mitochondrial sodium/calcium exchanger protein

Overview
Namemitochondrial sodium/calcium exchanger protein
Smed IDSMED30008728
Uniprot Best hitMitochondrial sodium/calcium exchanger protein OS=Rattus norvegicus OX=10116 GN=Slc8b1 PE=1 SV=1 (E=1.56771e-38)
Length (bp)2820
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008728

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30008728SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008728SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008728SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008728SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30008728SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the whole animalSMED30008728SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
collecting ductSMED30008728SMESG000022802.1 Smed-slc24a-2smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 155.221 bits (391), Expect = 3.598e-39
Identity = 95/271 (35.06%), Postives = 148/271 (54.61%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2758
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y          +  + +I G  +  V  F +   +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+   ++       V+L    +   VL   + L    +L+ +PL  FQ  R YG  L+  Y+ + V+ +L    +I +
Sbjct:  255 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHL 525          

HSP 2 Score: 60.4622 bits (145), Expect = 9.981e-9
Identity = 42/119 (35.29%), Postives = 63/119 (52.94%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP---TIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            N S+ C +I     C  + G+++Y +  +C F     P   T+ +       L    TAA  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA G +
Sbjct:   60 NVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAK-FFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGAL 174          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 154.836 bits (390), Expect = 8.452e-39
Identity = 95/271 (35.06%), Postives = 148/271 (54.61%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2758
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y          +  + +I G  +  V  F +   +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+   ++       V+L    +   VL   + L    +L+ +PL  FQ  R YG  L+  Y+ + V+ +L    +I +
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHL 581          

HSP 2 Score: 60.4622 bits (145), Expect = 5.720e-18
Identity = 42/119 (35.29%), Postives = 63/119 (52.94%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP---TIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            N S+ C +I     C  + G+++Y +  +C F     P   T+ +       L    TAA  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA G +
Sbjct:   60 NVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAK-FFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGAL 174          

HSP 3 Score: 51.9878 bits (123), Expect = 5.720e-18
Identity = 24/78 (30.77%), Postives = 41/78 (52.56%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+ V ++ AG I I+ PF    RP  +D +FY   +     +  R ++ L  +L +L LY  Y++  ++   +Y R
Sbjct:  176 GAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQR 253          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 154.836 bits (390), Expect = 8.452e-39
Identity = 95/271 (35.06%), Postives = 148/271 (54.61%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2758
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y          +  + +I G  +  V  F +   +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+   ++       V+L    +   VL   + L    +L+ +PL  FQ  R YG  L+  Y+ + V+ +L    +I +
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHL 581          

HSP 2 Score: 60.4622 bits (145), Expect = 5.720e-18
Identity = 42/119 (35.29%), Postives = 63/119 (52.94%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP---TIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            N S+ C +I     C  + G+++Y +  +C F     P   T+ +       L    TAA  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA G +
Sbjct:   60 NVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAK-FFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGAL 174          

HSP 3 Score: 51.9878 bits (123), Expect = 5.720e-18
Identity = 24/78 (30.77%), Postives = 41/78 (52.56%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+ V ++ AG I I+ PF    RP  +D +FY   +     +  R ++ L  +L +L LY  Y++  ++   +Y R
Sbjct:  176 GAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQR 253          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 140.584 bits (353), Expect = 3.005e-35
Identity = 77/195 (39.49%), Postives = 115/195 (58.97%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2539
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y          +  + +I G  +  V  F +   +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  181 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 375          

HSP 2 Score: 53.1434 bits (126), Expect = 1.445e-13
Identity = 24/78 (30.77%), Postives = 41/78 (52.56%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+ V ++ AG I I+ PF    RP  +D +FY   +     +  R ++ L  +L +L LY  Y++  ++   +Y R
Sbjct:   46 GAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQR 123          

HSP 3 Score: 44.2838 bits (103), Expect = 1.445e-13
Identity = 24/46 (52.17%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  292 TMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA G +
Sbjct:    2 TLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGAL 44          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 60.8474 bits (146), Expect = 9.162e-15
Identity = 42/119 (35.29%), Postives = 63/119 (52.94%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP---TIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            N S+ C +I     C  + G+++Y +  +C F     P   T+ +       L    TAA  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA G +
Sbjct:   60 NVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAK-FFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGAL 174          

HSP 2 Score: 40.817 bits (94), Expect = 9.162e-15
Identity = 18/55 (32.73%), Postives = 29/55 (52.73%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIEL-WS 605
            GAG+ V ++ AG I I+ PF    RP  +D +FY   +     +  R ++ L W+
Sbjct:  176 GAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWA 230          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Match: ncx-7 (Putative sodium/calcium exchanger 7 [Source:UniProtKB/Swiss-Prot;Acc:P34322])

HSP 1 Score: 152.91 bits (385), Expect = 3.707e-38
Identity = 89/258 (34.50%), Postives = 150/258 (58.14%), Query Frame = 2
Query: 1967 DLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVY-NTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGP-IPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2734
            + E+W E + FSK ++ I      +  LTIP+ + +     W K L  +H      F +     +  TPF  S  L VY   +   +  +++ FT    +P  Y+  +++ G I SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++ K  YPR+  +A +GGPLFNLL+G G+PF+I    G  I + +  T  +LI  + +     L+ +P+ KF+ +R +  +LI+IY+ + V VIL
Sbjct:  411 EAEDWEEMNIFSKVMAYINVVPNLLFKLTIPLNEMS-----WSKPLTLLHAFTCPAFLLFSIQFFLETPFSGSPGLWVYGLAVSIVLAILIMVFTELSVQPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQGKYISMTINPTYRLLILFLAISLLATLIGIPVQKFRLQRPHAAVLISIYIAFIVFVIL 663          

HSP 2 Score: 61.2326 bits (147), Expect = 1.687e-17
Identity = 37/115 (32.17%), Postives = 65/115 (56.52%), Query Frame = 1
Query:   88 SNICQYITFFSSCIPNSGFINYFQWQYC--SFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGI 426
              +C Y+    +     G++ + Q+  C  S  +R    I+ +++ L L   +++AAD F +P +  +   +R+SE++AGVT +A GNGA DVF S+++V S+  P   LA G +
Sbjct:   53 EQVCDYVNCNDNACEGGGYLLWTQYVECASSTFSRVILIIVGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGEL 167          

