Y CC EPYLD++F++++RR+TLFYG+NLICPCLAISFLTILVFYLP +SGEK+SLSI+ILLSLTVFFLLIFDI PPTS+VVPLILKYLLFTMILVTLSVMATV+VLN+HWRSPDT+ MAPWVR VF  TLPKLL MKKP+ + R  E   IP            F  DE D    ++++  +RR A++   ++NEIELALEGVR I  H+KKE+  + +RDDWKYVAVVLDRLF+WLFS AAIIG LGIFMQAP+L D
Sbjct:    1 MNRTNYRSSVRPVTNYSQPVLLYMNLSLTQILDVDEKNQIVTLNMWVSQQWHDPNFVWNPAHYGNITELHIPSEDIWTPDLVLYNNAGGDWDLGSSAN-KVNVLSDGTILWRPPIIFKSQCEINVEFFPFDTQNCTLKLGTWTHNGYLIDLRHVAQKEEADRNGWRNFDNCKAYIDYAIDLSQFVDNVEWDILEVAAKRNIEKYKCCPEPYLDLTFSLNIRRKTLFYGVNLICPCLAISFLTILVFYLPGESGEKMSLSINILLSLTVFFLLIFDICPPTSLVVPLILKYLLFTMILVTLSVMATVIVLNVHWRSPDTYVMAPWVRQVFMRTLPKLLLMKKPETERRKEEV--IPNIGGTDTEALCAFLADEFDDGEVMRERLRSRRTAMTSSGIINEIELALEGVRNIATHMKKEDERNTIRDDWKYVAVVLDRLFMWLFSCAAIIGALGIFMQAPSLRD 458          
BLAST of acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A1I8IIL2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 309/447 (69.13%), Postives = 363/447 (81.21%), Query Frame = 3
Query:  204 MRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQAS----FDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPE----------TFHEDETDSN--IQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAII 1496
            M R  Y  SVRPV +Y+  VLLYMNLSL QILDVDEKNQI+ LNMWV+Q+W+DPNFVW+P  YGN+TEL+IPS +IWTPDLVL   AGGDWDL SS+N KV V  DG++LW+PPIIFKSQC INVEFFPFD Q C LK+GTWTHNG+LIDLRH AQK ++  +    FDNC A IDYAIDLSQ+V+NVEWD+LEV+AKRNIE Y CC EPYLD++F++++RR+TLFYG+NLICPCLAISFLTILVFYLP +SGEK+SLSI+ILLSLTVFFLLIFDI PPTS+VVPLILKYLLFTMILVTLSVMATV+VLN+HWRSPDT+ MAPWVR VF  TLPKLL MKKP+ + R  E   IP            F  DE D    ++++  +RR A++   ++NEIELALEGVR I  H+KKE+  + +RDDWKYVAVVLDRLF+WLFS AAII
Sbjct:    1 MNRTNYRSSVRPVTNYSQPVLLYMNLSLTQILDVDEKNQIVTLNMWVSQQWHDPNFVWNPAHYGNITELHIPSEDIWTPDLVLLQYAGGDWDLGSSAN-KVNVLSDGTILWRPPIIFKSQCEINVEFFPFDTQNCTLKLGTWTHNGYLIDLRHVAQKEEADRNGWRNFDNCKAYIDYAIDLSQFVDNVEWDILEVAAKRNIEKYKCCPEPYLDLTFSLNIRRKTLFYGVNLICPCLAISFLTILVFYLPGESGEKMSLSINILLSLTVFFLLIFDICPPTSLVVPLILKYLLFTMILVTLSVMATVIVLNVHWRSPDTYVMAPWVRQVFMRTLPKLLLMKKPETERRKEEV--IPNIGGTDTEALCAFLADEFDDGEVMRERLRSRRTAMTSSGIINEIELALEGVRNIATHMKKEDERNTIRDDWKYVAVVLDRLFMWLFSCAAII 444          
BLAST of acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A5K3FRC6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 287/511 (56.16%), Postives = 381/511 (74.56%), Query Frame = 3
Query:   90 FVLIQFELIFTMICLGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQ--DYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPMTADNCPSVSSINVTKLTCETK 1616
             VLI + L F + C+  +   +     +    +LY  L  ++ Y P VRPV  + S VLL+MNLSL+QILDVDEK QII +N WVN +W D NF+WDP D+GNVT L +PS++IWTPDL LYNNAGGDWDLASSS+TKVIV++DG+V+W+PPIIFKSQCGINVE+FPFD Q C +KIG WTH+G LIDLRHT+QK  SQ +FDNC ++ID+AIDLS +  +V+WDL+ VSA+RNIEFYPCC+EPYLDI+F + LRR+ LF+G+NLICPC++IS LTILVFYLPADS EK+SLSIS L++LTVFFLL+F+ISPPTS+VVPLI+K+LLFTM+L+  S +ATV+VLNIH R+PDTHK++PW R +F   LPK+L +K+ +     +       P + +   +D  + D        +S    +++IE +L+ VR  V H +++   + +R +W+YVA V+DRL LW+F+ A + G++ IFMQAPTL      +TA   PSV +INVT+L+CETK
Sbjct:   12 LVLIFYALFFNVSCIKIVNSELL---PSGSDWKLYKYLTTKKNYSPFVRPVTRHESAVLLFMNLSLIQILDVDEKRQIIKMNAWVNLDWKDHNFMWDPKDHGNVTSLILPSQDIWTPDLALYNNAGGDWDLASSSSTKVIVHYDGTVIWRPPIIFKSQCGINVEYFPFDMQNCSMKIGCWTHHGLLIDLRHTSQKANSQPTFDNCRSQIDHAIDLSMFTTDVQWDLIGVSARRNIEFYPCCSEPYLDITFYIILRRKPLFFGVNLICPCISISILTILVFYLPADSREKISLSISTLIALTVFFLLVFEISPPTSLVVPLIVKFLLFTMVLIIFSTIATVIVLNIHTRTPDTHKISPWTRHIFIEVLPKVLRIKRYEHPGSKQIGRLSRSPPSLYVQNSDCVLTDFNQHMMEGLS----IDQIEASLDKVRHTVLHFRQQEKRNKIRSEWRYVAFVIDRLLLWMFAGATMAGIVSIFMQAPTLHTKERALTALTAPSVDAINVTRLSCETK 515          
BLAST of acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A0R3UQ15 (Uncharacterized protein (Fragment) OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9959 PE=3 SV=1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 281/479 (58.66%), Postives = 369/479 (77.04%), Query Frame = 3
Query:  186 RLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQ--DYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPMTADNCPSVSSINVTKLTCETK 1616
            +LY  L  ++ Y P VRPV  + S VLL+MNLSL+QILDVDEK QII +N WVN +W D NF+WDP D+GNVT L +PS++IWTPDL LYNNAGGDWDLASSS+TKVIV++DG+V+W+PPIIFKSQCGINVE+FPFD Q C +KIG WTH+G LIDLRHT+QK  SQ +FDNC ++ID+AIDLS +  +V+WDL+ VSA+RNIEFYPCC+EPYLDI+F + LRR+ LF+G+NLICPC++IS LTILVFYLPADS EK+SLSIS L++LTVFFLL+F+ISPPTS+VVPLI+K+LLFTM+L+  S +ATV+VLNIH R+PDTHK++PW R +F   LPK+L +K+ +     +       P + +   +D  + D        +S    +++IE +L+ VR  V H +++   + +R +W+YVA V+DRL LW+F+ A + G++ IFMQAPTL      +TA   PSV +INVT+L+CETK
Sbjct:   26 KLYKYLTTKKNYSPFVRPVTRHESAVLLFMNLSLIQILDVDEKRQIIKMNAWVNLDWKDHNFMWDPKDHGNVTSLILPSQDIWTPDLALYNNAGGDWDLASSSSTKVIVHYDGTVIWRPPIIFKSQCGINVEYFPFDMQNCSMKIGCWTHHGLLIDLRHTSQKANSQPTFDNCRSQIDHAIDLSMFTTDVQWDLIGVSARRNIEFYPCCSEPYLDITFYIILRRKPLFFGVNLICPCISISILTILVFYLPADSREKISLSISTLIALTVFFLLVFEISPPTSLVVPLIVKFLLFTMVLIIFSTIATVIVLNIHTRTPDTHKISPWTRHIFIEVLPKVLRIKRYEHPGSKQIGRLSRSPPSLYVQNSDCVLTDFNQHMMEGLS----IDQIEASLDKVRHTVLHFRQQEKRNKIRSEWRYVAFVIDRLLLWMFAGATMAGIVSIFMQAPTLHTKERALTALTAPSVDAINVTRLSCETK 500          
BLAST of acetylcholine receptor subunit alpha-like vs. TrEMBL
Match: A0A1I8IHE7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 294/469 (62.69%), Postives = 356/469 (75.91%), Query Frame = 3
Query:  123 MICLGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQS----QASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNET------DDIPETFH--------------EDETDSN--IQDKWSTRRAAVSGDN-VVNEIELALEGV------RRIVHHIKKENSYSAMRDD 1430
            ++CL     L   V G + A++L+ DLM R  Y  SVRPV +Y+  VLLYMNLSL QILDVDEKNQI+ LNMWV+Q+W DPNFVW+ ++YGN++EL+IPS +IWTPDLVLYNNAGGDWDL SS+N KV V  DG++LW+PPIIFKSQC INVEFFPFD Q C LK+GTWTHNG+LIDLRH AQK ++    + SFD+C A IDYAIDLSQ+V+NVEWD+LEV+AKRNIE Y CC EPYLD++F + +RR+TLFYGINLICPCLAISFLTILVFYLP +SGEK+SLSI+ILLSLTVFFLLIFDI PPTS+VVPLILKYLLFTMILVTLSVMATV+VLN+HWRSPDT+ M+PWVR VF  TLPKLL MKKP+ + R  E       DD    F+              EDE      ++ +  +RR A++G + V+NEIELALEG       +  + H+  +N    ++ D
Sbjct:   14 LLCLLVAIHLPVEVSGIEGAKKLFKDLMNRTNYRASVRPVTNYSQPVLLYMNLSLTQILDVDEKNQIVTLNMWVSQQWFDPNFVWNESNYGNISELHIPSEDIWTPDLVLYNNAGGDWDLGSSAN-KVNVLSDGTILWRPPIIFKSQCEINVEFFPFDTQNCTLKLGTWTHNGYLIDLRHVAQKEEADRNGRQSFDDCRAVIDYAIDLSQFVDNVEWDILEVTAKRNIETYKCCPEPYLDLTFYLIIRRKTLFYGINLICPCLAISFLTILVFYLPGESGEKMSLSINILLSLTVFFLLIFDICPPTSLVVPLILKYLLFTMILVTLSVMATVVVLNVHWRSPDTYVMSPWVRQVFMRTLPKLLLMKKPETERRKEEVIPNFGGDDSERLFNFAAPGEAGISSADAEDEEAGQEVMRQRLRSRRTAMTGSSGVINEIELALEGAPSLRDNKERMTHLNTQNKMPTIKRD 481          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 345.125 bits (884), Expect = 8.059e-112
Identity = 212/512 (41.41%), Postives = 294/512 (57.42%), Query Frame = 3
Query:  195 DDLMRR--RGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKK--PDQDYR---------------------------DNETD---------------DIPETF--------HEDETDSNIQDKWSTRRAA---------VSGDNVVNEIEL--------ALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFM 1517
            D L ++   GY+   RPV++ T  V++   LS+ Q++DVDEKNQ++  N+W+ QEWND    W P+DY NVT + +PS  IW PD+VLYNNA G  + A +  TK  + H G VLW PP I+KS C I+V FFPFD+Q C +K G+WT++   IDL                  +I+  +DL  Y  + EW ++      N + Y CC E Y DI++   +RR  LFY INLI PCL IS LT+LVFYLP+D GEK++L IS+LLSLTVF LLI +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H RSP THKM  WV+S+F   +P+ LFMK+  PDQ  R                             ETD                IP +F        H  E++  +Q  +  ++           V+  N+  E  L        ALEGV+ I  H++ E++  ++++DWKYVA+V+DR+FLW+F I  ++G +G+F+
Sbjct:   24 DQLFKKLFSGYNKWSRPVRNITDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADG--EFAVTHMTKAHLFHTGKVLWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE-----------------RIENTVDLKDYWESGEWAIVNAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPGWVQSIFLGFIPRWLFMKRPAPDQTRRRLLLNAQEKKQVPNQTSNLSTSRSSWLQQETDVDIGRYQDSNGRAGMGIPASFSFPTATSLHLSESEPLLQSLYDLQQLGHRINLNSRPVNLSNLEPEPRLPFSHSVMQALEGVQYIADHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFL 516          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103031133])

