Cyclin-K

Overview
NameCyclin-K
Smed IDSMED30008744
Length (bp)1147
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclin-K (SMED30008744) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclin-K (SMED30008744) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclin-K (SMED30008744) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclin-K (SMED30008744) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008744

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008744SMESG000004055.1 SMESG000047115.1 SMESG000004000.1 Contig4425uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008744SMESG000004055.1 SMESG000047115.1 SMESG000004000.1 Contig4425newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008744SMESG000030619.1 Contig4425uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008744SMESG000030619.1 Contig4425newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30008744SMESG000004055.1 SmedASXL_015710SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30008744SMESG000004055.1 dd_Smed_v4_2558_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008744SMESG000004055.1 dd_Smed_v4_2558_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008744SMESG000004055.1 dd_Smed_v4_2558_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008744SMESG000004055.1 dd_Smed_v4_2558_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008744SMESG000004055.1 dd_Smed_v4_2558_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008744SMESG000004055.1 dd_Smed_v4_2558_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008744SMESG000004055.1 dd_Smed_v4_2558_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008744SMESG000004055.1 dd_Smed_v4_2558_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclin-K vs. Ensembl Human
Match: CCNK (cyclin K [Source:HGNC Symbol;Acc:HGNC:1596])

HSP 1 Score: 339.347 bits (869), Expect = 3.309e-114
Identity = 144/245 (58.78%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F +FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  +++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K EI+ W ++ + ++WWE FV+ + ++V+EDICHQILDLYS  K
Sbjct:   18 DHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGK 262          
BLAST of Cyclin-K vs. Ensembl Human
Match: CCNK (cyclin K [Source:HGNC Symbol;Acc:HGNC:1596])

HSP 1 Score: 341.658 bits (875), Expect = 1.412e-112
Identity = 144/245 (58.78%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F +FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  +++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K EI+ W ++ + ++WWE FV+ + ++V+EDICHQILDLYS  K
Sbjct:   18 DHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGK 262          
BLAST of Cyclin-K vs. Ensembl Human
Match: CCNK (cyclin K [Source:HGNC Symbol;Acc:HGNC:1596])

HSP 1 Score: 293.893 bits (751), Expect = 1.206e-98
Identity = 125/208 (60.10%), Postives = 169/208 (81.25%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESW 654
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F +FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  +++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K EI+ W
Sbjct:   18 DHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEW 225          
BLAST of Cyclin-K vs. Ensembl Human
Match: CCNK (cyclin K [Source:HGNC Symbol;Acc:HGNC:1596])

HSP 1 Score: 137.502 bits (345), Expect = 2.444e-39
Identity = 57/92 (61.96%), Postives = 75/92 (81.52%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEET 306
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEET
Sbjct:   18 DHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEET 109          
BLAST of Cyclin-K vs. Ensembl Human
Match: CCNT1 (cyclin T1 [Source:HGNC Symbol;Acc:HGNC:1599])

HSP 1 Score: 149.058 bits (375), Expect = 6.842e-39
Identity = 80/243 (32.92%), Postives = 130/243 (53.50%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEE--------IMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            WYF +E+L N+PS   G+DP  E  YR + A  + ++G +L +   T  TA+VY HRFYM  SF   P    A   LFLA KVEE PKK   ++ +  + L   H  E   D + E        ++ +E I+L+T+ F+L + HP+ +++   Q ++  +     L Q S+    +SL  T   L++ P +VAC  ++LA K +  EI    +   G+ WWE     +T+E+++++ H+ L +
Sbjct:   12 WYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCL---HPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTD---GKHWWEYVDATVTLELLDELTHEFLQI 244          
BLAST of Cyclin-K vs. Ensembl Celegans
Match: ccnk-1 (CyCliN K [Source:UniProtKB/TrEMBL;Acc:O17869])

HSP 1 Score: 171.014 bits (432), Expect = 7.631e-51
Identity = 99/250 (39.60%), Postives = 146/250 (58.40%), Query Frame = 1
Query:   40 MPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLK-YDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGN---DPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERL---VQMSWTFINDSLRTNLCLKWEPEIVACAVLYLA-TKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            M  W +  E L+ TPS+  G+    E  +R EG   +SE+GN L  K   T   A VYFHRFYM HSF++  R +TA  CLFLAGKVE+ PKKC+D+     +     H+ E  +   +  +++M +ER+LL ++KFDL V+ PY  LL+Y  K+     N E++   VQ++WTFINDS+ T LC+  EP+++A A+L+LA T    Q ++    + +   WW + V     E ++  CH +LD Y+  K
Sbjct:    1 MSDWIWPLEALKTTPSIRAGLTKEQELLWRREGIKLLSEVGNALNCKPRPTIGVAAVYFHRFYMIHSFQSFSREVTALSCLFLAGKVEDFPKKCKDVCQAAVT-----HYPEIYSKYQNLVDDVMGLERVLLHSLKFDLHVALPYDALLDY--KMMFPDMNREKITDAVQIAWTFINDSIYTTLCITTEPQMIAIALLHLAFTVKGYQPVQ----KNMDPCWWSADVSNWPQESVDKACHLVLDFYAATK 239          
BLAST of Cyclin-K vs. Ensembl Celegans
Match: ccnk-1 (CyCliN K [Source:UniProtKB/TrEMBL;Acc:O17869])

HSP 1 Score: 171.014 bits (432), Expect = 7.631e-51
Identity = 99/250 (39.60%), Postives = 146/250 (58.40%), Query Frame = 1
Query:   40 MPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLK-YDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGN---DPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERL---VQMSWTFINDSLRTNLCLKWEPEIVACAVLYLA-TKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            M  W +  E L+ TPS+  G+    E  +R EG   +SE+GN L  K   T   A VYFHRFYM HSF++  R +TA  CLFLAGKVE+ PKKC+D+     +     H+ E  +   +  +++M +ER+LL ++KFDL V+ PY  LL+Y  K+     N E++   VQ++WTFINDS+ T LC+  EP+++A A+L+LA T    Q ++    + +   WW + V     E ++  CH +LD Y+  K
Sbjct:    1 MSDWIWPLEALKTTPSIRAGLTKEQELLWRREGIKLLSEVGNALNCKPRPTIGVAAVYFHRFYMIHSFQSFSREVTALSCLFLAGKVEDFPKKCKDVCQAAVT-----HYPEIYSKYQNLVDDVMGLERVLLHSLKFDLHVALPYDALLDY--KMMFPDMNREKITDAVQIAWTFINDSIYTTLCITTEPQMIAIALLHLAFTVKGYQPVQ----KNMDPCWWSADVSNWPQESVDKACHLVLDFYAATK 239          
BLAST of Cyclin-K vs. Ensembl Celegans
Match: cyl-1 (cyclin L [Source:UniProtKB/TrEMBL;Acc:G5EBX3])

HSP 1 Score: 103.605 bits (257), Expect = 4.118e-24
Identity = 65/247 (26.32%), Postives = 114/247 (46.15%), Query Frame = 1
Query:   76 NTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGND--------------------PKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYS 756
            N PSL DG+    E + R  G   I +    L L     AT  + F R+Y   SF           CL LA K+EE P++ R++  +   +       + G+D                     K+ ++  ER +L T+ F + V HP++ ++ Y   +   Q+  + ++Q SW ++ND LRT++ ++++PE +ACA ++LA +  +  I           W+E+F    +   +E I  Q++ LY+
Sbjct:   89 NPPSLVDGLSKETESELRYLGCELIQQGAILLKLPQTAAATGQILFQRYYYQKSFVRYHFEHAVQACLLLASKIEEEPRRPREVYNVFHRLERLHRLQQSGHDINKETTRGMKPPAVDMNYINTKQHMINSERRILATLGFVVHVKHPHRLIVAYGHTLGITQSRPD-ILQRSWNYMNDGLRTDIFMRYKPETIACACIFLAARTVENPIAL---PSTPFHWFEAF--DTSDRDVEAIALQLVGLYA 329          
BLAST of Cyclin-K vs. Ensembl Celegans
Match: cyl-1 (cyclin L [Source:UniProtKB/TrEMBL;Acc:G5EBX3])

HSP 1 Score: 103.605 bits (257), Expect = 4.118e-24
Identity = 65/247 (26.32%), Postives = 114/247 (46.15%), Query Frame = 1
Query:   76 NTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGND--------------------PKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYS 756
            N PSL DG+    E + R  G   I +    L L     AT  + F R+Y   SF           CL LA K+EE P++ R++  +   +       + G+D                     K+ ++  ER +L T+ F + V HP++ ++ Y   +   Q+  + ++Q SW ++ND LRT++ ++++PE +ACA ++LA +  +  I           W+E+F    +   +E I  Q++ LY+
Sbjct:   89 NPPSLVDGLSKETESELRYLGCELIQQGAILLKLPQTAAATGQILFQRYYYQKSFVRYHFEHAVQACLLLASKIEEEPRRPREVYNVFHRLERLHRLQQSGHDINKETTRGMKPPAVDMNYINTKQHMINSERRILATLGFVVHVKHPHRLIVAYGHTLGITQSRPD-ILQRSWNYMNDGLRTDIFMRYKPETIACACIFLAARTVENPIAL---PSTPFHWFEAF--DTSDRDVEAIALQLVGLYA 329          
BLAST of Cyclin-K vs. Ensembl Celegans
Match: cit-1.1 (Cyclin-T1.1 [Source:UniProtKB/Swiss-Prot;Acc:P34425])

HSP 1 Score: 101.293 bits (251), Expect = 2.026e-23
Identity = 64/240 (26.67%), Postives = 118/240 (49.17%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGN--------KLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFS--EFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQK--WWESFVEGMTIEVMEDI 729
            W F KEE++ T S+ +G+    E   R   A FI E+ +        K+ + +     A  + HRFY  HSFK        + C+FLAGK +E P+K   ++++ +   D+K  +     N+  + I+ +E ++L+TI FDL V  P+ Y+L+ ++K+  K+ +   L   ++ F  D +  T+  L++    ++  +++L        IE      + +   W+  F E MT E + ++
Sbjct:   20 WLFTKEEMKKTASIQEGMSREEELASRQMAAAFIQEMIDGLNNVKDPKMKIGHTGLCVAHTHMHRFYYLHSFKKYDYRDVGAACVFLAGKSQECPRKLSHVISVWRERKDRKQLTTETARNEAAQIIVLLESMILQTIAFDLNVHLPHIYVLDIMKKVDKKE-HYRPLTSCAYYFATDVIAVTDWSLRYSAASMSIVIIHLMAAYANVRIERLFADFINEDSPWYAKFDETMTNEKLREM 258          
BLAST of Cyclin-K vs. Ensembl Fly
Match: CycK (gene:FBgn0025674 transcript:FBtr0344022)