HSP 3 Score: 48.1358 bits (113), Expect = 1.687e-17
Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFI-RRQIELWSSLVFLILYAIYILVTVIS 659
            G G+FV ++    I++ +PF +     I+D LFY   L +  F F+   ++ LW  L FL LY +Y+ +TVI 
Sbjct:  169 GGGLFVTTMVVSTIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLWMPLTFLGLYLLYV-ITVIG 240          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Match: ncx-6 (Putative sodium/calcium exchanger 6 [Source:UniProtKB/Swiss-Prot;Acc:P34315])

HSP 1 Score: 145.591 bits (366), Expect = 3.979e-36
Identity = 96/309 (31.07%), Postives = 169/309 (54.69%), Query Frame = 2
Query: 1835 KGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPV-DLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN-TPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGP-IPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2752
             G+H +      + +  IE  E   +  +F G    F   + P   ++EW E + F K ++++ +   F+  LTIP  ++      W K +  + CL+  VF +    V + +PF  S  L +Y  I+   +   V+ FT    +PP Y+   ++ G + SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++AK  YPR+  +A +GG LFNLL+G G+PF+I    G  I + +  T  +L+  + +     L+ +   K+  +R +   L+ IY+ +FV + L   DI+
Sbjct:  285 HGHHVLHAHEVMKMEAEIEAVEPLKTW-SFRGVVHDFKEHLKPWPSMDEWDEMNIFQKVIAVLNTIPNFLFKLTIPHSEQP-----WSKPITLLQCLICPVFLLFCIQVCSISPFPNSPGLWMYGLILSVLLTAAVLFFTELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTIAKIQGKSISMIINPTYRLLMLFLAISLIFTLIAMFAQKYFLRRIHSYSLVFIYISFFVFIGLSLDDIL 587          

HSP 2 Score: 59.6918 bits (143), Expect = 3.285e-17
Identity = 35/117 (29.91%), Postives = 65/117 (55.56%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDN--RWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGI 426
            N + +C+Y+          G++ + ++  C+     R    I  +++ L L   +++AAD F +P +  +   +R+SE++AGVT +A GNGA DVF ++++V S+  P   LA G +
Sbjct:   60 NSTQVCEYVKCNDDNCEGGGYVLWTRYVECASSPAVRIILIITGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSSPTPKADLALGEL 176          

HSP 3 Score: 48.9062 bits (115), Expect = 3.285e-17
Identity = 25/79 (31.65%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRR-QIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+FV ++   + +   PFK      I+D  FY   L +  F F+    +E+W  + FL +Y IY+   ++S++L+ R
Sbjct:  178 GAGLFVTTMVLAVTIFTRPFKAEVFSSIRDIAFYLVALAFLAFCFVYYDHVEIWMPITFLGVYLIYVCTVILSQILHNR 256          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Match: ncx-9 (Mitochondrial sodium/calcium exchanger protein [Source:UniProtKB/Swiss-Prot;Acc:O16242])

HSP 1 Score: 127.102 bits (318), Expect = 8.680e-30
Identity = 78/265 (29.43%), Postives = 147/265 (55.47%), Query Frame = 2
Query: 1973 EEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN-TPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG---PIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIK 2755
            +E+ E + F K +++I+   +F   LT+P  + +     WCK L  +HC  S+ F +    +    PF  S  L +Y       +  V + F     +   Y+  ++++G + SI WIY  +NEIV+++++ GVV  +S  +LGL+++A++N  GD+V+++ + K  YP++  +A +GGPLFNLL+G G+PF+I    G    + +      ++L   I LVT    + L + +F  +R + ++LI I+V++ + + L    +++
Sbjct:  442 DEFSEMNIFIKIVTVIKVVPVFFFKLTVPSNEMS-----WCKPLFILHCFASIQFALFSIQIITLKPFDGSPGLWLYGLGFSAILAMVAMYFLPLSKEQKYYKEIYSYLGFLMSIAWIYATSNEIVSVVTMIGVVTGLSMELLGLTIMAWSNCIGDIVADIAVVKQGYPKMAMAAAIGGPLFNLLIGFGLPFTIAAAQGKEMELLINPVYRLLMLFLGISLVT--TFVALFIQRFTVRRPHAVLLIFIFVVFLIFICLAEFHVLE 699          

HSP 2 Score: 62.3882 bits (150), Expect = 4.292e-18
Identity = 29/63 (46.03%), Postives = 41/63 (65.08%), Query Frame = 1
Query:  238 IATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGI 426
            +++ AD F  P +  +   +RMSE++AGVT LA GNGA DVFSS+S+V +   P   LA G +
Sbjct:  118 MSSIADDFFCPAISGIVSHLRMSESIAGVTFLAFGNGAPDVFSSISSVLTTPKPKADLALGDL 180          

HSP 3 Score: 48.9062 bits (115), Expect = 4.292e-18
Identity = 23/72 (31.94%), Postives = 42/72 (58.33%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRR-QIELWSSLVFLILYAIYILVTVI 656
            G  IFV ++   II+    FK+   P ++D +FY + L + +F F++  +IE+W    FL +Y +Y++  +I
Sbjct:  182 GTSIFVTTVVLAIIIFTKSFKVAIIPTLRDLIFYMTTLAFIVFCFLKFDKIEVWMPATFLGIYGVYVVTVII 253          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Match: ncx-10 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q965R5])

HSP 1 Score: 118.627 bits (296), Expect = 1.753e-27
Identity = 77/274 (28.10%), Postives = 148/274 (54.01%), Query Frame = 2
Query: 1973 EEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNV-YNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLF-----------------NLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTAL--NLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2734
            +E+ E + FS+F++++     F L LTIP  +       W K +  IHC  S+   +    +   +PF  S  L +Y  +I   +  + + FT    +   Y+  ++++G + SI WIY I++EI+N++++ GV   +S  ILGL+++A++N  GD+VS+V + K  +P++  +A +GGPLF                 +LL+G G+PF+I    G   + L  T +  +  + L  +L  +L+ + + +F+ +  + + L+T++V + + V+L
Sbjct:  275 DEFYEMNYFSRFITVVAVIPTFFLKLTIPSNE-----MPWSKPILIIHCFCSIQLALFAVQISAKSPFHGSPGLWLYGLLISIILSLLALRFTPLDREQKYYREVYSYLGFLMSIAWIYTISSEIINVITMIGVATGVSQEILGLTIMAWSNCIGDIVSDVAVVKQGFPKMAMAAAIGGPLFSKLYSRPCQIKITTYISDLLIGFGLPFTIACLQGK-QIDLIITPVYRLLMLFLAISLFTSLIAIFVQRFKVRWPHAVALLTVFVAFLIFVLL 542          