HSP 1 Score: 342.813 bits (878), Expect = 2.239e-111
Identity = 203/469 (43.28%), Postives = 289/469 (61.62%), Query Frame = 3
Query:  171 TKDARRL------YDDLMRRR--GYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDD--------IPETFHE----DETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFM 1517
            TK AR L       D+L ++   GY+   RPV + +  V++   LS+ Q++DVDEKNQ++  N+W+ QEWND    W P+DY NVT + +PS  IW PD+VLYNNA G  + A +  TK  + + G V W PP I+KS C I+V FFPFD+Q C +K G+WT++   IDL                  +++  +DL  Y  + EW ++      N + Y CC E Y DI++   +RR  LFY INLI PCL IS LT+LVFYLP+D GEK++L IS+LLSLTVF LLI +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H RSP TH+M  WV +VF   +P+ LFM++P  D R  +           +P + H     + T+   ++    +R+ +S       I  ALEGV  I  H++ E++  ++++DWKYVA+V+DR+FLW+F I  ++G +G+F+
Sbjct:   40 TKVARNLGTHSHAEDELFKKLFIGYNKWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADG--EFAVTHMTKAHLFYTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE-----------------RLETMVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPGTHEMPHWVHAVFLDLIPRWLFMRRPAPDSRRRQRLLLLQQGMACLPNSRHSGARINHTNRPTEED---QRSPLSP-----SIMQALEGVHYIADHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTIGLFL 481          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna3 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:103025148])

HSP 1 Score: 336.65 bits (862), Expect = 2.434e-109
Identity = 188/461 (40.78%), Postives = 279/461 (60.52%), Query Frame = 3
Query:  168 GTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPE---TFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDN 1541
             ++   RL+  +     Y+  +RPV++ +  V++   +S+ Q++ VDE NQI+  N+W+   WND    WDP D+G V  + +PS  IW PD+VLYNNA GD+ +     TK ++ ++G V W PP IFKS C I+V +FPFD Q C +K G+WT++   IDL                   I   I+L  +  + EW +++    ++   Y CC E Y DI++++ +RR  LFY IN+I PCL ISFLT+LVFYLP+D GEKV+L IS+LLSLTVF L+I +  P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WVR VF   LP+++FM +PD+D    +         T H   +      K       ++   +  E+  A+E V+ I  +++ +N    ++DDWKYVA+V+DR+FLW+F +  I+G  G+F+Q   L ++
Sbjct:   21 ASEAEHRLFSVIFS--SYNQYIRPVENVSDPVIVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNRIWKPDIVLYNNAVGDFQV--DDKTKALLRYNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDL-----------------VLIGSTINLKDFWESGEWMIIDAPGYKHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRRVFLGLLPRVMFMTRPDRDPERPQVSGSSARSCTLHNSSSFPQHLTKPLGPVRLLAFSALSPEVREAIESVKYIAENMRLQNEAKEVQDDWKYVAMVIDRIFLWVFILVCILGTAGLFLQPLLLVED 460          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrna6 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:103022127])