HSP 1 Score: 330.487 bits (846), Expect = 6.858e-111
Identity = 143/239 (59.83%), Postives = 189/239 (79.08%), Query Frame = 1
Query:   40 MPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQV-GQKWWESFVEGMTIEVMEDICHQILDLY 753
            MPCWY++K+ELR TPS+ DGI    E +YR EGA FI E G K+GL ++T AT +VYFHRFYMFHSF++ PR++TA CCLF AGKVEETPKKCRDI+   + IL   +F  FG+DPKEE+MT+ERILL+TIKFDLQV HPY +LL Y +  KG Q  ++++VQM+W F+NDSL T +CL+WEPEI+A A+++LA+KL+K  ++ WE +Q   Q+WW+ FV  +T+E++EDICHQ+LDLY
Sbjct:    1 MPCWYYDKKELRETPSILDGISFETERRYRKEGARFIMECGTKMGLGHNTMATGVVYFHRFYMFHSFRSFPRYVTACCCLFFAGKVEETPKKCRDIIKTARGILTDNYFYSFGDDPKEEVMTLERILLQTIKFDLQVEHPYTFLLKYAKCFKGDQQKLQKMVQMAWNFVNDSLSTVVCLQWEPEIIAVALIHLASKLSKFTVQDWEGRQPQQQRWWDMFVSDVTMEILEDICHQVLDLY 239          
BLAST of Cyclin-K vs. Ensembl Fly
Match: CycK (gene:FBgn0025674 transcript:FBtr0085942)

HSP 1 Score: 330.487 bits (846), Expect = 6.858e-111
Identity = 143/239 (59.83%), Postives = 189/239 (79.08%), Query Frame = 1
Query:   40 MPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQV-GQKWWESFVEGMTIEVMEDICHQILDLY 753
            MPCWY++K+ELR TPS+ DGI    E +YR EGA FI E G K+GL ++T AT +VYFHRFYMFHSF++ PR++TA CCLF AGKVEETPKKCRDI+   + IL   +F  FG+DPKEE+MT+ERILL+TIKFDLQV HPY +LL Y +  KG Q  ++++VQM+W F+NDSL T +CL+WEPEI+A A+++LA+KL+K  ++ WE +Q   Q+WW+ FV  +T+E++EDICHQ+LDLY
Sbjct:    1 MPCWYYDKKELRETPSILDGISFETERRYRKEGARFIMECGTKMGLGHNTMATGVVYFHRFYMFHSFRSFPRYVTACCCLFFAGKVEETPKKCRDIIKTARGILTDNYFYSFGDDPKEEVMTLERILLQTIKFDLQVEHPYTFLLKYAKCFKGDQQKLQKMVQMAWNFVNDSLSTVVCLQWEPEIIAVALIHLASKLSKFTVQDWEGRQPQQQRWWDMFVSDVTMEILEDICHQVLDLY 239          
BLAST of Cyclin-K vs. Ensembl Fly
Match: CycK (gene:FBgn0025674 transcript:FBtr0085941)

HSP 1 Score: 330.487 bits (846), Expect = 6.858e-111
Identity = 143/239 (59.83%), Postives = 189/239 (79.08%), Query Frame = 1
Query:   40 MPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQV-GQKWWESFVEGMTIEVMEDICHQILDLY 753
            MPCWY++K+ELR TPS+ DGI    E +YR EGA FI E G K+GL ++T AT +VYFHRFYMFHSF++ PR++TA CCLF AGKVEETPKKCRDI+   + IL   +F  FG+DPKEE+MT+ERILL+TIKFDLQV HPY +LL Y +  KG Q  ++++VQM+W F+NDSL T +CL+WEPEI+A A+++LA+KL+K  ++ WE +Q   Q+WW+ FV  +T+E++EDICHQ+LDLY
Sbjct:    1 MPCWYYDKKELRETPSILDGISFETERRYRKEGARFIMECGTKMGLGHNTMATGVVYFHRFYMFHSFRSFPRYVTACCCLFFAGKVEETPKKCRDIIKTARGILTDNYFYSFGDDPKEEVMTLERILLQTIKFDLQVEHPYTFLLKYAKCFKGDQQKLQKMVQMAWNFVNDSLSTVVCLQWEPEIIAVALIHLASKLSKFTVQDWEGRQPQQQRWWDMFVSDVTMEILEDICHQVLDLY 239          
BLAST of Cyclin-K vs. Ensembl Fly
Match: CycT (gene:FBgn0025455 transcript:FBtr0333124)

HSP 1 Score: 133.65 bits (335), Expect = 1.046e-33
Identity = 78/240 (32.50%), Postives = 134/240 (55.83%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILD---KKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEI-ESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLY 753
            WYF  ++L N+PS   GI    E +YR   A  I E+G +L +      TA+VY HRFY FHSF    R   AS  LFLA KVEE P+K   ++      L    +++++E      +E++  E +LL+T+ FD+ + HP+ +++   Q +K      + L Q S+   ++SL  T++CL++ P +VAC  +YLA K ++ EI +S E    G+ W+    + +++++++ +  + + +Y
Sbjct:   45 WYFSNDQLANSPSRRCGIKGDDELQYRQMTAYLIQEMGQRLQVSQLCINTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEHVIRAANKCLPPTTEQNYAELA----QELVFNENVLLQTLGFDVAIDHPHTHVVRTCQLVKA----CKDLAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTE----GKHWFYYVDKTVSLDLLKQLTDEFIAIY 272          
BLAST of Cyclin-K vs. Ensembl Fly
Match: CycT (gene:FBgn0025455 transcript:FBtr0075205)

HSP 1 Score: 133.65 bits (335), Expect = 1.046e-33
Identity = 78/240 (32.50%), Postives = 134/240 (55.83%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILD---KKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEI-ESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLY 753
            WYF  ++L N+PS   GI    E +YR   A  I E+G +L +      TA+VY HRFY FHSF    R   AS  LFLA KVEE P+K   ++      L    +++++E      +E++  E +LL+T+ FD+ + HP+ +++   Q +K      + L Q S+   ++SL  T++CL++ P +VAC  +YLA K ++ EI +S E    G+ W+    + +++++++ +  + + +Y
Sbjct:   45 WYFSNDQLANSPSRRCGIKGDDELQYRQMTAYLIQEMGQRLQVSQLCINTAIVYMHRFYAFHSFTHFHRNSMASASLFLAAKVEEQPRKLEHVIRAANKCLPPTTEQNYAELA----QELVFNENVLLQTLGFDVAIDHPHTHVVRTCQLVKA----CKDLAQTSYFLASNSLHLTSMCLQYRPTVVACFCIYLACKWSRWEIPQSTE----GKHWFYYVDKTVSLDLLKQLTDEFIAIY 272          
BLAST of Cyclin-K vs. Ensembl Zebrafish
Match: ccnk (cyclin K [Source:NCBI gene;Acc:569432])

HSP 1 Score: 335.88 bits (860), Expect = 1.695e-112
Identity = 145/245 (59.18%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS +D +DP  E +YR EGA FI ++G +LGL YDT AT + YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F++FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  V++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K +I+ W ++Q  ++WWE FV+ + +E++EDICHQILDLYS  K
Sbjct:   20 DHTKPCWYWDKKDLAHTPSQSD-LDPATEARYRREGARFIFDVGTRLGLHYDTLATGITYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFAQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLRYAKQLKGDKNKVQKLVQMAWTFVNDSLCTMLSLQWEPEIIAVAVMYLAGRLCKFDIQEWTSKQSSRRWWEQFVQDVPVELLEDICHQILDLYSQGK 263          
BLAST of Cyclin-K vs. Ensembl Zebrafish
Match: ccnk (cyclin K [Source:NCBI gene;Acc:569432])

HSP 1 Score: 337.806 bits (865), Expect = 6.927e-112
Identity = 145/245 (59.18%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS +D +DP  E +YR EGA FI ++G +LGL YDT AT + YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F++FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  V++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K +I+ W ++Q  ++WWE FV+ + +E++EDICHQILDLYS  K
Sbjct:   20 DHTKPCWYWDKKDLAHTPSQSD-LDPATEARYRREGARFIFDVGTRLGLHYDTLATGITYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFAQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLRYAKQLKGDKNKVQKLVQMAWTFVNDSLCTMLSLQWEPEIIAVAVMYLAGRLCKFDIQEWTSKQSSRRWWEQFVQDVPVELLEDICHQILDLYSQGK 263          
BLAST of Cyclin-K vs. Ensembl Zebrafish
Match: ccnt1 (cyclin T1 [Source:ZFIN;Acc:ZDB-GENE-030131-6397])

HSP 1 Score: 152.525 bits (384), Expect = 2.104e-40
Identity = 77/240 (32.08%), Postives = 136/240 (56.67%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFS-EFGNDP----KEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            WYF +E++ N+PS   G+DP  E  YR + A  + ++G +L +   T  TA+VY HRFYM  SF    R + A   LFLA KVEE P+K   ++ +T + L+ +  S +  +D      ++++ +E I+L+T+ F++ + HP+ +++   Q ++  +     L Q S+    +SL  T  CL++ P IVAC  ++LA K +  EI    +   G+ WW+     +T+E+++++ H+ L +
Sbjct:   15 WYFTREQIENSPSRRAGLDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMVQSFTRFHRNVIAPAALFLAAKVEEQPRKLEHVIKVTHACLNPQDPSPDTRSDTYLQQAQDLVILESIILQTLGFEITIDHPHTHVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFCLQYSPPIVACVCIHLACKWSNWEIPVSTD---GKHWWQYVDPTVTLELLDELTHEFLQI 247          
BLAST of Cyclin-K vs. Ensembl Zebrafish
Match: ccnt2a (cyclin T2a [Source:ZFIN;Acc:ZDB-GENE-030131-5779])

HSP 1 Score: 146.362 bits (368), Expect = 2.517e-38
Identity = 77/243 (31.69%), Postives = 134/243 (55.14%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPK--------EEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W+F +E+L  TPS   G++P  E  YR + A  I ++G +L +   T  TA+VY HRFYM+HSF    R + +   LFLA KVEE P+K   ++ +  + L+ +   E   D K        +E++ +E I+L+T+ F++ + HP+  ++   Q ++  +     L Q S+    +SL  T  CL+ +P ++AC  ++LA K +  EI    +   G+ WWE     +T+E+++++ H+ L +
Sbjct:   11 WFFTREQLETTPSRRCGVEPDRELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMYHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQ---EPPLDTKSNAYLQQAQELVILETIVLQTLGFEITIEHPHTDVVKCSQLVRASKD----LAQTSYFMATNSLHLTTFCLQHKPTVIACVCIHLACKWSNWEIPVSTD---GKHWWEYVDNSVTLELLDELTHEFLQI 243          
BLAST of Cyclin-K vs. Ensembl Zebrafish
Match: ccnt2a (cyclin T2a [Source:ZFIN;Acc:ZDB-GENE-030131-5779])