HSP 2 Score: 55.8398 bits (133), Expect = 1.796e-12
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 1
Query:  238 IATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLA 414
            +   AD F +P +  + + +++SE++AGVT LA GNGA DVF S+++V +   P   LA
Sbjct:    1 MTVVADDFFSPSIAGIVRHLKISESIAGVTFLAFGNGAPDVFGSIASVITTPKPKADLA 59          

HSP 3 Score: 36.5798 bits (83), Expect = 1.796e-12
Identity = 20/71 (28.17%), Postives = 37/71 (52.11%), Query Frame = 3
Query:  456 FVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIR-RQIELWSSLVFLILYAIYILVTVISRL 665
            FV ++    I++   F++     I+D +F+    I+    F+    +E+W  L FL LYA Y++  ++ RL
Sbjct:   69 FVTTVVLSAIILTKSFRIAILATIRDIVFFIIADIFLAIWFLTFNHVEIWMPLTFLGLYAAYVVSVILMRL 139          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Match: ncx-10 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q965R5])

HSP 1 Score: 118.627 bits (296), Expect = 3.603e-27
Identity = 77/274 (28.10%), Postives = 148/274 (54.01%), Query Frame = 2
Query: 1973 EEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNV-YNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLF-----------------NLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTAL--NLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2734
            +E+ E + FS+F++++     F L LTIP  +       W K +  IHC  S+   +    +   +PF  S  L +Y  +I   +  + + FT    +   Y+  ++++G + SI WIY I++EI+N++++ GV   +S  ILGL+++A++N  GD+VS+V + K  +P++  +A +GGPLF                 +LL+G G+PF+I    G   + L  T +  +  + L  +L  +L+ + + +F+ +  + + L+T++V + + V+L
Sbjct:  392 DEFYEMNYFSRFITVVAVIPTFFLKLTIPSNE-----MPWSKPILIIHCFCSIQLALFAVQISAKSPFHGSPGLWLYGLLISIILSLLALRFTPLDREQKYYREVYSYLGFLMSIAWIYTISSEIINVITMIGVATGVSQEILGLTIMAWSNCIGDIVSDVAVVKQGFPKMAMAAAIGGPLFSKLYSRPCQIKITTYISDLLIGFGLPFTIACLQGK-QIDLIITPVYRLLMLFLAISLFTSLIAIFVQRFKVRWPHAVALLTVFVAFLIFVLL 659          

HSP 2 Score: 56.225 bits (134), Expect = 1.421e-12
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 1
Query:  238 IATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLA 414
            +   AD F +P +  + + +++SE++AGVT LA GNGA DVF S+++V +   P   LA
Sbjct:  118 MTVVADDFFSPSIAGIVRHLKISESIAGVTFLAFGNGAPDVFGSIASVITTPKPKADLA 176          

HSP 3 Score: 36.5798 bits (83), Expect = 1.421e-12
Identity = 20/71 (28.17%), Postives = 37/71 (52.11%), Query Frame = 3
Query:  456 FVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIR-RQIELWSSLVFLILYAIYILVTVISRL 665
            FV ++    I++   F++     I+D +F+    I+    F+    +E+W  L FL LYA Y++  ++ RL
Sbjct:  186 FVTTVVLSAIILTKSFRIAILATIRDIVFFIIADIFLAIWFLTFNHVEIWMPLTFLGLYAAYVVSVILMRL 256          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Match: CG12376 (gene:FBgn0033323 transcript:FBtr0339335)

HSP 1 Score: 100.523 bits (249), Expect = 1.008e-21
Identity = 78/289 (26.99%), Postives = 131/289 (45.33%), Query Frame = 2
Query: 1928 GPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-----LVFWVLLPNVYNT----PFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPV---QLTGTSIVLIFTIMLVTALN-LLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIK 2755
            G +K   + + P++ E+WR+ +   +   + + P + I  + IP+VD      GW K+LNCI  +L+     +    LL +  N+      G      +Y   I   I   +    S+ D PP Y   F  + L  S+  I+  A EI  +L V G +  +    +G +V A   S G L++NV +A + YPR+ Y++ +GGP F +++       ++   G +PV     TG   +  F  + +   + LL    + F  +R  GI  I  Y IY +  IL    +I 
Sbjct:  207 GLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAVIICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMYSLPITVPIAVFMF-IQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMGATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLFG-LPVSEANQTGNYGLNAFIFLNLGVFSTLLWSTTLGFFARRSVGIFSIVFYCIYLLFAILIHRKVIH 493          

HSP 2 Score: 38.5058 bits (88), Expect = 4.836e-7
Identity = 17/29 (58.62%), Postives = 26/29 (89.66%), Query Frame = 1
Query:  301 MSENLAGVTLLALGNGAADVFSSLSAVTS 387
            M+E++AGVTLLA GN +AD+FS+L++V +
Sbjct:    1 MNEHVAGVTLLAFGNSSADLFSNLASVNA 29          

HSP 3 Score: 35.8094 bits (81), Expect = 4.836e-7
Identity = 21/72 (29.17%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFY-FSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVI 656
             A +FV+ ++ G+I   +PFK+     ++D LF  F  ++   F+     +   S +V  ++Y  YILV V+
Sbjct:   39 AAALFVSMVSGGLICYTSPFKMNAYESVRDILFLIFGSMLLQYFLASSAHVPETSFIVMFLVYIFYILVNVV 110          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Match: CG12376 (gene:FBgn0033323 transcript:FBtr0088706)

HSP 1 Score: 100.908 bits (250), Expect = 1.540e-21
Identity = 78/289 (26.99%), Postives = 131/289 (45.33%), Query Frame = 2
Query: 1928 GPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-----LVFWVLLPNVYNT----PFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPV---QLTGTSIVLIFTIMLVTALN-LLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIK 2755
            G +K   + + P++ E+WR+ +   +   + + P + I  + IP+VD      GW K+LNCI  +L+     +    LL +  N+      G      +Y   I   I   +    S+ D PP Y   F  + L  S+  I+  A EI  +L V G +  +    +G +V A   S G L++NV +A + YPR+ Y++ +GGP F +++       ++   G +PV     TG   +  F  + +   + LL    + F  +R  GI  I  Y IY +  IL    +I 
Sbjct:  316 GLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAVIICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMYSLPITVPIAVFMF-IQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMGATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLFG-LPVSEANQTGNYGLNAFIFLNLGVFSTLLWSTTLGFFARRSVGIFSIVFYCIYLLFAILIHRKVIH 602          