HSP 1 Score: 329.331 bits (843), Expect = 8.486e-107
Identity = 181/435 (41.61%), Postives = 269/435 (61.84%), Query Frame = 3
Query:  219 YDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKP-DQDYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
            Y+  +RPV++ +  V +   +S+ Q++ VDE NQI+  N+W+   WND    W P ++  +  + +PS +IW PD+VLYNNA GD+ +     TK ++  DG++ W PP IFKS C +++ +FPFD Q C +K G+WT++   IDL     K                 ++L  +  + EW++++    ++   Y CC E Y DI+++  +RR  LFY INLI PCL ISFLT+LVFYLP+D GEKV+L IS+LLSLTVF L+I +  P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WVR+VF   LP+++ M++P DQ     +  + PE    D    + Q         V+   V  EI+ A+E V+ I  +++  N    + DDWKYVA+V+DR+FLW+F +  ++G +G+F Q
Sbjct:   28 YNQFIRPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWIPAEFDGIEYIRVPSNKIWRPDIVLYNNAVGDFLV--EDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGSK-----------------VNLKDFWESGEWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPGWVRTVFLRALPRIMLMRRPIDQSESSTKAKEGPEV---DCGKVSRQLSPQAINTVVAFSVVSPEIKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVLVCVLGTVGLFFQ 440          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 327.405 bits (838), Expect = 8.549e-106
Identity = 196/484 (40.50%), Postives = 277/484 (57.23%), Query Frame = 3
Query:  123 MICLGFLFGLIFIVQGTKDARRLYDDLMRR--RGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDT-HKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNE-----IELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIP 1550
            ++C  F+F L    +       L D L+R   RGY   VRPV     T+ +   L + Q++DVDEKNQ++  N+W+ QEW D    WDP DYG +T + +PS  IW PD+VLY NA G ++   S  TK IV +DG++ W PP  +KS C ++V FFPFD+Q C +K G+WT++G ++DL                 A +D  +D   + +N EW++L+ + +R        + P++  SF   L+R  LFY + LI PCL +SFLT+LVFYLP+D GEK+SLS S+L+SLTVF L+I +I P +S V+PLI +YLLF MI VT S++ TV V+N+H RS  T H MAPWV+S+F   LP+LL M      YR  + +      H  E    ++         V      N+     +E A   VR I  HIKKE+    +  DWK+VA VLDR+FLW F   +++G + IF  A  +  +  P
Sbjct:   10 LLCF-FMFSLSPAPEEYVSLAELEDTLLRNVFRGYQKWVRPVFHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLYENADGRFE--GSLMTKAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDL-----------------ALVDQHVDRKDFFDNGEWEILDATGRRGSRRDGIYSYPFVTYSF--ILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMHGHTDRYRYPDME-----LHSPELKRGMKRGQQRSACGVGVKEEENQAWMSMLEKATSSVRYISRHIKKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSVLGTILIFTPALKMYLSTAP 466          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 324.709 bits (831), Expect = 4.267e-105
Identity = 192/503 (38.17%), Postives = 282/503 (56.06%), Query Frame = 3
Query:  165 QGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKP--------DQDYRDNETDDIPETFHEDE------------TDSNIQDKWSTRRAAVSGDNVVN-------------------------------EIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
            + ++ A RLY  L     Y+P +RPV + +  V++   +S+ Q++ +DE NQI+  N+W+   WND  F W+P  +  +  + +PS +IW PD+VLYNNA GD+ +     TK ++ +DG+V+W PP IFKS C I+V +FPFD Q C +K G+WT++   IDL     K                 I+L  +  + EW +++V   ++   Y CC + Y DI+++V +RR  LFY INLI PCL ISFLT+LVFYLP+D GEKV+LSIS+LLSLTVF L+I +  P TS+V+PLI +YLLFTMI VTLS++ T+ VLN+H+R+P+ H M  WVR VF  TLPK++ ++ P          D   +E D  P      E                I    S+  A VS   +                                 EI   ++ V+ I  +++ ++    + DDWKYVA+V+DR+FLW+F +  I+G  G+F+Q
Sbjct:    3 RASEAASRLYKTLFT--SYNPYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQV--EGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLVGTK-----------------INLKDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIMLLQPPKGSVGTAASPDAVVSEADQQPACLCAGELSAAAASSSSSCQSGGISRASSSMEAHVSSVRLPRLRAADVMSDELSSSSSTESLDALLALCLLSPEIRQVIDSVKYIAENLRTQDEAKEVCDDWKYVAMVVDRIFLWVFVLVCILGTAGLFLQ 484          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 319.316 bits (817), Expect = 1.918e-103
Identity = 189/459 (41.18%), Postives = 269/459 (58.61%), Query Frame = 3
Query:  186 RLYDDLMRR--RGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHK-MAPWVRSVFTSTLPKLLFMKK-------PDQDYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTL 1532
             L D L++R  + Y   VRPV   + TV +   L + Q++DVDEKNQ++  N+W+ QEW D N  W+P+DYG +  + +P+  IW PD+VLY+NA G ++   S  TK +V HDG + W PP I+KS C I+V FFPFD+Q C +K G+WT++G L+DL                   ++  +D  +Y +N EW+ L  +  + +        PY+  SF +  RR  LFY + LI PCL +SFLT+ VFYLP+D GEK+SL  S+L+SLTVF L+I +I P +S V+PLI +YLLF MI VTLS++ TV V+N+H RS  TH  MAPWVR +F   LPK+L M+        PD+  RD+         H  E+  +  ++                I  A++ VR I  HIKKEN    + +DWK+VA V+DR+ LW F   ++ G + IF+  PT+
Sbjct:   33 ELEDRLLKRMLKDYQKWVRPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFE--GSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDL-----------------IMVNSDVDRGEYFDNGEWEFLNATGNKGVRLDGHRFYPYITYSFVI--RRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKILCMRSHVDRYTAPDEADRDHP-GRAGCACHGGESPPSASERL---------------ILTAIDSVRYITRHIKKENEVREVVEDWKFVAQVVDRILLWTFLSVSVFGSILIFL--PTI 452          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 280.411 bits (716), Expect = 3.180e-87
Identity = 157/317 (49.53%), Postives = 204/317 (64.35%), Query Frame = 3
Query:  291 QILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNE 1241
             + D DEKNQ++  N+W+ QEW+D    WDP +Y NVT + +PS  IW PD+VLYNNA GD   A +  TK  + H G V WKPP I+KS C I+V FFPFD+Q C +K G+WT++   IDL   A+                  +DL  Y  + EW ++      N + Y CC + Y DI+++  +RR  LFY INLI PCL IS LT+LVFYLP+D GEK++L IS+LLSLTVF LLI +I P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H RSP TH M  WVR VF   +P+ L M++P    R +E
Sbjct:    9 HLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGD--FAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMARD-----------------VDLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWLVMRRPPPQQRRSE 306          

HSP 2 Score: 62.3882 bits (150), Expect = 1.790e-10
Identity = 21/52 (40.38%), Postives = 44/52 (84.62%), Query Frame = 3
Query: 1362 LEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFM 1517
            ++GV+ I +H++ E+++ ++++DWKYVA+V+DR+FLW+F +  ++G +G+F+
Sbjct:  507 VQGVQYIANHLRAEDAHLSVKEDWKYVAMVIDRIFLWVFIVVCLLGTVGLFL 558          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 248.825 bits (634), Expect = 5.707e-76
Identity = 154/480 (32.08%), Postives = 260/480 (54.17%), Query Frame = 3
Query:  162 VQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEP----YLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDE--------------------TDSNIQDKWSTRRAAVSGDNVV--NEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQA 1523
            V+G +    L  DL   + Y   VRP ++ T  V + + ++L Q++ +      + L+  ++  W DP   WDP +Y N+  + +  + +W PD+ L NN  G++D        V+V++ G+V W PP I++S CG+ V++FPFD Q C +   ++T++   I+L +   +++ +             ID S +  + EW +    +++N       T P    Y DI+F + + R+ LFY IN++ PC+ I+   +  FYLP D+GEK+ L IS+LL+LTVF LL+ D  P TS+ VP+I+ YL+FTM++VT  V+ TV+VLN+H+RSP TH M  WVR +F  +LPK L++++P ++    +   +  T H+                      + S     +S+  A     +VV   E++ A++ V  I  H+  +  +  +++DW+YVA+V+DR+F   F +   +G  GIF  A
Sbjct:   18 VRGLEAEENLLKDLFVVQQYKTLVRPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDFGLY--VHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEYALDEHRQEIR--------HIIIDESTFPVSGEWQIKHKPSRKN-------TNPRDPLYQDITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPATHIMPYWVRRIFIHSLPKYLWIERPKKEELAPKLPVL--TQHQQHCHDEYFIRTPPSQALLLLPTSPSFGMTPFSSELAGPDKLHVVLPPELQSAVDAVHYISEHMLSQKEFDELKEDWQYVAMVVDRIFFITFFLITSLGTFGIFFNA 478          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.016 bits (567), Expect = 6.436e-67
Identity = 129/283 (45.58%), Postives = 180/283 (63.60%), Query Frame = 3
Query:  387 DYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRD 1235
            ++  V  L     +IWTPD++LYN+A   +D  ++ +T V+VN+ G+    PP + KS C I+V +FPFD Q CDLK G+WTH+G+LIDL+                       D S Y+ N EWDL+E+  KRN  +Y CC EPY D+++ +++RRRTL+YG+NL+ PC+ IS L++LVF LPADSGEK+SL I++LLSLTVF LL+ +I P TS  VPLI +Y   TMI+V  SV+ TV+VL  H  +PD  KM  WVR +        L MK+P ++  +
Sbjct:    2 EHPGVKNLRFQPHQIWTPDILLYNSADERFD--ATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQMLEA-------------------DTSGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILLDWCAWFLRMKQPGRERHE 263          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42038 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2N9])

HSP 1 Score: 266.159 bits (679), Expect = 9.372e-82
Identity = 170/506 (33.60%), Postives = 259/506 (51.19%), Query Frame = 3
Query:  177 DARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLA-SSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIP----------------------------------------------ETFHEDETDSNIQDKWSTRR------AAVSGDN-----VVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
            D  RL  DL    GY+P +RPV      V + + +S+ QI+DV EK+QII  + WV Q W +P   W+   YG + E+N+   ++WTPDLVLYNNA    D +  +  T++IV+ DG  +W  P+IF S C I +++FPFD Q C LK G+WT +GF +DL+  A     QAS             LS+++ N EWDL+   A RN+  Y CC  PY D++F + LRRR LF+  NLI PC  I  LT L FYLP DSGE++S+ I+ LL++TVF L++ DI PPTS  V +I  +   ++I V ++++ T +VL  H+ S   HKM PWVR +    L K+   ++   D  D+++D I                                                   +DE        +S+ R      AA +  N     +++  E  ++ +  + H  + ++     +++WK  A +LD  F WLF ++  I  + ++++
Sbjct:   49 DEGRLTRDLFA--GYNPKLRPVFHKRENVTVVLGMSVHQIIDVYEKDQIIKTSFWVRQIWYNPFLRWNETFYGGIKEINVSPLQVWTPDLVLYNNADASTDGSLENFKTRIIVSSDGKNMWLAPVIFSSSCTIKIKYFPFDDQYCSLKFGSWTFDGFHLDLKPEA----PQAS-------------LSKFIPNGEWDLIGAPAIRNVLRYDCCPAPYPDVTFTLHLRRRVLFFLFNLIIPCFVIVVLTSLSFYLPPDSGERISVVITNLLAMTVFMLMVADILPPTSDEVSIISIFYSCSIIEVGIALLGTCIVLKYHFCSTSIHKMPPWVRFLVIECLGKVFCRQEHTNDQEDSKSDTIKLDNCKHKLENGLKDPLIKQCNFFGKFGVRERVRSSGMKTTDGGSNLSMTQDDEGRGRGGTPYSSHRNMDDIIAAEASSNSTVFALLSRQESMVKNLEILAHAQRCQDEEDREKNEWKLAASILDNFFCWLFLMSIFISSIVLYVR 535          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 258.455 bits (659), Expect = 1.088e-79
Identity = 152/452 (33.63%), Postives = 247/452 (54.65%), Query Frame = 3
Query:  183 RRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLA-SSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDD-IPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTL 1532
            +RL  DL R   YD  VRPV + +  V +  +LSL+QI+ V+ K+Q++ +++W+ Q+W +P   W+ + YG +  +N+   ++W PD++LYNNA   +        T VI + DG+  W  P  F S C INV +FPFD Q C LK G+WT+ G  + +  T+                  + DLS+YVNN EW LL + AK N  FY CC  P+ D++  + ++R+ L+Y  NLI PC  I+ LT++ F+LP +SGEKV L I++LL++TVF LL+ +  P TS  +PL+ +Y + TM +  +S++AT L+LN   R+P T  M  WV+ +       L +M +  ++ R    D  IP +      +         RR +     +    E  L+ +  +   ++       +R++W+  A+VLDR+F W+  + +++    IF + P +
Sbjct:   39 KRLLADLFR--NYDSEVRPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTMTSTSD-----------------SADLSKYVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVKVII------LDYMARSPRNARLMRDDSVIPPSGRSTPCER--------RRMSTVSSQLNPFTERLLDDINVLAEDVRARQEDERLREEWRCAALVLDRMFFWIMLVTSLMTSFMIFYRDPVM 457          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO43642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY59])

HSP 1 Score: 246.899 bits (629), Expect = 1.827e-77
Identity = 134/303 (44.22%), Postives = 194/303 (64.03%), Query Frame = 3
Query:  186 RLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLA-SSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTL 1091
            +L  DL     Y+PSVRPV   TS+V + + +SL QI+D+DE+NQI++ N+WV Q+WN+P   WDP  +GN+T +N+    +W PDL+LYNNA  D D A     TKV +  DGS LW  PIIFKS C  +V +FPFD+Q C LK G+WT++G  +++     +N +    D             ++V+N EW+L  VSA RN+ FY CC EPY D++F + +RR TLFY +N++ PC  I+ LT+L + LP +SGE+++L ++ LL+  V+ LL+ +I PP + VVPLI  Y    M +VT+
Sbjct:    4 KLLKDLFS--NYNPSVRPVLKATSSVTVQLGVSLHQIIDLDERNQILISNLWVRQKWNNPLLTWDPTHFGNLTSINVDPLRVWRPDLILYNNADRDTDGALDRFYTKVQLKFDGSSLWLAPIIFKSTCKFDVAYFPFDEQSCILKFGSWTYDGLRLNI---VPENGTDIGID-------------KFVSNGEWELTGVSANRNVMFYDCCVEPYPDVTFTLKIRRLTLFYYMNMLIPCFLITGLTLLSYILPPESGERITLVVTSLLAQAVYLLLVSEIMPPVAEVVPLISIYYTTAMFMVTV 288          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO42039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2P0])

HSP 1 Score: 253.062 bits (645), Expect = 8.964e-77
Identity = 164/486 (33.74%), Postives = 268/486 (55.14%), Query Frame = 3
Query:  177 DARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNT-KVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTE-PYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLL---FMKKPDQDYRDNETDDIPETFHEDETDSNIQDKWS-----TRR--AAVSGD-----------------------NVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPT 1529
            D RRL  D+     YD  +RPV S T  V + + L+L QI+DV EK +++ ++++V Q+W +P   W+ ++YG + ++N+    +W PD+ LYNNA   +D +    T K+ VN+ G+  W  P IF + C INV++FPFD+Q C LK G+WT++   +D+       + QAS             +  Y  N EWD +    KR+I +YPCC + P+ D++  + +RR+TL+Y +NLI PC+ I+ L++L F +  DSGE+V L I+ LL+LTVF L++ DI PPTS VVP+I  Y++ + I V L+++AT +V+  +  +PD + M  WV+      L  LL    +K   ++ +  E DD   T H   T + I D         RR  A V G                        N + +++  +EG+ +++ ++++++  ++ RDDW   A V+DR FL LF++  ++  +  F   P+
Sbjct:   68 DERRLLADVFG--SYDNKLRPVLSKTHNVTVKLGLTLNQIMDVIEKFELLSVSLYVRQKWENPLVAWNKSEYGGIVQVNLDPSTLWKPDIYLYNNADSGYDGSLYGFTAKIKVNYSGTNTWLAPKIFTTSCKINVKYFPFDQQECRLKFGSWTYDANSVDIF----PEEDQAS-------------IKGYQKNGEWDFIGFPCKRSILYYPCCPDSPFTDVTCTLIIRRKTLYYWVNLIIPCMLITVLSLLSFIVSTDSGERVGLVITDLLALTVFMLIVADILPPTSEVVPVISIYIICSTIEVGLALVATTIVVQCYHTNPDINVMPFWVKYFICQKLGGLLGITHVKDKKEEEQAKELDDETVTNHMGFTLNQIMDVEGIYDDDERRLLADVFGSYDNKLRPVLSKTHNVTVKLGLTLNQIMDVDHLVEGITKLIDNMEEQDEGNSKRDDWILAATVIDRFFLILFALVILLSTILTFATIPS 534          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Match: EDO44896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG1])