HSP 1 Score: 146.747 bits (369), Expect = 2.794e-38
Identity = 77/243 (31.69%), Postives = 134/243 (55.14%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPK--------EEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W+F +E+L  TPS   G++P  E  YR + A  I ++G +L +   T  TA+VY HRFYM+HSF    R + +   LFLA KVEE P+K   ++ +  + L+ +   E   D K        +E++ +E I+L+T+ F++ + HP+  ++   Q ++  +     L Q S+    +SL  T  CL+ +P ++AC  ++LA K +  EI    +   G+ WWE     +T+E+++++ H+ L +
Sbjct:   11 WFFTREQLETTPSRRCGVEPDRELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMYHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQ---EPPLDTKSNAYLQQAQELVILETIVLQTLGFEITIEHPHTDVVKCSQLVRASKD----LAQTSYFMATNSLHLTTFCLQHKPTVIACVCIHLACKWSNWEIPVSTD---GKHWWEYVDNSVTLELLDELTHEFLQI 243          
BLAST of Cyclin-K vs. Ensembl Xenopus
Match: ccnk (cyclin K [Source:NCBI gene;Acc:779776])

HSP 1 Score: 342.813 bits (878), Expect = 2.031e-113
Identity = 144/245 (58.78%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F +FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  +++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K EI+ W ++ + ++WWE FV+ + ++V+EDICHQILDLYS  K
Sbjct:   18 DHAKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLRYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPLYRRWWEQFVQDVPVDVLEDICHQILDLYSQGK 262          
BLAST of Cyclin-K vs. Ensembl Xenopus
Match: ccnk (cyclin K [Source:NCBI gene;Acc:779776])

HSP 1 Score: 342.813 bits (878), Expect = 4.318e-113
Identity = 144/245 (58.78%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F +FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  +++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K EI+ W ++ + ++WWE FV+ + ++V+EDICHQILDLYS  K
Sbjct:   18 DHAKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLRYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPLYRRWWEQFVQDVPVDVLEDICHQILDLYSQGK 262          
BLAST of Cyclin-K vs. Ensembl Xenopus
Match: ccnk (cyclin K [Source:NCBI gene;Acc:779776])

HSP 1 Score: 340.887 bits (873), Expect = 2.553e-111
Identity = 144/245 (58.78%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F +FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  +++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K EI+ W ++ + ++WWE FV+ + ++V+EDICHQILDLYS  K
Sbjct:  130 DHAKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLRYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPLYRRWWEQFVQDVPVDVLEDICHQILDLYSQGK 374          
BLAST of Cyclin-K vs. Ensembl Xenopus
Match: CCNT2 (cyclin T2 [Source:NCBI gene;Acc:100488125])

HSP 1 Score: 145.976 bits (367), Expect = 5.301e-38
Identity = 77/242 (31.82%), Postives = 133/242 (54.96%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSI-------LDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W+F +E L  +PS   G++   E  YR + A  I ++G +L +   T  TA+VY HRFYM HSF    R + +   LFLA KVEE P+K   ++ +  +        LD K  SE      +E++T+E +LL+T+ F++ + HP+  ++   Q ++  +     L Q S+    +SL  T  CL+++P ++AC  ++LA K +  EI    +   G+ WWE   + +T+E+++++ H+ L +
Sbjct:   12 WFFTREHLETSPSRKCGVEADKELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKYHRNVMSPTALFLAAKVEEQPRKLEHVIKVAHACLNPVEPQLDTK--SEGYLQQAQELVTLETVLLQTLGFEITIEHPHTDVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD---GKHWWEYVDQSVTLELLDELTHEFLQI 244          
BLAST of Cyclin-K vs. Ensembl Xenopus
Match: CCNT2 (cyclin T2 [Source:NCBI gene;Acc:100488125])

HSP 1 Score: 146.362 bits (368), Expect = 6.063e-38
Identity = 77/242 (31.82%), Postives = 133/242 (54.96%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSI-------LDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W+F +E L  +PS   G++   E  YR + A  I ++G +L +   T  TA+VY HRFYM HSF    R + +   LFLA KVEE P+K   ++ +  +        LD K  SE      +E++T+E +LL+T+ F++ + HP+  ++   Q ++  +     L Q S+    +SL  T  CL+++P ++AC  ++LA K +  EI    +   G+ WWE   + +T+E+++++ H+ L +
Sbjct:   12 WFFTREHLETSPSRKCGVEADKELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKYHRNVMSPTALFLAAKVEEQPRKLEHVIKVAHACLNPVEPQLDTK--SEGYLQQAQELVTLETVLLQTLGFEITIEHPHTDVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD---GKHWWEYVDQSVTLELLDELTHEFLQI 244          
BLAST of Cyclin-K vs. Ensembl Mouse
Match: Ccnk (cyclin K [Source:MGI Symbol;Acc:MGI:1276106])

HSP 1 Score: 342.428 bits (877), Expect = 6.953e-113
Identity = 144/245 (58.78%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F +FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  +++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K EI+ W ++ + ++WWE FV+ + ++V+EDICHQILDLYS  K
Sbjct:   18 DHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGK 262          
BLAST of Cyclin-K vs. Ensembl Mouse
Match: Ccnk (cyclin K [Source:MGI Symbol;Acc:MGI:1276106])

HSP 1 Score: 342.428 bits (877), Expect = 6.953e-113
Identity = 144/245 (58.78%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F +FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  +++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K EI+ W ++ + ++WWE FV+ + ++V+EDICHQILDLYS  K
Sbjct:   18 DHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGK 262          
BLAST of Cyclin-K vs. Ensembl Mouse
Match: Ccnt1 (cyclin T1 [Source:MGI Symbol;Acc:MGI:1328363])

HSP 1 Score: 147.132 bits (370), Expect = 2.147e-38
Identity = 79/243 (32.51%), Postives = 130/243 (53.50%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEE--------IMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            WYF +E+L N+PS   G+D   E  YR + A  + ++G +L +   T  TA+VY HRFYM  SF    R+  A   LFLA KVEE PKK   ++ +  + L   H  E   D + E        ++ +E I+L+T+ F+L + HP+ +++   Q ++  +     L Q S+    +SL  T   L++ P +VAC  ++LA K +  EI    +   G+ WWE     +T+E+++++ H+ L +
Sbjct:   12 WYFTREQLENSPSRRFGVDSDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFHRYSMAPAALFLAAKVEEQPKKLEHVIKVAHTCL---HPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTD---GKHWWEYVDATVTLELLDELTHEFLQI 244          
BLAST of Cyclin-K vs. Ensembl Mouse
Match: Ccnt1 (cyclin T1 [Source:MGI Symbol;Acc:MGI:1328363])

HSP 1 Score: 147.132 bits (370), Expect = 2.147e-38
Identity = 79/243 (32.51%), Postives = 130/243 (53.50%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEE--------IMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            WYF +E+L N+PS   G+D   E  YR + A  + ++G +L +   T  TA+VY HRFYM  SF    R+  A   LFLA KVEE PKK   ++ +  + L   H  E   D + E        ++ +E I+L+T+ F+L + HP+ +++   Q ++  +     L Q S+    +SL  T   L++ P +VAC  ++LA K +  EI    +   G+ WWE     +T+E+++++ H+ L +
Sbjct:   12 WYFTREQLENSPSRRFGVDSDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFHRYSMAPAALFLAAKVEEQPKKLEHVIKVAHTCL---HPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTD---GKHWWEYVDATVTLELLDELTHEFLQI 244          
BLAST of Cyclin-K vs. Ensembl Mouse
Match: Ccnt2 (cyclin T2 [Source:MGI Symbol;Acc:MGI:1920199])

HSP 1 Score: 140.584 bits (353), Expect = 3.522e-36
Identity = 76/243 (31.28%), Postives = 132/243 (54.32%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPK--------EEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W+F +E+L NTPS   G++   E  +R + A  I ++G +L +   T  TA+VY HRFYM HSF    R + +   LFLA KVEE  +K   ++ +  + L   H  E   D K        +E++ +E I+L+T+ F++ + HP+  ++   Q ++  +     L Q S+    +SL  T  CL+++P ++AC  ++LA K +  EI    +   G+ WWE     +T+E+++++ H+ L +
Sbjct:   11 WFFTREQLENTPSRRCGVEADEELSHRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNRNIISPTALFLAAKVEEQARKLEHVIKVAHACL---HPLEPLLDTKCDAYLQQTQELVLLETIMLQTLGFEITIEHPHTDVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTD---GKHWWEYVDPTVTLELLDELTHEFLQI 243          
BLAST of Cyclin-K vs. UniProt/SwissProt
Match: sp|O88874|CCNK_MOUSE (Cyclin-K OS=Mus musculus OX=10090 GN=Ccnk PE=1 SV=3)

HSP 1 Score: 342.428 bits (877), Expect = 2.141e-112
Identity = 144/245 (58.78%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F +FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  +++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K EI+ W ++ + ++WWE FV+ + ++V+EDICHQILDLYS  K
Sbjct:   18 DHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGK 262          
BLAST of Cyclin-K vs. UniProt/SwissProt
Match: sp|O75909|CCNK_HUMAN (Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=2)

HSP 1 Score: 341.658 bits (875), Expect = 6.779e-112
Identity = 144/245 (58.78%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS  +G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F +FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  +++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K EI+ W ++ + ++WWE FV+ + ++V+EDICHQILDLYS  K
Sbjct:   18 DHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGK 262          
BLAST of Cyclin-K vs. UniProt/SwissProt
Match: sp|F1QMB9|CCNK_DANRE (Cyclin-K OS=Danio rerio OX=7955 GN=ccnk PE=2 SV=3)