HSP 2 Score: 43.8986 bits (102), Expect = 8.773e-9
Identity = 20/45 (44.44%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  253 DGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS 387
            + + +P L  V++ + M+E++AGVTLLA GN +AD+FS+L++V +
Sbjct:   94 NKYYSPALKAVSRFLCMNEHVAGVTLLAFGNSSADLFSNLASVNA 138          

HSP 3 Score: 36.1946 bits (82), Expect = 8.773e-9
Identity = 21/72 (29.17%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFY-FSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVI 656
             A +FV+ ++ G+I   +PFK+     ++D LF  F  ++   F+     +   S +V  ++Y  YILV V+
Sbjct:  148 AAALFVSMVSGGLICYTSPFKMNAYESVRDILFLIFGSMLLQYFLASSAHVPETSFIVMFLVYIFYILVNVV 219          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Match: CG14744 (gene:FBgn0033324 transcript:FBtr0307024)

HSP 1 Score: 98.5969 bits (244), Expect = 7.424e-21
Identity = 79/316 (25.00%), Postives = 144/316 (45.57%), Query Frame = 2
Query: 1856 PENENE------NKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL-----PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPF----SIRTFSGPIPVQLT-GTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIK 2755
            PE  +E      N+  +   EN  ++  F      F  ++ PVD E W+     ++   I + P +F+L L IP+VD      GW K+LNC   + +    + L      +VY T   T +F +      L   + +V+   S+ D PP Y   F  +   +S++ ++    E+  +  + G+VFN+S   + ++  A +N+T D+++N  LA   Y R+ ++A +GGP+F +LV + + F     +R       V    G +  L   I +VT   +       F  +R  G+ L  +Y+ + +  +    D++ 
Sbjct:  300 PERRSEHVDYELNRTALHDSENPKNLQLF----TEFFQSLNPVDAEAWQLGGWSNRIYLIARCPLVFVLQLFIPVVDYEKIKHGWSKLLNCTQIVTNPFVVITLVHSGVSSVYKTWHITLDFSISMWSPCLTVPLAIVIFLHSRTDVPPSYHHLFIILTFFSSMVTLWLAVTELEVLSEIVGIVFNLSESFMAVTFEAVSNATPDIIANYQLALQGYGRMAFAAIIGGPVFAILVSMSLAFIFNHRVREVGANSWVYGDLGDNCYLFLVITIVTT--MWWSVTFDFHARRSAGVFLWLVYLQFLLYAVCVEWDVVH 609          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Match: CG14743 (gene:FBgn0033326 transcript:FBtr0307023)

HSP 1 Score: 97.4413 bits (241), Expect = 1.850e-20
Identity = 69/269 (25.65%), Postives = 140/269 (52.04%), Query Frame = 2
Query: 1940 HFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWV---LLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSI-RTFSGPIPVQLTGTSIVLIFTIMLVTALNLL--CLPLMKFQPKRFYGIILITIYVIYFV 2722
             F   I P+D E W      ++ L I+++P   +L L +P+VD      GW K+LNC+  +L+  ++F +   +L + Y   +    F +    +++   + +VV   S+ D PP Y   +  + + T I++ +  A E+  ++S+ GVVF+++   + ++  + + +T DL++   LAK+ Y ++ + A +GG +++L V +GI   + +  +    V L G   V I+  +++T    L  CL    F  +R  G+ + +++V++ V
Sbjct:  321 EFLQAINPIDSEGWYLSGTCARILQILKAPVTLMLHLVVPLVDYQLVKHGWSKMLNCLQIVLTPFVIFALVETMLVHKYAEWYYVPQFRMAIWSLLVTMPLAIVVFLHSRTDIPPFYHSSYCALTISTVIIFFWICAWEMDALISIIGVVFDLAPSYMSITFNSVSAATADLIAYAHLAKHGYGKMAFGAIIGGSVYSLAVNVGIELVLQKKLNSRGQVVLYGDDGVTIYIFLVITITTTLWWCLTF-NFVARRSAGLFMWSLFVLFLV 588          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Match: CG5348 (gene:FBgn0034156 transcript:FBtr0305318)

HSP 1 Score: 97.4413 bits (241), Expect = 1.851e-20
Identity = 77/296 (26.01%), Postives = 135/296 (45.61%), Query Frame = 2
Query: 1925 PGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCI-----------------HCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGT--SIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIK 2755
             G ++ F L + P+  + W++    ++ L +I++P + I TL IP+VD      GW K+LN I                 H   + ++++ L N     +G S+F+L            V + F ++ D PP Y   F  + L  S+  I+  A EI  +L V G + +I    +G +V AF  + G L +N  +A + YP++ +++ +GG  F ++V       +R+  G            I  IF  M +  + LL    + F  +R  G+  I +YV+Y + V L   ++I 
Sbjct:  325 QGIFRDFFLALRPIKCQAWKQAELLNRVLLLIRAPAVVICTLYIPLVDYEMEKHGWNKLLNAINVVVNPALSISIFLSFMHRKGNFLWYISLQNT--LIYGASSFVLT-------VPFAVFILFHARTDVPPSYHWVFTIMNLTGSMFLIFLCATEIDTVLEVIGNILSIDDNYMGATVKAFTGNLGTLFANTAVAIHGYPKMAFASAIGGSFFTIVVTGNTVAYVRSLVGNRSEHHMEEYGEIAFIFLNMALFTI-LLWSTTLGFFARRSMGLYSIGLYVVYLLFVTLVHEEVIH 610          

HSP 2 Score: 44.2838 bits (103), Expect = 3.740e-6
Identity = 19/41 (46.34%), Postives = 32/41 (78.05%), Query Frame = 1
Query:  259 FLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAV 381
            + +P L  V++ + M+E+LAGVTL+A GN +AD F++L++V
Sbjct:  104 YYSPALKAVSRFLHMNEHLAGVTLMAFGNTSADFFANLASV 144          