HSP 1 Score: 243.817 bits (621), Expect = 9.753e-74
Identity = 162/502 (32.27%), Postives = 259/502 (51.59%), Query Frame = 3
Query:  189 LYDDLMRRRGYDPSVRPVKSYTST-VLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLA-SSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTH--KMAPWVRSVFTSTLPKLLFMKKP-DQDYRDNETD-----------DIPETFHEDETDSNIQDKWSTRR----AAVSGDNVVNEIEL---------------------------------ALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLT 1535
            L  DL++  GY+    PV     T  ++   L LVQ+++VD+KNQII  N+WV Q W +    WDP+ YG +T + I + +IW PD+VLYN+A  ++        T+VI+NHDG   W  P  F+S C I+V FFPFD+Q C +K G+WT    ++DL   A K+   +S               QY+ + EWDL+  S KRN+E+Y CCT P+ D++     RR+ LFY  NLI PCL I+ + +L F LP +SGE+++LSI++LL++ VF  L  +  P  S  VP++  + +  M+ V LS++AT  VL+IH ++       +  WV+      L K+L +KKP  +D  D  +            D+     + +    + +   + R     AVS D +++  +                                  A +G+  +  H+K +      + +W+Y+A+VLDRLF WLF +  I+    + +++P+++
Sbjct:   15 LLGDLLK--GYNKDAHPVPILNKTQYMVTFGLELVQLVNVDDKNQIITTNVWVRQRWTNLLLKWDPDKYGGITRVRIDASKIWIPDIVLYNSADSEFSGGLEKYKTRVILNHDGVNAWYSPASFRSTCQIDVTFFPFDQQTCFMKFGSWTFE--VVDLDIFADKSPLHSS---------------QYMKSAEWDLIAASKKRNVEYYACCTYPFSDVTVTWVFRRKPLFYVFNLIVPCLIITGMVLLGFMLPPESGERITLSITVLLAMAVFLQLAAENLPRNSDNVPVLGIFYITVMVEVALSLIATCYVLHIHHKNSGIAVVPVPHWVQVYMLGYLGKILGVKKPITEDTYDASSKLDFKRLSMMKRDMERAVGDGKRRFGLSNGGKSGRRLGSRAVSDDLLMDSFDQEDDTNSNSTNQNTTNNTGNNQRTFSVQSSMNTKATQGIIVLADHVKHKRLVEINQGEWRYLAMVLDRLFFWLFVLMIILSA-SVILRSPSIS 496          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000017941.2 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:101168601])

HSP 1 Score: 320.087 bits (819), Expect = 1.476e-102
Identity = 186/480 (38.75%), Postives = 283/480 (58.96%), Query Frame = 3
Query:  168 GTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKP-DQD------------YRDNETDDIPETFHED------------ETDSNIQDKWSTRRAA----VSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
             +K   RL+  L RR  Y+  +RPV++ +  V +   +S+ Q++ VDE NQI+  N+W+   WND    W P ++  +  + +PS +IW PD+VLYNNA GD+ +     TK ++  DG++ W PP IFKS C +++ +FPFD Q C +K G+WT++   IDL     K                 ++L  +  + EW++++    ++   Y CC E Y DI+++  +RR  LFY INLI PCL ISFLT+LVFYLP+D GEKV+L IS+LLSLTVF L+I +  P TS+V+PLI +YLLFTMI VTLS++ TV VLN+H+R+P TH M  WV  VF   LP+++ M++P D+D            Y D +   +     +             ET ++++ K    + +    V+   V  E++ A+E V+ I  +++  N    + DDWKYVA+V+DR+FLW+F    ++G +G+F+Q
Sbjct:   25 SSKAEDRLFRKLFRR--YNQFIRPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLRWTPAEFDGIEFIRVPSNKIWRPDIVLYNNAVGDFLV--EDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGSK-----------------VNLKDFWESGEWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPGWVHLVFLKVLPRIMLMRRPTDEDGKVGGGSLNCLEYGDCKLSSMDGCGAKKCPCPCQHGRETPETAASVRMKHQLSQQSINTVVAFSVVSPEVKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRIFLWVFVTVCLLGTMGLFLQ 483          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrnb2 (cholinergic receptor nicotinic beta 2 subunit [Source:NCBI gene;Acc:101175346])

HSP 1 Score: 317.775 bits (813), Expect = 8.042e-102
Identity = 184/455 (40.44%), Postives = 271/455 (59.56%), Query Frame = 3
Query:  156 FIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQ 1520
            F   G     RL + L+    Y+  +RP  + +  V + + +SL Q++ V E+ Q++  N+W+ QEW D    W P ++  + ++ +PS+ IW PD+VLYNNA G ++++  SN   +V++DGS+ W PP I+KS C I V+ FPFD+Q C L+  +WT++   IDL   A      AS D+             +  + EWD++ +  +RN          Y+DI+++  +RR+ LFY INLI PC+ I+ L ILVFYLP+D GEK++L IS+LL+LTVF LLI  I PPTS+ VPL+ KYL+FTM+LVT S++ +V VLN+H RSP TH M PWV+ VF + LP LLFM++P                 + E      D       ++ G N       A+EGVR I +H+K E+   ++ +DWKYVA+V+DRLFLW+F    + G LG+F+Q
Sbjct:   33 FCSLGADTEERLVEHLLNPAHYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQVMTTNVWLTQEWQDYRLTWVPEEFDGMLKVRLPSKHIWLPDVVLYNNADGVYEVSFYSNA--VVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTLRFRSWTYDRTEIDLVLRAD----VASMDD-------------FTPSGEWDIIALPGRRNEN---PADPAYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMPPWVKLVFLNKLPALLFMRQPRNSCERQRLRQRRRAQEQREVKQFGGDLGGAGGGSMDGLN-----REAVEGVRFIANHMKSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTLGMFLQ 460          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrnb3a (neuronal acetylcholine receptor subunit non-alpha-3 [Source:NCBI gene;Acc:101168098])

HSP 1 Score: 312.768 bits (800), Expect = 4.850e-100
Identity = 185/454 (40.75%), Postives = 263/454 (57.93%), Query Frame = 3
Query:  186 RLYDDLMRR--RGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDT-HKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSG-----DNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQA 1523
             L D L+R   +GY   VRPV+    T+ +   L + Q++DVDEKNQ++  N+W+ QEW D    W+P+DYG +T + +PS  IW PD+VLY NA G ++   S  TK IV  DG++ W PP  +KS C ++V FFPFD+Q C +K G+WT++G ++DL                   +D+ +D   + +N EW++L  + +R          P+L  SF   L+R  LFY + LI PCL +SFLT+LVFYLP+D GEK+SLS S+L+SLTVF L+I +I P +S V+PLI +YLLF MI VT S++ TV V+N+H RS  T H MAPWV+S+F   LP+LL M+     Y   + +                     ++ A+ G        +  +E A   V  I  HI+KE+    +  DWK+VA VLDR+FLW F   +I+G + IF  A
Sbjct:   32 ELEDSLLRNLFKGYQKWVRPVQHANDTITVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDVKLKWNPDDYGGITSIRVPSETIWLPDIVLYENADGRFE--GSLMTKAIVRWDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGNMVDL-----------------VLVDHYVDRKDFFDNGEWEILNATGQRGSRRDEMYWYPFLTYSF--ILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQKLPRLLCMRGHTDRYHFPDIEMRSPELKTRRGAGRRAVPGGQQKGALGGMEDDSQAWLAMLEKATNSVHYISRHIRKEHFIREVVQDWKFVAQVLDRIFLWAFLTVSILGTVLIFTPA 464          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:101162690])