HSP 1 Score: 335.88 bits (860), Expect = 1.279e-111
Identity = 145/245 (59.18%), Postives = 198/245 (80.82%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPK 765
            +H+ PCWY++K++L +TPS +D +DP  E +YR EGA FI ++G +LGL YDT AT + YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F++FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  V++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K +I+ W ++Q  ++WWE FV+ + +E++EDICHQILDLYS  K
Sbjct:   20 DHTKPCWYWDKKDLAHTPSQSD-LDPATEARYRREGARFIFDVGTRLGLHYDTLATGITYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFAQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLRYAKQLKGDKNKVQKLVQMAWTFVNDSLCTMLSLQWEPEIIAVAVMYLAGRLCKFDIQEWTSKQSSRRWWEQFVQDVPVELLEDICHQILDLYSQGK 263          
BLAST of Cyclin-K vs. UniProt/SwissProt
Match: sp|Q2QQS5|CCT14_ORYSJ (Cyclin-T1-4 OS=Oryza sativa subsp. japonica OX=39947 GN=CYCT1-1 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.149e-47
Identity = 95/246 (38.62%), Postives = 146/246 (59.35%), Query Frame = 1
Query:   46 CWYFEKEELR-NTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFS--------EFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQK-WWESFVEGMTIEVMEDICHQILDLY 753
             WYF ++E+  N+PS  DGID + E   R    TF+ +LG +L +   T ATA+V+ HRFY+  S     R   A+ C+FLAGKVEETP+  +D++ ++  I+ KK  +        E  +  KE I+  ER++L T+ FDL V HPYK L+  ++K K  Q     L Q++W F+ND LRT+LCL+++P  +A   ++LA K  K ++ S      G+K WW+ F   +T   +E++ +Q+L+LY
Sbjct:   35 SWYFSRKEIEENSPSRRDGIDLKKESYLRKSYCTFLQDLGMRLKVPQVTIATAIVFCHRFYLRQSHAKNDRRTIATVCMFLAGKVEETPRPLKDVILVSYEIIHKKDPAAGQRIKQKEVYDQQKELILLAERVVLATLGFDLNVHHPYKPLVEAIRKFKVAQN---ALAQVAWNFVNDGLRTSLCLQFKPHHIAAGAIFLAAKFLKVKLPS-----DGEKVWWQEF--DVTPRQLEEVSNQMLELY 270          
BLAST of Cyclin-K vs. UniProt/SwissProt
Match: sp|Q2RAC5|CCT13_ORYSJ (Cyclin-T1-3 OS=Oryza sativa subsp. japonica OX=39947 GN=CYCT1-3 PE=3 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 3.577e-46
Identity = 94/251 (37.45%), Postives = 147/251 (58.57%), Query Frame = 1
Query:   46 CWYFEKEELR-NTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFS--------EFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPKTA 771
             WYF ++E+  N+ S  DGID + E   R    TF+ +LG +L +   T ATA+V+ HRF++  S     R   A+ C+FLAGKVEETP+  +D++ I+  I+ KK  +        E     KE I+  ER++L T+ FDL V HPYK L+  ++K K  Q     L Q++W F+ND LRT+LCL+++P  +A   ++LA K  K ++ S + ++V   WW+ F   +T   +E++ +Q+L+LY   + A
Sbjct:   36 SWYFSRKEIEENSLSRRDGIDLKKESYLRKSYCTFLQDLGMRLKVPQVTIATAIVFCHRFFLRQSHAKNDRRTIATVCMFLAGKVEETPRPLKDVILISYEIIHKKDAAAVQRIKQKEVYEQQKELILLGERVVLVTLGFDLNVHHPYKPLVEAIKKFKVAQNA---LAQVAWNFVNDGLRTSLCLQFKPHHIAAGAIFLAAKFLKVKLPS-DGEKV---WWQEF--DVTPRQLEEVSNQMLELYEQNRVA 277          
BLAST of Cyclin-K vs. TrEMBL
Match: G4V5F8 (Putative cyclin k OS=Schistosoma mansoni OX=6183 GN=Smp_130980 PE=3 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 6.025e-122
Identity = 162/242 (66.94%), Postives = 195/242 (80.58%), Query Frame = 1
Query:   28 DEHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLY 753
            D+  MPCWY+E+EEL  TPS  D ID   E ++R EGA F+S +  KL L+YDTCATA+V+FHRFYMFHSFK  PR++TA+CCL LAGKVEETPKK RDIV   +S+L    F +FGNDP+EE+M  ER+LLKTIKFDLQVSHPY YLL + ++IKG Q  ++ LVQMSW+FINDSL T LCL+WEPEIVACAVLYLAT+++K  IE WE +Q GQ+WWE FVEGM+ EVMEDICH+ILDLY
Sbjct:    3 DQQQMPCWYYEREELYKTPSYYDQIDHETETRHRREGARFLSAVSTKLNLRYDTCATAIVFFHRFYMFHSFKAFPRYVTAACCLMLAGKVEETPKKVRDIVKTARSLLSDADFEQFGNDPREEVMAFERVLLKTIKFDLQVSHPYSYLLQFAKRIKGNQEKLKELVQMSWSFINDSLATTLCLQWEPEIVACAVLYLATRMSKFTIEDWEGRQPGQRWWECFVEGMSTEVMEDICHKILDLY 244          
BLAST of Cyclin-K vs. TrEMBL
Match: A0A1S8WI22 (Cyclin domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_10131 PE=3 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 1.364e-121
Identity = 161/238 (67.65%), Postives = 196/238 (82.35%), Query Frame = 1
Query:   40 MPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLY 753
            MPCWY+ +EEL+ TPS  D IDP  E +YR EGA F+ ++ +KL L+YDTCATA+V+FHRFYMFHSFK  PR++TASCCL LAGKVEETPKK RDIV   + +L +  F +FG+DP+EE+M  ER+LLKTIKFDLQVSHPY YLL +V++IKG Q  ++ LVQMSW+FINDSL T LCL+WEPEIVACAVLYLAT+++K  IE WE +Q G +WWESFVEGM+ EVMEDICH+ILDLY
Sbjct:    1 MPCWYYTREELQKTPSFYDHIDPETEARYRREGARFLFDVSSKLNLRYDTCATAIVFFHRFYMFHSFKAFPRYVTASCCLMLAGKVEETPKKVRDIVKTARLLLPEAIFEQFGSDPREEVMAYERVLLKTIKFDLQVSHPYSYLLQFVKRIKGNQEKLKELVQMSWSFINDSLATTLCLQWEPEIVACAVLYLATRMSKYTIEDWEGRQPGLRWWESFVEGMSTEVMEDICHKILDLY 238          
BLAST of Cyclin-K vs. TrEMBL
Match: A0A183K0F3 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS8464 PE=3 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 1.005e-120
Identity = 161/238 (67.65%), Postives = 193/238 (81.09%), Query Frame = 1
Query:   40 MPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLY 753
            MPCWY+E+EEL  TPS  D ID   E ++R EGA F+S +  KL L+YDTCATA+V+FHRFYMFHSFK  PR++TA+CCL LAGKVEETPKK RDIV   +S+L    F +FGNDP+EE+M  ER+LLKTIKFDLQVSHPY YLL + ++IKG Q  ++ LVQMSW+FINDSL T LCL+WEPEIVACAVLYLAT+++K  IE WE +Q GQ+WWE FVEGM+ EVMEDICH+ILDLY
Sbjct:    1 MPCWYYEREELYKTPSYYDQIDHETETRHRREGARFLSAVSTKLNLRYDTCATAIVFFHRFYMFHSFKAFPRYVTAACCLMLAGKVEETPKKVRDIVKTARSLLSDADFEQFGNDPREEVMAFERVLLKTIKFDLQVSHPYSYLLQFAKRIKGNQEKLKELVQMSWSFINDSLATTLCLQWEPEIVACAVLYLATRMSKFTIEDWEGRQPGQRWWECFVEGMSTEVMEDICHKILDLY 238          
BLAST of Cyclin-K vs. TrEMBL
Match: A0A5J4NQN6 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0007685 PE=3 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.217e-120
Identity = 158/243 (65.02%), Postives = 195/243 (80.25%), Query Frame = 1
Query:   25 MDEHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLY 753
            M++  MPCWY+E++EL  TPS  D IDP  E +YR EGA F+ ++  KL L+YDTCATA+V+FHRFYMFHSF   PR++TA+CCL LAGKVEETPKK RDIV   + +L    F++FGND +EE+M  ER+LLKTIKFDLQV+HPY YLL +V++IKG +  ++ LVQMSW+FINDSL T LCL+WEPEIVACAVLYLAT++ K  IE WE +QVG +WWESFVE M+ EVMEDICH+ILDLY
Sbjct:    1 MEDQQMPCWYYERDELLKTPSFLDHIDPETEARYRREGARFLFDVSGKLNLRYDTCATAIVFFHRFYMFHSFTAFPRYVTAACCLMLAGKVEETPKKVRDIVKTARMLLSDSDFAQFGNDSREEVMAYERVLLKTIKFDLQVTHPYSYLLQFVKRIKGNKEKLKELVQMSWSFINDSLATTLCLQWEPEIVACAVLYLATRMKKYTIEDWEGRQVGLRWWESFVENMSTEVMEDICHKILDLY 243          
BLAST of Cyclin-K vs. TrEMBL
Match: A0A094ZYI2 (Cyclin-K OS=Schistosoma haematobium OX=6185 GN=MS3_08487 PE=3 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 1.456e-120
Identity = 161/238 (67.65%), Postives = 193/238 (81.09%), Query Frame = 1
Query:   40 MPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLY 753
            MPCWY+E+EEL  TPS  D ID   E ++R EGA F+S +  KL L+YDTCATA+V+FHRFYMFHSFK  PR++TA+CCL LAGKVEETPKK RDIV   +S+L    F +FGNDP+EE+M  ER+LLKTIKFDLQVSHPY YLL + ++IKG Q  ++ LVQMSW+FINDSL T LCL+WEPEIVACAVLYLAT+++K  IE WE +Q GQ+WWE FVEGM+ EVMEDICH+ILDLY
Sbjct:    1 MPCWYYEREELYKTPSYYDQIDHETETRHRREGARFLSAVSTKLNLRYDTCATAIVFFHRFYMFHSFKAFPRYVTAACCLMLAGKVEETPKKVRDIVKTARSLLSDADFEQFGNDPREEVMAFERVLLKTIKFDLQVSHPYSYLLQFAKRIKGNQEKLKELVQMSWSFINDSLATTLCLQWEPEIVACAVLYLATRMSKFTIEDWEGRQPGQRWWECFVEGMSTEVMEDICHKILDLY 238          
BLAST of Cyclin-K vs. Ensembl Cavefish
Match: ccnk (cyclin K [Source:NCBI gene;Acc:103046138])

HSP 1 Score: 342.428 bits (877), Expect = 1.545e-113
Identity = 146/250 (58.40%), Postives = 202/250 (80.80%), Query Frame = 1
Query:    7 LSTI*KMDEHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYS 756
            LS++    +H  PCWY++K++L +TPS ++G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F++FG+DPKEE+M +ERILL+TIKFDLQV HPY++LL Y +++KG +  V++LVQM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K +I+ W ++Q  ++WWE FV+ + +E++EDICHQILDLYS
Sbjct:   10 LSSLTTNLDHIKPCWYWDKKDLAHTPSQSEGLDPATEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFAQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLRYAKQLKGDKNKVQKLVQMAWTFVNDSLCTMLSLQWEPEIIAIAVMYLAGRLCKFDIQEWTSKQSSRRWWEQFVQDVPVELLEDICHQILDLYS 259          
BLAST of Cyclin-K vs. Ensembl Cavefish
Match: ccnt2b (cyclin-T2-like [Source:NCBI gene;Acc:103028284])

HSP 1 Score: 146.362 bits (368), Expect = 1.459e-38
Identity = 75/242 (30.99%), Postives = 135/242 (55.79%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKH-----FSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGK--QTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W F +E++ N+PS   GI+P  E  YR + A  I ++G +L +   T  TA+VY HRFYM +SF    R + +   LFLA KVEE P+K   ++ ++ + L+ +       S       +E++ +E I+L+T+ F++ + HP+  ++   Q ++G+    + + L Q S+    +SL  T  CL+++P +VAC  ++LA K +  EI    +   G+ WWE     +T+++++ + H+ L +
Sbjct:   22 WLFNREQIENSPSRRCGIEPDRELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMLNSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVSHACLNPQEPPLDTSSNVYLQQAQELVLLETIVLQTLGFEITIEHPHTDVVRCSQLVRGRCFHLSSKDLAQTSYFMATNSLHLTTFCLQYKPTVVACVCIHLACKWSNWEIPISSD---GKHWWEYLDPTVTLQLLDQLTHEFLQI 260          
BLAST of Cyclin-K vs. Ensembl Cavefish
Match: ccnt2a (cyclin T2 [Source:NCBI gene;Acc:103023729])