HSP 3 Score: 26.9498 bits (58), Expect = 3.740e-6
Identity = 10/29 (34.48%), Postives = 19/29 (65.52%), Query Frame = 3
Query:  447 AGIFVNSITAGIIMIITPFKLMKRPVIKD 533
            + +FV +I+ G+I  I+PFK+     ++D
Sbjct:  157 SALFVITISGGLIFYISPFKMNSYETVRD 185          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Match: slc8b1 (solute carrier family 8 member B1 [Source:ZFIN;Acc:ZDB-GENE-130530-900])

HSP 1 Score: 64.3142 bits (155), Expect = 1.499e-22
Identity = 45/118 (38.14%), Postives = 62/118 (52.54%), Query Frame = 1
Query:   88 SNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP---TIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGIL 429
            S  C+Y+     C  + GFI Y    +C F     P   TI ++      L     A+D F  P L  +A T+R++ N+AGVT LALGNGA DVFS+++A    S+P   GLA G + 
Sbjct:   64 SQRCEYVKNTPDCASDEGFIKYPFVTFCLFTPSLLPLAITIYVIWLLFLFLVLGLIASD-FFCPNLSAIASTLRLTHNVAGVTFLALGNGAPDVFSAMAAF---SHPQTAGLAIGALF 177          

HSP 2 Score: 62.7734 bits (151), Expect = 1.499e-22
Identity = 25/78 (32.05%), Postives = 45/78 (57.69%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAGIFV ++ AG + ++ PF +  RP ++D +FY + + W   +  +  I L  S+ +L +Y  Y+   ++S  +Y R
Sbjct:  178 GAGIFVTTVVAGSVALVKPFTVASRPFLRDVIFYMAAVFWTFTVLYKGHISLGESVGYLGMYIAYVFTVILSSYIYNR 255          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Match: BX088721.1 (solute carrier family 24 member 6a [Source:NCBI gene;Acc:561209])

HSP 1 Score: 60.077 bits (144), Expect = 9.942e-9
Identity = 38/160 (23.75%), Postives = 87/160 (54.37%), Query Frame = 2
Query: 2267 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTA---LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILF 2737
            P ++ +F  +  + S LWI   +  +V ++++     +I  V++G++ LA   S  D ++++ +A+     +  S  +G  +F++L+G+G P+++RT        ++  S  L+++++L+ A   L +L + L  ++  R  G+ L+ +Y I+ +  I F
Sbjct:  357 PRWERWF-MVTFVASTLWIAVFSYLMVWMVTIISFTLDIPDVVMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNIFDILLGLGFPWALRTLVVDYGSTVSINSKGLVYSVILLLASVFLTVLSVHLNHWRLDRRLGLGLMFLYAIFLLCSICF 515          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Match: slc24a6a (solute carrier family 24 member 6a [Source:ZFIN;Acc:ZDB-GENE-100922-39])

HSP 1 Score: 59.3066 bits (142), Expect = 1.641e-8
Identity = 38/160 (23.75%), Postives = 87/160 (54.37%), Query Frame = 2
Query: 2267 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTA---LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILF 2737
            P ++ +F  +  + S LWI   +  +V ++++     +I  V++G++ LA   S  D ++++ +A+     +  S  +G  +F++L+G+G P+++RT        ++  S  L+++++L+ A   L +L + L  ++  R  G+ L+ +Y I+ +  I F
Sbjct:  478 PRWERWF-MVTFVASTLWIAVFSYLMVWMVTIISFTLDIPDVVMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNIFDILLGLGFPWALRTLVVDYGSTVSINSKGLVYSVILLLASVFLTVLSVHLNHWRLDRRLGLGLMFLYAIFLLCSICF 636          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Match: slc24a3 (solute carrier family 24 member 3 [Source:ZFIN;Acc:ZDB-GENE-090312-67])

HSP 1 Score: 56.6102 bits (135), Expect = 1.090e-7
Identity = 41/172 (23.84%), Postives = 89/172 (51.74%), Query Frame = 2
Query: 2243 FTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTA---LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDI 2749
            FT      P ++ ++  +  I+S +WI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++L+G+G+P++++T +      +   S  LIF++ L+ A   L +L + L  ++  +  G   + +Y ++    IL   +I
Sbjct:  428 FTVPNSANPRWERWY-MVSFISSTIWIAFFSYIMVWMVTVIGYTMGIPDVIMGITFLAAGTSVPDCLASLIVARQGMGDMAISNSIGSNVFDILIGLGLPWALQTLAINYGSTIHLNSKGLIFSVGLLLASVFLTVLGVHLNNWKLDKRLGFACLLMYAVFLCFSILIEFNI 598          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Match: CABZ01081780.1 (sodium/potassium/calcium exchanger 2-like [Source:NCBI gene;Acc:571043])

HSP 1 Score: 52.7582 bits (125), Expect = 4.076e-7
Identity = 39/166 (23.49%), Postives = 85/166 (51.20%), Query Frame = 2
Query: 2261 KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTF-SGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2752
            + P  + FF  +  + +I WI   +  +V      G    I+  I+GL++LA   S  DL+++V +A+     +  S+ VG  +F++ VG+  P+ + +  +G +PVQ++   +   I  + L+    ++ +   K++  +  G I+  +Y+++ V+ +L    +I
Sbjct:   43 RKPTSKKFFP-VTFLGAICWIAGFSYLMVWWAHQVGETIGITEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPFPWLLFSMVNGMVPVQVSSNGLFCAIVLLFLMLLFVIVSIAACKWRMSKLLGFIMFLLYIVFLVVSVLLEDKVI 207          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 157.918 bits (398), Expect = 5.994e-40
Identity = 94/311 (30.23%), Postives = 165/311 (53.05%), Query Frame = 2
Query: 1859 ENENENKFNIETGENGDSVVTF----PGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2764
            E+E++        E GD            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+   ++       +QL    +   +L   + +    +L+ +P   F  +R YG+ L  IY ++  + +L    II++ +
Sbjct:  262 ESEDDCVSTPHGSEYGDEYQPLLPLQRSTWQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVFLTVALLTEFGIIRLEM 572          

HSP 2 Score: 60.077 bits (144), Expect = 5.393e-15
Identity = 40/112 (35.71%), Postives = 57/112 (50.89%), Query Frame = 1
Query:   97 CQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGI--ATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGI 426
            C +      C    G+INY    +CSF     P  + L     L   I  A  A+ F  P L  +++ +R+S N+AGVT LA GNGA DVFS+++A + +     GLA G +
Sbjct:   55 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAFSDSR--TAGLAIGAL 164          