HSP 1 Score: 311.997 bits (798), Expect = 1.660e-99
Identity = 188/457 (41.14%), Postives = 269/457 (58.86%), Query Frame = 3
Query:  195 DDLMRR--RGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSA-----KRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDT-HKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNE-TDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNE-----IELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQA 1523
            DDL++   +GY   VRP++    TV +   L + Q++DVDEKNQ++  N+W+ QEW D    W+P+ YG +T + +PS  IW PD+VLY NA G ++   S  TK IV  +G+V W PP  +KS C ++V FFPFD+Q C +K G+WT++G ++DL                   +D  +D   + +N EW++L  +      K  + FYP  T  ++       L+R  LFY + LI PCL +SFLT+LVFYLP+D GEK+SLS S+L+SLTVF L+I +I P +S V+PLI +YLLF MI VTLS++ TV V+N+H RS  T H M+PWVRS+F   LP+LL M+     Y   E   + P           IQ + S+     + D    E     +E A+  VR I  HI+K++    +  DWK+VA VLDR+FLW+F   +++G + IF  A
Sbjct:   35 DDLLKNLFQGYQRWVRPIQRPNDTVRVRFGLKISQLVDVDEKNQLMTTNVWLRQEWIDYKLRWNPDKYGGITSIRVPSENIWLPDIVLYENADGKFE--GSLMTKAIVKFNGAVTWMPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGNMVDL-----------------VLMDSQVDRKDFFDNGEWEILSATGAKGNRKDGLYFYPFITCSFI-------LKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRSLFLQKLPRLLCMRGHADRYHYPELAPESPALKSRSGGRRGIQ-RMSSGGQQSTYDGKEEEAYSTMLEKAIYSVRYISRHIRKDHFIREVVQDWKFVAQVLDRIFLWIFLSVSVLGTILIFTPA 464          
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Match: ENSORLT00000038695.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 311.997 bits (798), Expect = 7.029e-99
Identity = 198/503 (39.36%), Postives = 280/503 (55.67%), Query Frame = 3
Query:  177 DARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDETDSNIQDKWSTRRA---------------------AVSGDNVV--------------------------NEIELA--LEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTD 1538
            + RRLY DLM    Y+P  RPV + + ++ ++  LSL+QI+DVDEKNQ++  N+W+   WND    W+ +DY  VT +  P   IW PD++LYN+A   +D  ++ +T ++VN  G+  + PP IFKS C I+V +FPFD Q C+LK G+WT+ G+ +DL+                       D+S Y+ N EWDL+EV  +RN  FY CC EPYLDI+F V +RRRTL+YG+NL+ PC+ IS L +LVF LPADSGEK+SL I++LLSLTVF LL+ +I P TS  VPLI +Y   TM++V LSV+ATVLVL  H   PD  KM  W R +  +     L MK+P +D   +  D+  +T     T  ++    ST  +                     A S D+ V                           E+ELA  L+ VR I    + ++   ++ ++WK+ A V+DRL L  FS+  I+  +GI M AP   +
Sbjct:   49 NQRRLYSDLMST--YNPLERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFD--ATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKMLEA-------------------DVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDRVRSACDN--KTRRSSLTSMDLNAPTSTSLSTNGNLLYVGVRGLESLQYSPGATSPDSGVVCGRLITRAGEDEMLLPSSHASSLGNMEMELAKILDEVRYIAKRFRDQDEDESVCNEWKFAASVVDRLCLMAFSLFTILCTIGILMSAPNFVE 526          
BLAST of acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000020665.1 (SMESG000020665.1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 462/462 (100.00%), Postives = 462/462 (100.00%), Query Frame = 3
Query:  123 MICLGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLG 1508
            MICLGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKVSLSISILLSLTVFFLLIFDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLG
Sbjct:    1 MICLGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKVSLSISILLSLTVFFLLIFDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLG 462          
BLAST of acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000056721.1 (SMESG000056721.1)

HSP 1 Score: 451.825 bits (1161), Expect = 1.051e-153
Identity = 239/510 (46.86%), Postives = 346/510 (67.84%), Query Frame = 3
Query:  132 LGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQK----NQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDET----DSNIQD----KWS-------TRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPM-TADNCPSVSSINVTKL 1601
            L F+   I +      AR LYDDL  +    P + PV +  + V++YMNLSL QIL+V+ K+QIIVLN+WV QEWND  F WDP+DYG +TE+ IPS  IW PDLVLYNNAGGDWDL+  S +KV V HDG+++WKPP+I KSQC ++V +FPFD Q C LK+GTWTH+G LIDLRH AQK    +  +  +DNC +KIDYAIDL+ Y+ + EWDLL V+A RNI+ YPCC EPYLD++F++ +RR TLFYG+NLI PCL+ISFLTI+VFYLP  S +K++L IS+ L+L +F L++FD++P TS  VPLI+KYLLFTM +VT S++A++ VLN  +R P+T K++  ++ +F  TLP  L M+    ++++N   +IP +F   ++    D ++ D    KW+         ++  + +    +  LALE +R I +++  +   + +R++W Y+ +V+DRLFL +F++   +G L IF+  P L    + + + D    +++ N T+L
Sbjct:   10 LSFVAIKICVTTAYSAARNLYDDLFNKAHNYPKLLPVVNLETPVIVYMNLSLSQILEVNVKDQIIVLNVWVYQEWNDNRFSWDPSDYGGLTEIQIPSSMIWLPDLVLYNNAGGDWDLSGMSGSKVKVKHDGTIIWKPPVILKSQCEMDVTYFPFDIQTCPLKMGTWTHHGLLIDLRHWAQKVSDLSNERIKYDNCESKIDYAIDLTDYLQSYEWDLLSVTANRNIKKYPCCPEPYLDVTFHIKIRRMTLFYGLNLIFPCLSISFLTIMVFYLPTYSTQKITLCISVFLALNIFILVVFDLTPSTSRSVPLIVKYLLFTMFMVTFSIVASIAVLNFSFRQPETDKLSDNMKKIFLKTLPTYLKMR--SVEFKENS--EIPTSFGSTKSTNYADYSMYDLTWLKWNKGYTEMMNSKSGTAQNFSSAKRNLALESLRSIKYNLLLKTRRNEVRNEWMYMGIVIDRLFLIVFTVIVTLGSLIIFLMPPQLWSQQLVLNSKDAAQMLANSNYTRL 515          
BLAST of acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000014741.1 (SMESG000014741.1)