HSP 1 Score: 146.362 bits (368), Expect = 2.204e-38
Identity = 77/243 (31.69%), Postives = 135/243 (55.56%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPK--------EEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W+F +E+L NTPS   G++   E  YR + A  I ++G +L +   T  TA+VY HRFYM+HSF    R + +   LFLA KVEE P+K   ++ +  + L+ +   E   D K        +E++ +E I+L+T+ F++ + HP+  ++   Q ++  +     L Q S+    +SL  T  CL+++P ++AC  ++L  K +K+EI    +   G+ WWE     +TIE+++++  + L +
Sbjct:   11 WFFTREQLDNTPSRRCGVEADRELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMYHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQ---EPPLDAKSNAYLQQAQELVILETIVLQTLGFEITIEHPHTDVVKCSQLVRASKD----LAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLVCKWSKREIPLSTD---GKSWWEYVDNSVTIELLDELTTEFLQI 243          
BLAST of Cyclin-K vs. Ensembl Cavefish
Match: ccnt2a (cyclin T2 [Source:NCBI gene;Acc:103023729])

HSP 1 Score: 146.747 bits (369), Expect = 2.625e-38
Identity = 77/243 (31.69%), Postives = 135/243 (55.56%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPK--------EEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W+F +E+L NTPS   G++   E  YR + A  I ++G +L +   T  TA+VY HRFYM+HSF    R + +   LFLA KVEE P+K   ++ +  + L+ +   E   D K        +E++ +E I+L+T+ F++ + HP+  ++   Q ++  +     L Q S+    +SL  T  CL+++P ++AC  ++L  K +K+EI    +   G+ WWE     +TIE+++++  + L +
Sbjct:   11 WFFTREQLDNTPSRRCGVEADRELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMYHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQ---EPPLDAKSNAYLQQAQELVILETIVLQTLGFEITIEHPHTDVVKCSQLVRASKD----LAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLVCKWSKREIPLSTD---GKSWWEYVDNSVTIELLDELTTEFLQI 243          
BLAST of Cyclin-K vs. Ensembl Cavefish
Match: ccnt2b (cyclin-T2-like [Source:NCBI gene;Acc:103028284])

HSP 1 Score: 143.28 bits (360), Expect = 2.126e-37
Identity = 74/240 (30.83%), Postives = 132/240 (55.00%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKH-----FSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W F +E++ N+PS   GI+P  E  YR + A  I ++G +L +   T  TA+VY HRFYM +SF    R + +   LFLA KVEE P+K   ++ ++ + L+ +       S       +E++ +E I+L+T+ F++ + HP+  ++   Q ++  +     L Q S+    +SL  T  CL+++P +VAC  ++LA K +  EI    +   G+ WWE     +T+++++ + H+ L +
Sbjct:   26 WLFNREQIENSPSRRCGIEPDRELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMLNSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVSHACLNPQEPPLDTSSNVYLQQAQELVLLETIVLQTLGFEITIEHPHTDVVRCSQLVRASKD----LAQTSYFMATNSLHLTTFCLQYKPTVVACVCIHLACKWSNWEIPISSD---GKHWWEYLDPTVTLQLLDQLTHEFLQI 258          
BLAST of Cyclin-K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003409.1 (pep scaffold:Pmarinus_7.0:GL483875:8555:11659:-1 gene:ENSPMAG00000003120.1 transcript:ENSPMAT00000003409.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 278.1 bits (710), Expect = 2.349e-93
Identity = 126/232 (54.31%), Postives = 176/232 (75.86%), Query Frame = 1
Query:   43 PCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGL----KYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIK-GKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVME 723
            PCWY++K +L  TPS+ +G+D   E +YR EGA FI ++G +LGL     YDT AT MVYFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+  H +++     EE+M +ERILL+TIKFDLQ+ HPY +LL Y +++K G ++ +++LVQM+WTF+NDSL T LCL+WEPEI+  AV+YLA +L K EI+ W ++   ++WWE FV+ + +E++E
Sbjct:    2 PCWYWDKRDLVRTPSMQEGMDAVTESRYRREGARFIFDVGTRLGLYPLSHYDTLATGMVYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVHINKYWF-LLEEVMVLERILLQTIKFDLQLEHPYHFLLKYAKQLKAGDKSKLQKLVQMAWTFVNDSLCTMLCLQWEPEIIGVAVMYLAGRLCKFEIQEWTSRPAHRRWWEQFVQDVPVELLE 232          
BLAST of Cyclin-K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003411.1 (pep scaffold:Pmarinus_7.0:GL483875:8648:11677:-1 gene:ENSPMAG00000003120.1 transcript:ENSPMAT00000003411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.937 bits (694), Expect = 2.792e-91
Identity = 121/205 (59.02%), Postives = 161/205 (78.54%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGL----KYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPK-EEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKL 630
            E   PCWY++K +L  TPS+ +G+D   E +YR EGA FI ++G +LGL     YDT AT MVYFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F++FG+DPK EE+M +ERILL+TIKFDLQ+ HPY +LL Y +++KG ++ +++LVQM+WTF+NDSL T LCL+WEPEI+  AV+YLA +L
Sbjct:    4 EPRRPCWYWDKRDLVRTPSMQEGMDAVTESRYRREGARFIFDVGTRLGLLHDRHYDTLATGMVYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFAQFGDDPKQEEVMVLERILLQTIKFDLQLEHPYHFLLKYAKQLKGDKSKLQKLVQMAWTFVNDSLCTMLCLQWEPEIIGVAVMYLAGRL 208          
BLAST of Cyclin-K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003616.1 (pep scaffold:Pmarinus_7.0:GL476475:418210:425326:1 gene:ENSPMAG00000003277.1 transcript:ENSPMAT00000003616.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.428 bits (350), Expect = 1.608e-36
Identity = 72/240 (30.00%), Postives = 128/240 (53.33%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHF-----SEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W+F +E+L  TPS   GI+   E  YR + A  I ++G +L +   T  TA+VY HRFYM  +F    R   +   LFLA KVEE P+K   ++ +  + L+ +       S+      ++++  E ++L+T+ F++ + HP+ Y++   Q ++  +     L Q S+    +SL  T  CL+ +P +VAC  ++LA K +  EI    +   G+ WWE    G+++ +++ + H+ L +
Sbjct:    2 WFFSREQLEATPSRRCGIEVDKELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMLQTFSKFHRNAISPAALFLAAKVEEQPRKLEHVIKVAHACLNPQEAPLDTKSDAYLQQAQDLVMNEHVMLQTLGFEITIDHPHTYVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFCLQHKPTVVACVCIHLACKWSNWEIPVSSD---GKPWWEYVDNGVSMNLLDALTHEFLQI 234          
BLAST of Cyclin-K vs. Ensembl Sea Lamprey
Match: ccnc (cyclin C [Source:ZFIN;Acc:ZDB-GENE-030131-7369])

HSP 1 Score: 97.8265 bits (242), Expect = 1.510e-23
Identity = 66/212 (31.13%), Postives = 106/212 (50.00%), Query Frame = 1
Query:  139 ATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRD-IVTITKSILDKKHFSEFGND---PKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQV---GQKWWESFVEGMTIEVMEDICHQILDLY 753
            A  I  LG +L L+    ATA VYF RFY  +S + +   L A  C+FLA KVEE        ++T   ++   K    F  D       ++  E  LL+ +   L V HPY+ L  YV  +       E+L+Q++W  +ND+ RT+LCL + P ++A A L++A  + ++E      ++V   G+ W+      + ++ + +I   IL LY
Sbjct:   33 ANVIQALGEQLKLRQQVIATATVYFKRFYARYSLQCIDPVLMAPTCVFLASKVEEFGVISNSRLITAASTVFKNKFSYAFSKDFPFRVNHVLECEFYLLELMDCCLIVYHPYRALTQYVHDMGPD----EQLLQIAWKIVNDTYRTDLCLMYPPFMIALASLHMACAIQQKEPPKEHQKEVLRDGRHWFAEL--SVDMDKILEITRAILKLY 238          
BLAST of Cyclin-K vs. Ensembl Sea Lamprey
Match: ccnq (cyclin Q [Source:NCBI gene;Acc:553650])

HSP 1 Score: 87.0409 bits (214), Expect = 4.505e-20
Identity = 69/232 (29.74%), Postives = 114/232 (49.14%), Query Frame = 1
Query:  103 DPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILD--------KKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTN--VER---LVQMSWTFINDS-LRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFV-EGMTIEVMEDICHQILDLY 753
            +P  E K   +   FI E G KLG++    ATA   +H F+   S       L A+ CL+LAGK EE   + RDI+ +    L+         K F E     ++ ++  E ++L+ +KF +  +HP+KYLL Y+  ++        ER   L + +W  ++DS LR    L+   + VA A LYLA +    E+    N++    WW++   E ++ EV+ +I  +++  Y
Sbjct:    2 EPSKEAKTHFKLCRFIMEAGVKLGMRSVPLATACTLYHAFFSEVSLDDYDPHLVAASCLYLAGKAEEQHVRLRDIINVVHRHLNPDKELLQLSKEFWEL----RDSLVQCELLILRVLKFQISFTHPHKYLLYYLTSLRNWMGTWAWERAGPLAETAWALLSDSYLRGGAILRHRAQHVAAAALYLALECRGTEVPG--NREARTSWWQALCEEDLSYEVLNEIVCELISTY 227          
BLAST of Cyclin-K vs. Ensembl Yeast
Match: SSN8 (Cyclin-like component of the RNA polymerase II holoenzyme; involved in phosphorylation of the RNA polymerase II C-terminal domain; forms a kinase-cyclin pair in the RNAPII holoenzyme with Ssn3p; required for both entry into and execution of the meiotic program; involved in glucose repression and telomere maintenance; cyclin homolog 35% identical to human cyclin C [Source:SGD;Acc:S000004970])

HSP 1 Score: 75.8702 bits (185), Expect = 7.792e-16
Identity = 47/166 (28.31%), Postives = 85/166 (51.20%), Query Frame = 1
Query:  145 FISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERL---VQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLN 633
             I +LG +L ++    ATA +Y  RF +  S + +  ++  + C++LA KVEE P+  R +V+  +++     + EF      ++   E  LL+ ++  L V HPY+ L   VQ +K     +      +Q  W+ INDS   ++ L + P I+A A L++   ++
Sbjct:   81 LIMKLGRRLNIRQYALATAHIYLSRFLIKASVREINLYMLVTTCVYLACKVEECPQYIRTLVSEARTL-----WPEFIPPDPTKVTEFEFYLLEELESYLIVHHPYQSLKQIVQVLKQPPFQITLSSDDLQNCWSLINDSYINDVHLLYPPHIIAVACLFITISIH 241          
BLAST of Cyclin-K vs. Ensembl Yeast
Match: CTK2 (Beta subunit of C-terminal domain kinase I (CTDK-I); which phosphorylates both RNA pol II subunit Rpo21p to affect transcription and pre-mRNA 3' end processing, and ribosomal protein Rps2p to increase translational fidelity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000003543])