HSP 3 Score: 42.3578 bits (98), Expect = 5.393e-15
Identity = 32/78 (41.03%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+FV ++ AG I I+ PF    RP ++D +FY S +    FI  +  + L  +LV+L+LY +Y+ V VIS  +Y R
Sbjct:  166 GAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTWIYRR 243          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 157.918 bits (398), Expect = 7.157e-40
Identity = 94/311 (30.23%), Postives = 165/311 (53.05%), Query Frame = 2
Query: 1859 ENENENKFNIETGENGDSVVTF----PGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2764
            E+E++        E GD            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+   ++       +QL    +   +L   + +    +L+ +P   F  +R YG+ L  IY ++  + +L    II++ +
Sbjct:  265 ESEDDCVSTPHGSEYGDEYQPLLPLQRSTWQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVFLTVALLTEFGIIRLEM 575          

HSP 2 Score: 47.3654 bits (111), Expect = 5.388e-11
Identity = 37/112 (33.04%), Postives = 52/112 (46.43%), Query Frame = 1
Query:   97 CQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGI--ATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGI 426
            C +      C    G+INY    +CSF     P  + L     L   I  A  A+ F  P L  ++    ++  L GVT LA GNGA DVFS+++A + +     GLA G +
Sbjct:   58 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAFSDSR--TAGLAIGAL 167          

HSP 3 Score: 41.5874 bits (96), Expect = 5.388e-11
Identity = 32/78 (41.03%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+FV ++ AG I I+ PF    RP ++D +FY S +    FI  +  + L  +LV+L+LY +Y+ V VIS  +Y R
Sbjct:  169 GAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTWIYRR 246          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 156.762 bits (395), Expect = 1.830e-39
Identity = 94/312 (30.13%), Postives = 168/312 (53.85%), Query Frame = 2
Query: 1853 PPENENENK--FNIETGENGDSVVTFP-GPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2764
            P E+  E+   F   +G+    ++      W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+   ++       +QL    +   +L   + +    +L+ +P   F  +R YG+ L  IY ++  + +L    II++ +
Sbjct:  272 PGEDFKEHSLSFFFSSGDEYQPLLPLQRSTWQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVFLTVALLTEFGIIRLEM 583          

HSP 2 Score: 41.5874 bits (96), Expect = 4.495e-8
Identity = 32/78 (41.03%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+FV ++ AG I I+ PF    RP ++D +FY S +    FI  +  + L  +LV+L+LY +Y+ V VIS  +Y R
Sbjct:  181 GAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTWIYRR 258          

HSP 3 Score: 37.3502 bits (85), Expect = 4.495e-8
Identity = 34/110 (30.91%), Postives = 48/110 (43.64%), Query Frame = 1
Query:   97 CQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGI 426
            C +      C    G+INY    +CSF     P  + L     L   I  A     A     ++    ++  L GVT LA GNGA DVFS+++A + +     GLA G +
Sbjct:   75 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVT---AEKNQTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAFSDSR--TAGLAIGAL 179          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 155.992 bits (393), Expect = 2.533e-39
Identity = 89/282 (31.56%), Postives = 157/282 (55.67%), Query Frame = 2
Query: 1934 WKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2764
            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+   ++       +QL    +   +L   + +    +L+ +P   F  +R YG+ L  IY ++  + +L    II++ +
Sbjct:  278 WQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGLGCLLQMGPSRTSLQLEHQGLLVWILAGGLGISLVFSLISVPAQSFHLRRGYGVALFFIYAVFLTVALLTEFGIIRLEM 559          

HSP 2 Score: 44.669 bits (104), Expect = 4.970e-9
Identity = 23/72 (31.94%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSL----VFLILYAIYILV 647
            GAG+FV ++ AG I I+ PF    RP ++D +FY S +    FI  +  + L  +L     + + Y +Y  +
Sbjct:  181 GAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALGKYKAYFLAYLLYCFL 252          

HSP 3 Score: 37.3502 bits (85), Expect = 4.970e-9
Identity = 34/110 (30.91%), Postives = 48/110 (43.64%), Query Frame = 1
Query:   97 CQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGI 426
            C +      C    G+INY    +CSF     P  + L     L   I  A     A     ++    ++  L GVT LA GNGA DVFS+++A + +     GLA G +
Sbjct:   75 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVT---AEKNQTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAFSDSR--TAGLAIGAL 179          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 60.077 bits (144), Expect = 7.313e-15
Identity = 40/113 (35.40%), Postives = 57/113 (50.44%), Query Frame = 1
Query:   97 CQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGI--ATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL 429
            C +      C    G+INY    +CSF     P  + L     L   I  A  A+ F  P L  +++ +R+S N+AGVT LA GNGA DVFS+++A + +     GLA G + 
Sbjct:   54 CNFTRTTPDCSVGDGYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAFSDSR--TAGLAIGALF 164          

HSP 2 Score: 41.9726 bits (97), Expect = 7.313e-15
Identity = 24/61 (39.34%), Postives = 37/61 (60.66%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLIL 626
            GAG+FV ++ AG I I+ PF    RP ++D +FY S +    FI  +  + L  +LV+L+L
Sbjct:  165 GAGVFVTTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLL 225          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 151.369 bits (381), Expect = 4.459e-38
Identity = 94/272 (34.56%), Postives = 153/272 (56.25%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFS---IRTFSGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2758
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+      IR     + ++  G  + VL   + L    +L+ +PL  FQ  + YG+ L+  Y+ + V+V+L    +I +
Sbjct:  255 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVLLTEFGVIHL 526          

HSP 2 Score: 56.225 bits (134), Expect = 1.414e-7
Identity = 40/119 (33.61%), Postives = 61/119 (51.26%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP---TIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            N S+ C ++     C   +G+++Y +  +C F     P   T+ +       L    TAA  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P   GLA G +
Sbjct:   60 NTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAK-FFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGAL 174          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 151.369 bits (381), Expect = 7.773e-38
Identity = 94/272 (34.56%), Postives = 153/272 (56.25%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFS---IRTFSGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2758
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+      IR     + ++  G  + VL   + L    +L+ +PL  FQ  + YG+ L+  Y+ + V+V+L    +I +
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVLLTEFGVIHL 582          