HSP 1 Score: 358.607 bits (919), Expect = 8.398e-117
Identity = 206/535 (38.50%), Postives = 313/535 (58.50%), Query Frame = 3
Query:  132 LGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDN--------ETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVV--------------------------------------NE----IELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPMTADNCPSVSSI 1586
            +   + LI I    KDA RLY  LM    Y   +RPV      + +Y+ L L Q+ +V+ + + +  N+W+ Q+W D N  W+PN YG VT+L IPS +IW PD+VL+NN  G +++  S  TK  V HDG+V W PP I+KS C INVEFFP+D Q C L   +WT+ G  ++L+H AQKN            ID+A+DL+ +  +VE+D+LE+SA+R++  Y    +P   ++F + +RR+TLFY +NL+ PCLAI FL++L FYLP++SGEKV LSI+IL SLT+FFLL+ +  P TS+V+PLI KYLLFTMIL++LS++ TV +LN+H+RS  +H M  WV+ +F  TLP+LL + +P +  R           T  +    ++  T +N    +  R       N                                        NE    I+ A++ V+ + + ++ ++  + +++DWK+VA+V+DRLFLW FS A ++  LGI +Q+P L D   P+ ++N P+ +++
Sbjct:    8 IAVFYVLIPINHAYKDAIRLYKVLMDGSNYSNYIRPVNYNNDVLTVYLGLRLSQLSEVNMRKETVTTNVWLEQQWIDVNLRWNPNQYGGVTKLYIPSDKIWLPDIVLFNNIDGKYEI--SIKTKATVFHDGTVKWIPPAIYKSSCQINVEFFPYDIQECFLTFASWTYEGSKVNLKHMAQKNVIDIPNATGMVNIDFAVDLTNFYESVEFDILELSAERSLVTY---LQPSPKVTFKILMRRKTLFYTVNLMMPCLAICFLSVLAFYLPSESGEKVYLSITILFSLTLFFLLLVETIPSTSLVIPLIGKYLLFTMILISLSIILTVYILNVHFRSSLSHDMPDWVKQIFLITLPRLLLIDRPKKTIRPKPCKHNSKCSTKFVATENNQPCTSNNTSYSYQYRYMPADASNYTFTSHLTQDSTAQWSVEPKRKVYRSSKQSSKSQLKPDSENELDWKIDRAIDEVQFVANQLRADDESNDIKEDWKFVAMVMDRLFLWTFSSACLMSTLGIILQSPALYDTRKPIHSNNVPNCTNL 537          
BLAST of acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000014741.1 (SMESG000014741.1)

HSP 1 Score: 358.992 bits (920), Expect = 2.273e-116
Identity = 206/535 (38.50%), Postives = 313/535 (58.50%), Query Frame = 3
Query:  132 LGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDN--------ETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVV--------------------------------------NE----IELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPMTADNCPSVSSI 1586
            +   + LI I    KDA RLY  LM    Y   +RPV      + +Y+ L L Q+ +V+ + + +  N+W+ Q+W D N  W+PN YG VT+L IPS +IW PD+VL+NN  G +++  S  TK  V HDG+V W PP I+KS C INVEFFP+D Q C L   +WT+ G  ++L+H AQKN            ID+A+DL+ +  +VE+D+LE+SA+R++  Y    +P   ++F + +RR+TLFY +NL+ PCLAI FL++L FYLP++SGEKV LSI+IL SLT+FFLL+ +  P TS+V+PLI KYLLFTMIL++LS++ TV +LN+H+RS  +H M  WV+ +F  TLP+LL + +P +  R           T  +    ++  T +N    +  R       N                                        NE    I+ A++ V+ + + ++ ++  + +++DWK+VA+V+DRLFLW FS A ++  LGI +Q+P L D   P+ ++N P+ +++
Sbjct:   56 IAVFYVLIPINHAYKDAIRLYKVLMDGSNYSNYIRPVNYNNDVLTVYLGLRLSQLSEVNMRKETVTTNVWLEQQWIDVNLRWNPNQYGGVTKLYIPSDKIWLPDIVLFNNIDGKYEI--SIKTKATVFHDGTVKWIPPAIYKSSCQINVEFFPYDIQECFLTFASWTYEGSKVNLKHMAQKNVIDIPNATGMVNIDFAVDLTNFYESVEFDILELSAERSLVTY---LQPSPKVTFKILMRRKTLFYTVNLMMPCLAICFLSVLAFYLPSESGEKVYLSITILFSLTLFFLLLVETIPSTSLVIPLIGKYLLFTMILISLSIILTVYILNVHFRSSLSHDMPDWVKQIFLITLPRLLLIDRPKKTIRPKPCKHNSKCSTKFVATENNQPCTSNNTSYSYQYRYMPADASNYTFTSHLTQDSTAQWSVEPKRKVYRSSKQSSKSQLKPDSENELDWKIDRAIDEVQFVANQLRADDESNDIKEDWKFVAMVMDRLFLWTFSSACLMSTLGIILQSPALYDTRKPIHSNNVPNCTNL 585          
BLAST of acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Match: SMESG000015383.1 (SMESG000015383.1)