HSP 1 Score: 62.7734 bits (151), Expect = 1.586e-11
Identity = 45/163 (27.61%), Postives = 87/163 (53.37%), Query Frame = 1
Query:  145 FISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILD-KKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKL 630
            F+S+L  +L     T  TA+ ++ R+++F+ F+T   +  A+ CL L  K  ET KK  DI T++  + +  K  ++   + K+ +  +E  +L++  FD +V++ Y ++  YV KI  + +   +L  ++W    D+L+    L      +A A+L +A +L
Sbjct:   45 FLSDLCVQLKFPRKTLETAVYFYQRYHLFNRFETEVCYTVATSCLTLGCKEVETIKKTNDICTLSLRLRNVVKINTDILENFKKRVFQIELRILESCSFDYRVNN-YVHIDEYVIKIGRELSFDYKLCNLAWVIAYDALKLETILVIPQHSIALAILKIAYEL 206          
BLAST of Cyclin-K vs. Ensembl Yeast
Match: CLB2 (B-type cyclin involved in cell cycle progression; activates Cdc28p to promote the transition from G2 to M phase; accumulates during G2 and M, then targeted via a destruction box motif for ubiquitin-mediated degradation by the proteasome; CLB2 has a paralog, CLB1, that arose from the whole genome duplication [Source:SGD;Acc:S000006323])

HSP 1 Score: 50.0618 bits (118), Expect = 3.273e-7
Identity = 54/233 (23.18%), Postives = 98/233 (42.06%), Query Frame = 1
Query:  106 PRVEDKYRNEG--------ATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEF--GNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWES----FVEGMTIEVMEDICHQILDLYSDP 762
            P+ ED Y++            ++ ++ NK GL  +T   A+    RF      +     L  + CLF+A K EE           + SI   KHF+    G   ++EI   E+ +LKT+KF+L   +P    +N++++I        +   ++   +  SL     +   P + A A ++++ K+            +G+  W+     +  G T E +  +CH I+D    P
Sbjct:  246 PKKEDLYQHRNIHQNRDILVNWLVKIHNKFGLLPETLYLAINIMDRFLGKELVQLDKLQLVGTSCLFIASKYEEV---------YSPSI---KHFASETDGACTEDEIKEGEKFILKTLKFNLNYPNP----MNFLRRISKADDYDIQSRTLAKFLLEISLVDFRFIGILPSLCAAAAMFMSRKM------------LGKGKWDGNLIHYSGGYTKEELAPVCHMIMDYLVSP 450          
BLAST of Cyclin-K vs. Ensembl Nematostella
Match: EDO48578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIW0])

HSP 1 Score: 236.884 bits (603), Expect = 2.375e-77
Identity = 119/201 (59.20%), Postives = 140/201 (69.65%), Query Frame = 1
Query:   40 MPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQE 642
            MP W F  + L  TPS  DGID   E +YR EG  FI E GNK+GL+YDT AT  VYFHRFYM  SFK  PR++T + CLFLAGKVEETPKKCRDI+    S+L    F  FG DPKEE+M  ERILL+TIKFDLQV HPY  LL   + +KG +  + +LVQM+WTFINDSL T LCLK   E++A A+L LA KLN  +
Sbjct:    1 MPNWLFTHDGLNRTPSRLDGIDYATECRYRREGTRFIMECGNKMGLRYDTMATGAVYFHRFYMIQSFKNFPRWVTGAACLFLAGKVEETPKKCRDIIKTANSLLTPPQFEAFGPDPKEEVMIYERILLQTIKFDLQVEHPYPCLLKLGKGLKGDRAKLNKLVQMAWTFINDSLSTTLCLKHRSEVIANAMLALAAKLNNYQ 201          
BLAST of Cyclin-K vs. Ensembl Nematostella
Match: EDO42905 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S058])

HSP 1 Score: 150.214 bits (378), Expect = 4.729e-43
Identity = 80/240 (33.33%), Postives = 135/240 (56.25%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDK-----KHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            WYF KE+L+N+PS   G+D   E  YR + AT I ++G +L +   T  T++VY HRFYM H F+   R   A CCLFL+ KVEE P+K   ++ +  + L +        SE      ++++  E ILL+T+ F++ V HP+ Y++  +Q ++  +     L Q S+    +SL  T LCL+++P +VACA ++LA K    EI    + +    WW+     +T +++++I  + +++
Sbjct:   13 WYFTKEQLQNSPSRRMGMDAERELSYRQQAATLIQDMGQRLSVSQLTINTSIVYMHRFYMCHPFQKFHRHAMAPCCLFLSAKVEEQPRKLEHVIRVAHACLHRDGPPLNPESEEYLQQAQDLIENESILLQTLGFEVTVHHPHTYVVKGIQLVRASKD----LGQASYFMATNSLHLTTLCLQFKPPVVACACIHLACKWCNYEIPQSSDHKY---WWQYINPTVTKKLLDEIAQEFVNI 245          
BLAST of Cyclin-K vs. Ensembl Nematostella
Match: EDO45644 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSI9])

HSP 1 Score: 97.0561 bits (240), Expect = 1.834e-23
Identity = 58/211 (27.49%), Postives = 109/211 (51.66%), Query Frame = 1
Query:  145 FISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGN----DPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKG----KQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLY 753
            FI E G KL L  +  ++A V +H+F+     K    +L     ++LA K EE P K RD++ +      K       N    + +E ++  E ++L+ + F +   +P+KYLL+Y++ ++           ++ Q+SW+++ DS    LCL++ P  VA A+L+ A +    E+ S   Q+  + WW++    +T E+++ I   ++D+Y
Sbjct:   23 FIMESGAKLSLPQNAMSSACVLYHQFWKGCDPKDFDPYLIGMTAIYLASKAEECPCKVRDVINVCYRSSHKDSPCLEINARYWELRESVVNCELLMLRVLGFRVSYDNPHKYLLHYLKVLQDWTCPGMWERSQVPQISWSYLLDSHHIPLCLEYPPAHVAVALLHFAVECVGLEVPS---QEAVRPWWKALCSDVTPELIQSITEDVMDMY 230          
BLAST of Cyclin-K vs. Ensembl Nematostella
Match: EDO34798 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNA4])

HSP 1 Score: 97.8265 bits (242), Expect = 2.609e-23
Identity = 67/224 (29.91%), Postives = 109/224 (48.66%), Query Frame = 1
Query:   64 EELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDP--------------KEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESF 693
            ++L  TPS+ DG+D  VE+  R  G  FI   G  L L     AT  V F RFY   SF      + +  C +   K     K  +  + + +     + +  + N P              K +++  ER +LK + F + V HP+K ++ Y+Q ++  +TN E L Q++W  +NDSLRT+  +++ PE +ACA ++LA++L K  + S         W+E F
Sbjct:   27 DKLTETPSVKDGLDKNVEEDLRIIGCEFIQTSGLLLKLPQVAMATGQVLFQRFYYTKSFVKHDVEVGSCTCYYCTSKRNGQIKATKHRIVVVQYASSVRGWLFYLNRPIQPLEYMGNLYFNRKNQVVKAERRVLKELGFCVHVKHPHKIIITYLQILEC-ETNQE-LAQLAWNHMNDSLRTSAFVRFAPETIACACIFLASRLLKICLPS------NPPWYELF 242          
BLAST of Cyclin-K vs. Ensembl Nematostella
Match: EDO32917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STP9])

HSP 1 Score: 91.2781 bits (225), Expect = 6.051e-21
Identity = 60/211 (28.44%), Postives = 108/211 (51.18%), Query Frame = 1
Query:  139 ATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRD-IVTITKSILDKKHFSEFGNDP----KEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVE-GMTIEVMEDICHQILDLY 753
            + F+  LG  L L+    ATA V+F RFY  +S K++   L A  C++LA KVEE      + +++ + S++  K+   F  +       +++  E  LL+ +   L + HPY+ L  YV  +  +    E ++  +W  INDSLRT++ L + P ++A A +++A  + +++ + W            F E  + ++ + +I H IL LY
Sbjct:   45 SNFMQSLGEHLDLRQQVIATATVFFKRFYSKNSLKSIDPLLIAPTCVYLASKVEECGAISNNKLISASSSVVKNKYSYAFQMEQFPYRMNQVLECEFYLLEMLDCCLIIYHPYRPLTQYVSDLGME----EAILPTAWRIINDSLRTDIFLIYPPYLIALAAIHMACVIQQKDSKQW------------FAELSVDMDQIVEITHHILRLY 239          
BLAST of Cyclin-K vs. Ensembl Medaka
Match: ccnk (cyclin K [Source:NCBI gene;Acc:101155650])

HSP 1 Score: 338.191 bits (866), Expect = 6.134e-112
Identity = 143/242 (59.09%), Postives = 197/242 (81.40%), Query Frame = 1
Query:   31 EHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYS 756
            +H  PCWY++K++L +TPS ++G+DP  E +YR EGA FI ++G +LGL YDT AT ++YFHRFYMFHSFK  PR++T +CCLFLAGKVEETPKKC+DI+   +S+L+   F++FG+DPKEE+M +ERILL+TIKFDLQV HPY +LL YV+++KG +  V +++QM+WTF+NDSL T L L+WEPEI+A AV+YLA +L K +I+ W ++Q  ++WWE FV+ + +E++EDICHQILDLYS
Sbjct:   33 DHIKPCWYWDKKDLAHTPSQSEGLDPGTEARYRREGARFIFDVGTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFAQFGDDPKEEVMVLERILLQTIKFDLQVEHPYMFLLRYVKQLKGDKNKVCKVLQMAWTFVNDSLCTMLSLQWEPEIIAVAVMYLAGRLCKFDIQEWTSKQSSRRWWEQFVQDVPVELLEDICHQILDLYS 274          
BLAST of Cyclin-K vs. Ensembl Medaka
Match: ccnt1 (cyclin T1 [Source:NCBI gene;Acc:101175653])

HSP 1 Score: 137.502 bits (345), Expect = 6.346e-38
Identity = 75/241 (31.12%), Postives = 132/241 (54.77%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLT--ASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFS-EFGNDP----KEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILD 747
            WYF ++E+ N PS   G+DP  E  YR + A  I ++G +L +   T  TA+VY HRFYM  SF    R ++  +   LFLA KVEE P+K   ++ +  + L+ +  S +  +D      ++++ +E I+L+T+ F++ + HP+ +++   Q ++  +     L Q S+    +SL  T  CL++ P +VAC  ++LA K +  EI    +   G+ WWE     +T+E+++     +L+
Sbjct:   13 WYFTRQEIDNNPSRRAGLDPDKELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTRFHRNVSVISPAALFLAAKVEEQPRKLEHVIKVAHACLNPQEPSPDVRSDAYLTQAQDLVILESIILQTLAFEITIDHPHTHVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFCLQYCPPVVACVCIHLACKWSNWEIPVSTD---GKHWWEYVDPTVTLELLDGTSQILLN 246          
BLAST of Cyclin-K vs. Ensembl Medaka
Match: ccnt2a (cyclin T2 [Source:NCBI gene;Acc:101159477])