HSP 2 Score: 55.4546 bits (132), Expect = 1.702e-15
Identity = 39/118 (33.05%), Postives = 61/118 (51.69%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXX--XXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            N S+ C ++     C   +G+++Y +  +C F     P  + L     L+L   +   A  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P   GLA G +
Sbjct:   60 NTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGAL 174          

HSP 3 Score: 47.7506 bits (112), Expect = 1.702e-15
Identity = 33/116 (28.45%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRXXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDS 791
            GAG+ V ++ AG I I+ PF    RP ++D  FY   +          +I L  +L +L LY  Y++  +I   +Y R           +  +    TP+L  E+ E Q   N +S
Sbjct:  176 GAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQR-------QRSRSLVHSISETPELLSESEEDQMSSNTNS 284          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 150.984 bits (380), Expect = 8.193e-38
Identity = 94/272 (34.56%), Postives = 153/272 (56.25%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFS---IRTFSGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2758
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+      IR     + ++  G  + VL   + L    +L+ +PL  FQ  + YG+ L+  Y+ + V+V+L    +I +
Sbjct:  294 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVLLTEFGVIHL 565          

HSP 2 Score: 47.3654 bits (111), Expect = 5.583e-10
Identity = 33/116 (28.45%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRXXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDS 791
            GAG+ V ++ AG I I+ PF    RP ++D  FY   +          +I L  +L +L LY  Y++  +I   +Y R           +  +    TP+L  E+ E Q   N +S
Sbjct:  159 GAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQR-------QRSRSLVHSISETPELLSESEEDQMSSNTNS 267          

HSP 3 Score: 37.3502 bits (85), Expect = 5.583e-10
Identity = 32/116 (27.59%), Postives = 48/116 (41.38%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            N S+ C ++     C   +G+++Y +  +C F     P              I       L   L++     +      GVT LA GNGA D+FS+L A    S+P   GLA G +
Sbjct:   60 NTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPL------------AITLYVFWLLYLFLILGVTAAKFPH---GVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGAL 157          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 98.2117 bits (243), Expect = 1.144e-20
Identity = 64/193 (33.16%), Postives = 102/193 (52.85%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGI 2533
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS G     +T        +G   C  GP  +LL G+
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGAGARRIT-------GVGAGQCP-GPQLDLLPGL 495          

HSP 2 Score: 55.4546 bits (132), Expect = 5.079e-16
Identity = 40/119 (33.61%), Postives = 61/119 (51.26%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP---TIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            N S+ C ++     C   +G+++Y +  +C F     P   T+ +       L    TAA  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P   GLA G +
Sbjct:   60 NTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAK-FFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGAL 174          

HSP 3 Score: 49.6766 bits (117), Expect = 5.079e-16
Identity = 33/116 (28.45%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRXXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDS 791
            GAG+ V ++ AG I I+ PF    RP ++D  FY   +          +I L  +L +L LY  Y++  +I   +Y R           +  +    TP+L  E+ E Q   N +S
Sbjct:  176 GAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQR-------QRSRSLVHSISETPELLSESEEDQMSSNTNS 284          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Match: Slc24a4 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 [Source:MGI Symbol;Acc:MGI:2447362])

HSP 1 Score: 64.3142 bits (155), Expect = 5.150e-10
Identity = 42/164 (25.61%), Postives = 89/164 (54.27%), Query Frame = 2
Query: 2267 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLV---TALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDI 2749
            P ++ FF  +  IT+ LWI   +  +V ++++ G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+GIP+ ++T        +   S  L+++++L+    AL +L + L K++  R  GI ++ +Y ++    I+   ++
Sbjct:  430 PRWEKFF-MVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTMVINYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGIYVLVLYAVFLCFSIMIEFNV 592          
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt
Match: sp|Q6AXS0|NCLX_RAT (Mitochondrial sodium/calcium exchanger protein OS=Rattus norvegicus OX=10116 GN=Slc8b1 PE=1 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.568e-38
Identity = 95/272 (34.93%), Postives = 153/272 (56.25%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFS---IRTFSGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2758
            P+D  +WR QS   K L + + P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F  +   +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+      +R+ +  + ++  G  + VL   + L    +L+ +PL  FQ  + YG+ L+  Y+ + V+V+L    +I +
Sbjct:  311 PLDYRKWRTQSISCKLLKVAKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNSEPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIVRSHASEVKLEPDGLLVWVLASALGLSLVFSLVSVPLQCFQLSKAYGLCLLLFYICFIVVVLLTEFGVIHL 582          

HSP 2 Score: 56.225 bits (134), Expect = 7.400e-15
Identity = 40/120 (33.33%), Postives = 62/120 (51.67%), Query Frame = 1
Query:   76 SSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXX--XXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            S N S+ C ++     C    G+++Y +  +C F     P  + L     L+L   +   A  F  P L  ++ ++++S N+AGVT LA GNGA D+FS+L A    S+P   GLA G +
Sbjct:   58 SLNTSDRCDFVKRNPDCHSEGGYLDYLKGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTSLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGAL 174          

HSP 3 Score: 47.7506 bits (112), Expect = 7.400e-15
Identity = 32/116 (27.59%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRXXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDS 791
            GAG+ V ++ AG I I+ PF    RP ++D  FY   +          +I L  +L +L LY  Y++  +I   +Y R           +  +    TP+L  ++ E Q   N +S
Sbjct:  176 GAGVLVTTVVAGGITILRPFMAASRPFLRDITFYMVAVFLTFTALYLGRITLVWALGYLGLYVFYVVTVIICTWVYQR-------QRSRSLVHSISETPELLTDSEEDQMSSNTNS 284          
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt
Match: sp|Q6J4K2|NCLX_HUMAN (Mitochondrial sodium/calcium exchanger protein OS=Homo sapiens OX=9606 GN=SLC8B1 PE=1 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 4.059e-38
Identity = 95/271 (35.06%), Postives = 148/271 (54.61%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2758
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y          +  + +I G  +  V  F +   +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+   ++       V+L    +   VL   + L    +L+ +PL  FQ  R YG  L+  Y+ + V+ +L    +I +
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGVYEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTEVKLEPDGLLVWVLAGALGLSLVFSLVSVPLQCFQLSRVYGFCLLLFYLNFLVVALLTEFGVIHL 581          

HSP 2 Score: 60.4622 bits (145), Expect = 2.541e-17
Identity = 42/119 (35.29%), Postives = 63/119 (52.94%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP---TIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            N S+ C +I     C  + G+++Y +  +C F     P   T+ +       L    TAA  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+  GLA G +
Sbjct:   60 NVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAK-FFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGAL 174          