HSP 1 Score: 339.732 bits (870), Expect = 3.380e-110
Identity = 185/494 (37.45%), Postives = 294/494 (59.51%), Query Frame = 3
Query:  168 GTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKXXXXXXXXXXXXXXXXXXXDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRD---------NETDDIPETFHEDETDSNIQDKW---STRRAAVSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLWLFSIAAIIGMLGIFMQAPTLTDNAIPMTADNCPSVSSINVTKLTCET 1613
            G K A +LY  L+    Y+  +RPV+     V  Y  L L Q++D++ ++Q +  N+WV QEW D N  W+P DY  V  L+IPS +IW PD+VLYN A G +++   +  KV   HDG+V W PP +++S C INVEFFP+D Q C +   +WT+N   + L+H  QK    +S  +    I++A+DL  +  +VE+D+LE+SA+R+I  +   +E + +++FN+ +RR+TLFY +NLI PCLA+SFL++LVFYLP  SGEK               + + +  P TS+V+PLI KYLLFT+IL++LS++ TV+VLN+++RS  TH M+PW+R +F   LP +LF+  P    ++         N+T      F E      I + +   S R  ++   ++  +I   +  ++ +V ++K ++  + ++++W++VAVV+DR+FL LF  A +I    I +++P L D   P+  ++ P     N T LT  T
Sbjct:   24 GFKSAVQLYQKLLDENNYNKLIRPVERNEDAVTTYFGLKLTQLIDLNMRDQKLTTNVWVQQEWQDVNLRWNPEDYEGVQLLHIPSNKIWLPDIVLYNTADGKYEVKLMTKAKVF--HDGTVKWTPPAVYRSSCHINVEFFPYDIQNCQMTFASWTYNDHKMVLKHYTQKGIPDSSNTSGTVVINHAVDLRNFYTSVEFDILELSARRHIRQFQGESEKFPEVTFNIIMRRKTLFYTVNLIMPCLAVSFLSVLVFYLPTQSGEK---------------ISLIETIPSTSLVIPLIGKYLLFTIILISLSIIITVIVLNVNFRSTMTHSMSPWIRYIFLKFLPPILFLHSPISKEKEMSERCFMYCNKT-----MFKEASVSKLIYETFMRRSKRSYSLKDASIEEKINRTIADLKYVVDNLKDDDYKNKVQEEWRFVAVVMDRVFLLLFLSACVISTGSIILRSPALYDRRTPLDGNHLP-----NQTLLTYST 490          
The following BLAST results are available for this feature:
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA34.773e-10938.28cholinergic receptor nicotinic alpha 3 subunit [So... [more]
CHRNA34.773e-10938.28cholinergic receptor nicotinic alpha 3 subunit [So... [more]
CHRNA22.729e-10841.27cholinergic receptor nicotinic alpha 2 subunit [So... [more]
CHRNA25.998e-10841.27cholinergic receptor nicotinic alpha 2 subunit [So... [more]
CHRNA61.484e-10739.79cholinergic receptor nicotinic alpha 6 subunit [So... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-385.444e-11443.42Acetylcholine receptor subunit alpha-type unc-38 ... [more]
unc-632.102e-11342.77Acetylcholine receptor subunit alpha-type unc-63 ... [more]
acr-169.498e-10136.25Acetylcholine receptor subunit alpha-type acr-16 ... [more]
acr-115.157e-10037.45AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-81.020e-9937.89AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha45.333e-14447.74gene:FBgn0266347 transcript:FBtr0332872[more]
nAChRbeta25.599e-13345.76gene:FBgn0004118 transcript:FBtr0084681[more]
nAChRalpha21.345e-12453.85gene:FBgn0000039 transcript:FBtr0084639[more]
nAChRalpha21.345e-12453.85gene:FBgn0000039 transcript:FBtr0084640[more]
nAChRalpha41.813e-12150.92gene:FBgn0266347 transcript:FBtr0346707[more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna2a3.350e-11041.44cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrnb5a5.953e-10539.96cholinergic receptor, nicotinic, beta 5a [Source:Z... [more]
chrna38.927e-10538.21cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb5a1.380e-10439.35cholinergic receptor, nicotinic, beta 5a [Source:Z... [more]
chrnb5a1.504e-10440.00cholinergic receptor, nicotinic, beta 5a [Source:Z... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA24.239e-11440.58cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
mppe11.238e-11141.29metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe11.304e-11141.29metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe11.700e-11141.29metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe13.534e-11141.60metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna21.074e-10739.19cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna21.074e-10739.19cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna62.802e-10638.46cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna35.862e-10638.70cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna36.305e-10638.70cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91766|ACH1_MANSE2.019e-13845.51Acetylcholine receptor subunit alpha-like OS=Mandu... [more]
sp|P25162|ACH4_DROME5.612e-13245.76Acetylcholine receptor subunit beta-like 2 OS=Dros... [more]
sp|P17644|ACH2_DROME1.349e-12353.85Acetylcholine receptor subunit alpha-like 2 OS=Dro... [more]
sp|P23414|ACH1_SCHGR4.135e-12255.01Acetylcholine receptor subunit alpha-L1 OS=Schisto... [more]
sp|P09478|ACH1_DROME3.765e-11954.85Acetylcholine receptor subunit alpha-like 1 OS=Dro... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8G5C20.000e+070.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IIL20.000e+069.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A5K3FRC60.000e+056.16Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3UQ150.000e+058.66Uncharacterized protein (Fragment) OS=Mesocestoide... [more]
A0A1I8IHE70.000e+062.69Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna2a8.059e-11241.41cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrna2b2.239e-11143.28neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna32.434e-10940.78neuronal acetylcholine receptor subunit alpha-3-li... [more]
chrna68.486e-10741.61neuronal acetylcholine receptor subunit alpha-3 [S... [more]
chrnb3a8.549e-10640.50cholinergic receptor, nicotinic, beta polypeptide ... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna34.267e-10538.17cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb3b1.918e-10341.18cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna2a3.180e-8749.53cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrnb1l5.707e-7632.08cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
ENSPMAT00000008550.16.436e-6745.58pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420389.372e-8233.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420541.088e-7933.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436421.827e-7744.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420398.964e-7733.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448969.753e-7432.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000017941.21.476e-10238.75neuronal acetylcholine receptor subunit alpha-3-li... [more]
chrnb28.042e-10240.44cholinergic receptor nicotinic beta 2 subunit [Sou... [more]
chrnb3a4.850e-10040.75neuronal acetylcholine receptor subunit non-alpha-... [more]
chrnb3b1.660e-9941.14neuronal acetylcholine receptor subunit non-alpha-... [more]
ENSORLT00000038695.17.029e-9939.36neuronal acetylcholine receptor subunit alpha-7-li... [more]
back to top
BLAST of acetylcholine receptor subunit alpha-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020665.10.000e+0100.00SMESG000020665.1[more]
SMESG000056721.11.051e-15346.86SMESG000056721.1[more]
SMESG000014741.18.398e-11738.50SMESG000014741.1[more]
SMESG000014741.12.273e-11638.50SMESG000014741.1[more]
SMESG000015383.13.380e-11037.45SMESG000015383.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008748 ID=SMED30008748|Name=acetylcholine receptor subunit alpha-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1782bp
GTTTAATGCGTTTGTAAAAATAATTTCTTACTGTCAAATGTTTTATTAAT
GAAAAAATTTAAATTTTATTTACCGCCAAAACATACGAATTTGTTTTAAT
TCAATTCGAATTAATTTTCACAATGATTTGTTTGGGATTTTTATTTGGAT
TGATTTTCATTGTCCAAGGAACAAAAGATGCCAGGCGTCTTTATGACGAC
TTGATGAGACGACGTGGCTATGACCCTTCTGTGAGGCCAGTGAAAAGTTA
TACATCGACAGTTTTGCTCTATATGAATCTCAGTCTCGTACAAATATTAG
ACGTGGATGAAAAAAATCAAATTATCGTGCTCAACATGTGGGTCAACCAA
GAATGGAATGATCCTAATTTTGTTTGGGATCCAAATGATTATGGGAATGT
AACAGAGCTCAATATTCCATCAAGAGAAATATGGACTCCGGATTTAGTTT
TATACAACAATGCAGGTGGTGATTGGGATCTGGCAAGTTCTTCTAATACA
AAGGTTATTGTTAACCACGATGGTTCAGTTCTTTGGAAACCGCCGATCAT
TTTTAAGAGTCAATGTGGAATAAATGTCGAATTCTTTCCTTTTGACAAGC
AGCTTTGCGATTTGAAAATCGGCACTTGGACGCACAATGGATTTCTCATT
GATTTAAGGCACACTGCACAAAAGAATCAAAGTCAGGCCAGTTTCGATAA
TTGTAATGCAAAAATAGACTATGCAATAGACCTAAGTCAATATGTTAACA
ACGTAGAATGGGATTTATTGGAAGTCAGTGCAAAGAGGAATATTGAGTTT
TATCCATGTTGCACTGAGCCATATTTAGATATTAGTTTTAACGTTTCTTT
AAGACGAAGAACTCTTTTTTACGGAATTAATTTGATTTGTCCATGTCTGG
CTATCTCATTTTTGACAATTCTGGTCTTTTATTTACCAGCTGATAGTGGA
GAAAAGGTTTCTTTGAGTATTTCAATTTTGTTATCTTTGACTGTTTTCTT
TTTGCTGATTTTTGATATTTCTCCTCCGACTAGTATTGTTGTTCCTTTAA
TTTTAAAGTACCTCTTGTTTACTATGATTCTAGTAACTTTATCTGTAATG
GCTACTGTATTAGTATTGAATATTCATTGGAGATCTCCAGATACTCATAA
AATGGCTCCTTGGGTGCGAAGTGTTTTTACGTCAACTCTTCCAAAATTAC
TTTTTATGAAAAAACCAGATCAAGACTATCGAGACAATGAGACAGACGAT
ATTCCAGAAACATTTCATGAAGATGAAACTGACAGCAATATTCAAGATAA
ATGGAGTACTCGTCGGGCAGCTGTGTCTGGTGACAATGTTGTCAATGAGA
TAGAATTGGCTCTTGAAGGTGTTAGAAGAATAGTTCATCATATTAAAAAA
GAAAACTCTTATTCCGCCATGAGAGACGATTGGAAGTACGTCGCTGTTGT
TCTTGACCGATTATTTTTATGGTTGTTTAGTATAGCTGCAATCATTGGAA
TGCTGGGGATATTTATGCAGGCTCCGACTCTCACAGATAACGCAATACCC
ATGACGGCTGACAATTGTCCGTCCGTCAGTTCAATTAATGTTACGAAATT
GACTTGTGAAACCAAAGGAACATCATAATATTTTTATACTTTTTTTCCAT
TTATTACTGAATGTTGATTTATTTACAAGTACCGTGAATTGAATTTGTAA
TTAATTAATTAATTTTATCCTATTATTCATTTTTCAAATGATATCCATTA
TAAATTCAAATATAGGAATTGCTAATTCAAAC
back to top

protein sequence of SMED30008748-orf-1

>SMED30008748-orf-1 ID=SMED30008748-orf-1|Name=SMED30008748-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=502bp
MICLGFLFGLIFIVQGTKDARRLYDDLMRRRGYDPSVRPVKSYTSTVLLY
MNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPS
REIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGI
NVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDY
AIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFY
GINLICPCLAISFLTILVFYLPADSGEKVSLSISILLSLTVFFLLIFDIS
PPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRS
VFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDETDSNIQDKWSTRRAA
VSGDNVVNEIELALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRLFLW
LFSIAAIIGMLGIFMQAPTLTDNAIPMTADNCPSVSSINVTKLTCETKGT
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR002394Nicotinic_acetylcholine_rcpt
IPR006201Neur_channel
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR027361Acetylcholine_rcpt_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0006812cation transport
GO:0007165signal transduction
GO:0007271synaptic transmission, cholinergic
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0005892acetylcholine-gated channel complex
GO:0030054cell junction
GO:0045202synapse