HSP 1 Score: 144.436 bits (363), Expect = 1.526e-37
Identity = 76/243 (31.28%), Postives = 134/243 (55.14%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPK--------EEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W+F +++L +TPS   G++P  E  YR + A  I ++G +L +   T  TA+VY HRFYM HSF    R + +   LFLA KVEE P+K   ++ +  + L+ +   E   D K        +E++ +E I+L+T+ F++ + HP+  ++   Q ++  +     L Q S+    +SL  T  CL+ +P ++AC  ++LA K +  EI    +   G+ WWE     +T+E+++++ H+ L +
Sbjct:   70 WFFTRDQLESTPSRRCGVEPDRELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQ---EPPLDTKSNAYLQQAQELVILESIVLQTLGFEITIDHPHTDVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFCLQHKPTVIACVCIHLACKWSNWEIPVSTD---GKHWWEYVDNSVTLELLDELTHEFLQI 302          
BLAST of Cyclin-K vs. Ensembl Medaka
Match: ccnt2a (cyclin T2 [Source:NCBI gene;Acc:101159477])

HSP 1 Score: 144.436 bits (363), Expect = 1.582e-37
Identity = 76/243 (31.28%), Postives = 134/243 (55.14%), Query Frame = 1
Query:   49 WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPK--------EEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            W+F +++L +TPS   G++P  E  YR + A  I ++G +L +   T  TA+VY HRFYM HSF    R + +   LFLA KVEE P+K   ++ +  + L+ +   E   D K        +E++ +E I+L+T+ F++ + HP+  ++   Q ++  +     L Q S+    +SL  T  CL+ +P ++AC  ++LA K +  EI    +   G+ WWE     +T+E+++++ H+ L +
Sbjct:   70 WFFTRDQLESTPSRRCGVEPDRELSYRQQAANLIQDMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFHRNIISPTTLFLAAKVEEQPRKLEHVIKVAHACLNPQ---EPPLDTKSNAYLQQAQELVILESIVLQTLGFEITIDHPHTDVVKCTQLVRASKD----LAQTSYFMATNSLHLTTFCLQHKPTVIACVCIHLACKWSNWEIPVSTD---GKHWWEYVDNSVTLELLDELTHEFLQI 302          
BLAST of Cyclin-K vs. Ensembl Medaka
Match: ccnt2b (cyclin-T2 [Source:NCBI gene;Acc:101157196])

HSP 1 Score: 141.739 bits (356), Expect = 5.234e-37
Identity = 80/253 (31.62%), Postives = 133/253 (52.57%), Query Frame = 1
Query:   25 MDEHSMPC--WYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPK--------EEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLR-TNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDL 750
            M  H  P   W F +E+L NTPS   GI+   E  YR + A  I ++G +L +      TA+VY HRFYM HSF    R + +   LFLA KVEE P+K   ++ +  + ++ +   E   D K         E++ +E I+L+T+ F++ V HP+  ++   Q ++  +     L Q S+    +SL  T  CL++ P +VAC  ++LA K +  EI    +   G+ WWE     +T+++++++ H+ L +
Sbjct:    1 MAVHRGPSTKWLFTREQLENTPSRRCGIEADRELSYRQQAANLIQDIGQRLNVSQLIINTAIVYMHRFYMIHSFTKFHRNIISQTTLFLAAKVEEQPRKLEHVIKMAHAFINPQ---EPALDTKSSAFQLQAHELVVLESIVLQTLGFEITVDHPHTDVVRCSQLVRASRD----LAQTSYFMATNSLHLTTFCLEYRPTVVACVCIHLACKWSNWEIPVSTD---GKHWWEYVDRTVTLQLLDELTHEFLQI 243          
BLAST of Cyclin-K vs. Planmine SMEST
Match: SMESG000004055.1 (SMESG000004055.1)

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 325/326 (99.69%), Postives = 326/326 (100.00%), Query Frame = 1
Query:   25 MDEHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPKTAKSYXXXXXXXXXXXXXXXXXXXXXXAKRSRSDHHVAPFERPKKVHSYPDGQPSSGASGLNSIKSNHFGFQPENADHP 1002
            MDEHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHF+EFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPKTAKSYSESNNQSSTTPPNPPSTSASTPAKRSRSDHHVAPFERPKKVHSYPDGQPSSGASGLNSIKSNHFGFQPENADHP
Sbjct:    1 MDEHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFNEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPKTAKSYSESNNQSSTTPPNPPSTSASTPAKRSRSDHHVAPFERPKKVHSYPDGQPSSGASGLNSIKSNHFGFQPENADHP 326          
BLAST of Cyclin-K vs. Planmine SMEST
Match: SMESG000075514.1 (SMESG000075514.1)

HSP 1 Score: 111.309 bits (277), Expect = 7.444e-27
Identity = 77/233 (33.05%), Postives = 116/233 (49.79%), Query Frame = 1
Query:   79 TPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDP-------KEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYS 756
            TPS  D +D   E+K R  G   I + G  L L     A A V +HRFY   SF        A  C+FL+ K+EE+ ++ RD+VT+   +   +  S F   P       K  I+  ER +LK + F +   HP+K L+     + G+  N+E L Q+SW ++NDSLRT +   + PE +ACA ++LA++             +G   +E F   ++ + +E I   IL LYS
Sbjct:   14 TPSELDNLDAESENKLRVLGCESIQDAGKLLKLPQVAVACAQVLYHRFYFSKSFVRHNWEHYAMACVFLSAKIEESCRRLRDVVTVFVHLRQFREQSVFKPFPIPEYAELKPHIIKAERRILKELGFCVHGKHPHK-LICLCLHVLGQTDNIE-LAQLSWNYMNDSLRTTVFACYHPETIACACIFLASR--------HLQCHLGTNCFEIF--NVSEDTLETISLSILKLYS 234          
BLAST of Cyclin-K vs. Planmine SMEST
Match: SMESG000075514.1 (SMESG000075514.1)

HSP 1 Score: 110.923 bits (276), Expect = 1.152e-26
Identity = 77/233 (33.05%), Postives = 116/233 (49.79%), Query Frame = 1
Query:   79 TPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDP-------KEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLATKLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYS 756
            TPS  D +D   E+K R  G   I + G  L L     A A V +HRFY   SF        A  C+FL+ K+EE+ ++ RD+VT+   +   +  S F   P       K  I+  ER +LK + F +   HP+K L+     + G+  N+E L Q+SW ++NDSLRT +   + PE +ACA ++LA++             +G   +E F   ++ + +E I   IL LYS
Sbjct:   29 TPSELDNLDAESENKLRVLGCESIQDAGKLLKLPQVAVACAQVLYHRFYFSKSFVRHNWEHYAMACVFLSAKIEESCRRLRDVVTVFVHLRQFREQSVFKPFPIPEYAELKPHIIKAERRILKELGFCVHGKHPHK-LICLCLHVLGQTDNIE-LAQLSWNYMNDSLRTTVFACYHPETIACACIFLASR--------HLQCHLGTNCFEIF--NVSEDTLETISLSILKLYS 249          
BLAST of Cyclin-K vs. Planmine SMEST
Match: SMESG000028921.1 (SMESG000028921.1)

HSP 1 Score: 97.4413 bits (241), Expect = 9.012e-23
Identity = 65/196 (33.16%), Postives = 105/196 (53.57%), Query Frame = 1
Query:  115 EDKYRN-----EGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDPKE------EIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQT--NVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLAT---KLNKQEIESW 654
            ED+Y+       G TF    G KLGL+    ATA+ YF RFY  +S K++  +L     LFLA K+EE     +  +  T + + K+ FS++   P+E      +++  E IL++ +   L V HPY+ LL Y + +       +   ++Q +W  +NDSLRT+L L + P +++   L+LA    K N++ I+SW
Sbjct:   35 EDEYQKLMIFFTGVTF--SFGEKLGLRQQVIATAVTYFKRFYAMYSLKSVDPWLMGQTALFLASKIEEFGLVSQKSIIQTCNSVIKQKFSQYF--PREYPHKIQDVLDCEFILVEVLDCSLIVFHPYRSLLLYSENLSTSPNYQHDSSILQKAWKIVNDSLRTDLMLYYPPYLISLGCLFLACVMDKKNEEAIQSW 226          
BLAST of Cyclin-K vs. Planmine SMEST
Match: SMESG000075514.1 (SMESG000075514.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.089e-15
Identity = 57/184 (30.98%), Postives = 87/184 (47.28%), Query Frame = 1
Query:   22 KMDEHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLGLKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRDIVTITKSILDKKHFSEFGNDP-------KEEIMTMERILLKTIKFDLQVSHPYKYLLNYVQKIKGKQTNVERLVQMSWTFIND 552
            KMD+  +P       + + TPS  D +D   E+K R  G   I + G  L L     A A V +HRFY   SF        A  C+FL+ K+EE+ ++ RD+VT+   +   +  S F   P       K  I+  ER +LK + F +   HP+K L+     + G+  N+E L Q+S   + +
Sbjct:   15 KMDDVFIP-----PHKAKPTPSELDNLDAESENKLRVLGCESIQDAGKLLKLPQVAVACAQVLYHRFYFSKSFVRHNWEHYAMACVFLSAKIEESCRRLRDVVTVFVHLRQFREQSVFKPFPIPEYAELKPHIIKAERRILKELGFCVHGKHPHK-LICLCLHVLGQTDNIE-LAQLSCLLLKN 191          
The following BLAST results are available for this feature:
BLAST of Cyclin-K vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCNK3.309e-11458.78cyclin K [Source:HGNC Symbol;Acc:HGNC:1596][more]
CCNK1.412e-11258.78cyclin K [Source:HGNC Symbol;Acc:HGNC:1596][more]
CCNK1.206e-9860.10cyclin K [Source:HGNC Symbol;Acc:HGNC:1596][more]
CCNK2.444e-3961.96cyclin K [Source:HGNC Symbol;Acc:HGNC:1596][more]
CCNT16.842e-3932.92cyclin T1 [Source:HGNC Symbol;Acc:HGNC:1599][more]
back to top
BLAST of Cyclin-K vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnk-17.631e-5139.60CyCliN K [Source:UniProtKB/TrEMBL;Acc:O17869][more]
ccnk-17.631e-5139.60CyCliN K [Source:UniProtKB/TrEMBL;Acc:O17869][more]
cyl-14.118e-2426.32cyclin L [Source:UniProtKB/TrEMBL;Acc:G5EBX3][more]
cyl-14.118e-2426.32cyclin L [Source:UniProtKB/TrEMBL;Acc:G5EBX3][more]
cit-1.12.026e-2326.67Cyclin-T1.1 [Source:UniProtKB/Swiss-Prot;Acc:P344... [more]
back to top
BLAST of Cyclin-K vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CycK6.858e-11159.83gene:FBgn0025674 transcript:FBtr0344022[more]
CycK6.858e-11159.83gene:FBgn0025674 transcript:FBtr0085942[more]
CycK6.858e-11159.83gene:FBgn0025674 transcript:FBtr0085941[more]
CycT1.046e-3332.50gene:FBgn0025455 transcript:FBtr0333124[more]
CycT1.046e-3332.50gene:FBgn0025455 transcript:FBtr0075205[more]
back to top
BLAST of Cyclin-K vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnk1.695e-11259.18cyclin K [Source:NCBI gene;Acc:569432][more]
ccnk6.927e-11259.18cyclin K [Source:NCBI gene;Acc:569432][more]
ccnt12.104e-4032.08cyclin T1 [Source:ZFIN;Acc:ZDB-GENE-030131-6397][more]
ccnt2a2.517e-3831.69cyclin T2a [Source:ZFIN;Acc:ZDB-GENE-030131-5779][more]
ccnt2a2.794e-3831.69cyclin T2a [Source:ZFIN;Acc:ZDB-GENE-030131-5779][more]
back to top
BLAST of Cyclin-K vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnk2.031e-11358.78cyclin K [Source:NCBI gene;Acc:779776][more]
ccnk4.318e-11358.78cyclin K [Source:NCBI gene;Acc:779776][more]
ccnk2.553e-11158.78cyclin K [Source:NCBI gene;Acc:779776][more]
CCNT25.301e-3831.82cyclin T2 [Source:NCBI gene;Acc:100488125][more]
CCNT26.063e-3831.82cyclin T2 [Source:NCBI gene;Acc:100488125][more]
back to top
BLAST of Cyclin-K vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ccnk6.953e-11358.78cyclin K [Source:MGI Symbol;Acc:MGI:1276106][more]
Ccnk6.953e-11358.78cyclin K [Source:MGI Symbol;Acc:MGI:1276106][more]
Ccnt12.147e-3832.51cyclin T1 [Source:MGI Symbol;Acc:MGI:1328363][more]
Ccnt12.147e-3832.51cyclin T1 [Source:MGI Symbol;Acc:MGI:1328363][more]
Ccnt23.522e-3631.28cyclin T2 [Source:MGI Symbol;Acc:MGI:1920199][more]
back to top
BLAST of Cyclin-K vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O88874|CCNK_MOUSE2.141e-11258.78Cyclin-K OS=Mus musculus OX=10090 GN=Ccnk PE=1 SV=... [more]
sp|O75909|CCNK_HUMAN6.779e-11258.78Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=2[more]
sp|F1QMB9|CCNK_DANRE1.279e-11159.18Cyclin-K OS=Danio rerio OX=7955 GN=ccnk PE=2 SV=3[more]
sp|Q2QQS5|CCT14_ORYSJ1.149e-4738.62Cyclin-T1-4 OS=Oryza sativa subsp. japonica OX=399... [more]
sp|Q2RAC5|CCT13_ORYSJ3.577e-4637.45Cyclin-T1-3 OS=Oryza sativa subsp. japonica OX=399... [more]
back to top
BLAST of Cyclin-K vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V5F86.025e-12266.94Putative cyclin k OS=Schistosoma mansoni OX=6183 G... [more]
A0A1S8WI221.364e-12167.65Cyclin domain protein OS=Opisthorchis viverrini OX... [more]
A0A183K0F31.005e-12067.65Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A5J4NQN61.217e-12065.02Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A094ZYI21.456e-12067.65Cyclin-K OS=Schistosoma haematobium OX=6185 GN=MS3... [more]
back to top
BLAST of Cyclin-K vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnk1.545e-11358.40cyclin K [Source:NCBI gene;Acc:103046138][more]
ccnt2b1.459e-3830.99cyclin-T2-like [Source:NCBI gene;Acc:103028284][more]
ccnt2a2.204e-3831.69cyclin T2 [Source:NCBI gene;Acc:103023729][more]
ccnt2a2.625e-3831.69cyclin T2 [Source:NCBI gene;Acc:103023729][more]
ccnt2b2.126e-3730.83cyclin-T2-like [Source:NCBI gene;Acc:103028284][more]
back to top
BLAST of Cyclin-K vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003409.12.349e-9354.31pep scaffold:Pmarinus_7.0:GL483875:8555:11659:-1 g... [more]
ENSPMAT00000003411.12.792e-9159.02pep scaffold:Pmarinus_7.0:GL483875:8648:11677:-1 g... [more]
ENSPMAT00000003616.11.608e-3630.00pep scaffold:Pmarinus_7.0:GL476475:418210:425326:1... [more]
ccnc1.510e-2331.13cyclin C [Source:ZFIN;Acc:ZDB-GENE-030131-7369][more]
ccnq4.505e-2029.74cyclin Q [Source:NCBI gene;Acc:553650][more]
back to top
BLAST of Cyclin-K vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SSN87.792e-1628.31Cyclin-like component of the RNA polymerase II hol... [more]
CTK21.586e-1127.61Beta subunit of C-terminal domain kinase I (CTDK-I... [more]
CLB23.273e-723.18B-type cyclin involved in cell cycle progression; ... [more]
back to top
BLAST of Cyclin-K vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO485782.375e-7759.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429054.729e-4333.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456441.834e-2327.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347982.609e-2329.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329176.051e-2128.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclin-K vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnk6.134e-11259.09cyclin K [Source:NCBI gene;Acc:101155650][more]
ccnt16.346e-3831.12cyclin T1 [Source:NCBI gene;Acc:101175653][more]
ccnt2a1.526e-3731.28cyclin T2 [Source:NCBI gene;Acc:101159477][more]
ccnt2a1.582e-3731.28cyclin T2 [Source:NCBI gene;Acc:101159477][more]
ccnt2b5.234e-3731.62cyclin-T2 [Source:NCBI gene;Acc:101157196][more]
back to top
BLAST of Cyclin-K vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004055.10.000e+099.69SMESG000004055.1[more]
SMESG000075514.17.444e-2733.05SMESG000075514.1[more]
SMESG000075514.11.152e-2633.05SMESG000075514.1[more]
SMESG000028921.19.012e-2333.16SMESG000028921.1[more]
SMESG000075514.11.089e-1530.98SMESG000075514.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008744 ID=SMED30008744|Name=Cyclin-K|organism=Schmidtea mediterranea sexual|type=transcript|length=1147bp
CTTGATTTATCGACAATTTGAAAGATGGATGAACATTCTATGCCATGTTG
GTATTTTGAAAAAGAAGAACTTAGAAATACTCCATCTTTAGCAGATGGGA
TTGATCCACGCGTTGAAGATAAATACCGCAACGAAGGAGCTACATTTATA
AGTGAACTAGGAAATAAGCTTGGTCTTAAATATGATACATGTGCGACTGC
AATGGTTTACTTTCACCGATTTTACATGTTCCATTCATTTAAAACTATGC
CTAGATTTTTGACAGCATCATGCTGCTTATTCTTAGCTGGTAAAGTTGAA
GAAACTCCTAAGAAATGCAGAGATATTGTTACTATCACAAAGTCAATTTT
GGATAAAAAGCATTTTAGTGAATTTGGAAATGACCCAAAAGAAGAAATTA
TGACTATGGAAAGAATTTTATTGAAAACGATAAAATTCGATTTGCAAGTT
TCTCATCCCTATAAATATTTGCTTAATTATGTTCAAAAAATCAAAGGTAA
ACAAACTAACGTAGAAAGACTCGTTCAAATGTCATGGACTTTTATAAATG
ATAGTTTGAGAACAAATCTCTGTTTGAAATGGGAGCCAGAAATTGTAGCT
TGTGCTGTTTTATATTTAGCTACTAAATTGAATAAACAAGAAATCGAAAG
TTGGGAAAACCAGCAAGTCGGCCAAAAGTGGTGGGAAAGTTTCGTGGAAG
GAATGACAATTGAAGTTATGGAGGATATATGCCATCAAATTCTGGATTTG
TATTCAGATCCTAAAACCGCTAAATCCTATTCGGAATCAAACAATCAAAG
TAGTACGACACCTCCAAATCCTCCCTCTACAAGTGCTTCTACTCCAGCCA
AGCGATCTCGGTCCGATCATCACGTGGCACCGTTTGAAAGGCCGAAGAAG
GTACACAGTTATCCTGATGGTCAACCGAGTTCTGGAGCAAGCGGCCTCAA
TTCAATTAAGTCGAATCATTTTGGATTCCAGCCAGAAAATGCTGACCATC
CATAATAAAGTTAAAATATAAAATGTTAATAATAAAGTTAAAGAGTTCAT
TTGTTAGTGTCGAAATTAATCTTTGTGAAAGGCATTTCAATATCGAATTT
AAATTAATCAAATTTGTTACTTTCTATTTGAATTTTTATAGATTTTT
back to top

protein sequence of SMED30008744-orf-1

>SMED30008744-orf-1 ID=SMED30008744-orf-1|Name=SMED30008744-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=327bp
MDEHSMPCWYFEKEELRNTPSLADGIDPRVEDKYRNEGATFISELGNKLG
LKYDTCATAMVYFHRFYMFHSFKTMPRFLTASCCLFLAGKVEETPKKCRD
IVTITKSILDKKHFSEFGNDPKEEIMTMERILLKTIKFDLQVSHPYKYLL
NYVQKIKGKQTNVERLVQMSWTFINDSLRTNLCLKWEPEIVACAVLYLAT
KLNKQEIESWENQQVGQKWWESFVEGMTIEVMEDICHQILDLYSDPKTAK
SYSESNNQSSTTPPNPPSTSASTPAKRSRSDHHVAPFERPKKVHSYPDGQ
PSSGASGLNSIKSNHFGFQPENADHP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000079regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0006357regulation of transcription from RNA polymerase II promoter
Vocabulary: molecular function
TermDefinition
GO:0016538cyclin-dependent protein serine/threonine kinase regulator activity
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR043198Cyclin/Ssn8
IPR036915Cyclin-like_sf
IPR013763Cyclin-like
IPR006671Cyclin_N
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013763Cyclin-likeSMARTSM00385cyclin_7coord: 40..134
e-value: 7.4E-13
score: 58.7
coord: 147..238
e-value: 1.3
score: 9.6
IPR013763Cyclin-likeCDDcd00043CYCLINcoord: 142..202
e-value: 5.88389E-5
score: 39.1441
IPR013763Cyclin-likeCDDcd00043CYCLINcoord: 35..133
e-value: 1.34663E-18
score: 77.2788
NoneNo IPR availablePIRSFPIRSF036580Cyclin_Lcoord: 4..302
e-value: 1.0E-50
score: 170.5
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 142..251
e-value: 9.9E-44
score: 150.0
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 1..141
e-value: 1.7E-51
score: 175.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 276..295
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 250..275
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 299..317
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 250..326
NoneNo IPR availablePANTHERPTHR10026:SF110CYCLIN-Kcoord: 6..295
IPR006671Cyclin, N-terminalPFAMPF00134Cyclin_Ncoord: 9..140
e-value: 2.3E-19
score: 69.4
IPR043198Cyclin/Cyclin-like subunit Ssn8PANTHERPTHR10026CYCLINcoord: 6..295
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 6..142
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 144..246