HSP 3 Score: 51.9878 bits (123), Expect = 2.541e-17
Identity = 24/78 (30.77%), Postives = 41/78 (52.56%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+ V ++ AG I I+ PF    RP  +D +FY   +     +  R ++ L  +L +L LY  Y++  ++   +Y R
Sbjct:  176 GAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQR 253          
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt
Match: sp|P34322|NCX7_CAEEL (Putative sodium/calcium exchanger 7 OS=Caenorhabditis elegans OX=6239 GN=ncx-7 PE=3 SV=3)

HSP 1 Score: 152.91 bits (385), Expect = 4.715e-37
Identity = 89/258 (34.50%), Postives = 150/258 (58.14%), Query Frame = 2
Query: 1967 DLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVY-NTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGP-IPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2734
            + E+W E + FSK ++ I      +  LTIP+ + +     W K L  +H      F +     +  TPF  S  L VY   +   +  +++ FT    +P  Y+  +++ G I SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++ K  YPR+  +A +GGPLFNLL+G G+PF+I    G  I + +  T  +LI  + +     L+ +P+ KF+ +R +  +LI+IY+ + V VIL
Sbjct:  411 EAEDWEEMNIFSKVMAYINVVPNLLFKLTIPLNEMS-----WSKPLTLLHAFTCPAFLLFSIQFFLETPFSGSPGLWVYGLAVSIVLAILIMVFTELSVQPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQGKYISMTINPTYRLLILFLAISLLATLIGIPVQKFRLQRPHAAVLISIYIAFIVFVIL 663          

HSP 2 Score: 61.2326 bits (147), Expect = 1.780e-16
Identity = 37/115 (32.17%), Postives = 65/115 (56.52%), Query Frame = 1
Query:   88 SNICQYITFFSSCIPNSGFINYFQWQYC--SFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGI 426
              +C Y+    +     G++ + Q+  C  S  +R    I+ +++ L L   +++AAD F +P +  +   +R+SE++AGVT +A GNGA DVF S+++V S+  P   LA G +
Sbjct:   53 EQVCDYVNCNDNACEGGGYLLWTQYVECASSTFSRVILIIVGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGEL 167          

HSP 3 Score: 48.1358 bits (113), Expect = 1.780e-16
Identity = 26/73 (35.62%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFI-RRQIELWSSLVFLILYAIYILVTVIS 659
            G G+FV ++    I++ +PF +     I+D LFY   L +  F F+   ++ LW  L FL LY +Y+ +TVI 
Sbjct:  169 GGGLFVTTMVVSTIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLWMPLTFLGLYLLYV-ITVIG 240          
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt
Match: sp|Q925Q3|NCLX_MOUSE (Mitochondrial sodium/calcium exchanger protein OS=Mus musculus OX=10090 GN=Slc8b1 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 5.437e-37
Identity = 94/272 (34.56%), Postives = 153/272 (56.25%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFS---IRTFSGPIPVQLTGTSI-VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKV 2758
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+      IR     + ++  G  + VL   + L    +L+ +PL  FQ  + YG+ L+  Y+ + V+V+L    +I +
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQIIRNHVVEVKLEPDGLLVWVLASALGLSLIFSLVSVPLQCFQLSKAYGLCLLLFYICFLVVVLLTEFGVIHL 582          

HSP 2 Score: 55.4546 bits (132), Expect = 1.043e-14
Identity = 39/118 (33.05%), Postives = 61/118 (51.69%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXX--XXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            N S+ C ++     C   +G+++Y +  +C F     P  + L     L+L   +   A  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P   GLA G +
Sbjct:   60 NTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGAL 174          

HSP 3 Score: 47.7506 bits (112), Expect = 1.043e-14
Identity = 33/116 (28.45%), Postives = 52/116 (44.83%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRXXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDS 791
            GAG+ V ++ AG I I+ PF    RP ++D  FY   +          +I L  +L +L LY  Y++  +I   +Y R           +  +    TP+L  E+ E Q   N +S
Sbjct:  176 GAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQR-------QRSRSLVHSISETPELLSESEEDQMSSNTNS 284          
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt
Match: sp|P34315|NCX6_CAEEL (Putative sodium/calcium exchanger 6 OS=Caenorhabditis elegans OX=6239 GN=ncx-6 PE=3 SV=3)

HSP 1 Score: 145.591 bits (366), Expect = 5.061e-35
Identity = 96/309 (31.07%), Postives = 169/309 (54.69%), Query Frame = 2
Query: 1835 KGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPV-DLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN-TPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGP-IPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDII 2752
             G+H +      + +  IE  E   +  +F G    F   + P   ++EW E + F K ++++ +   F+  LTIP  ++      W K +  + CL+  VF +    V + +PF  S  L +Y  I+   +   V+ FT    +PP Y+   ++ G + SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++AK  YPR+  +A +GG LFNLL+G G+PF+I    G  I + +  T  +L+  + +     L+ +   K+  +R +   L+ IY+ +FV + L   DI+
Sbjct:  285 HGHHVLHAHEVMKMEAEIEAVEPLKTW-SFRGVVHDFKEHLKPWPSMDEWDEMNIFQKVIAVLNTIPNFLFKLTIPHSEQP-----WSKPITLLQCLICPVFLLFCIQVCSISPFPNSPGLWMYGLILSVLLTAAVLFFTELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTIAKIQGKSISMIINPTYRLLMLFLAISLIFTLIAMFAQKYFLRRIHSYSLVFIYISFFVFIGLSLDDIL 587          

HSP 2 Score: 59.6918 bits (143), Expect = 3.466e-16
Identity = 35/117 (29.91%), Postives = 65/117 (55.56%), Query Frame = 1
Query:   82 NYSNICQYITFFSSCIPNSGFINYFQWQYCSFDN--RWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGI 426
            N + +C+Y+          G++ + ++  C+     R    I  +++ L L   +++AAD F +P +  +   +R+SE++AGVT +A GNGA DVF ++++V S+  P   LA G +
Sbjct:   60 NSTQVCEYVKCNDDNCEGGGYVLWTRYVECASSPAVRIILIITGVIYMLVLFIMVSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSSPTPKADLALGEL 176          

HSP 3 Score: 48.9062 bits (115), Expect = 3.466e-16
Identity = 25/79 (31.65%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRR-QIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+FV ++   + +   PFK      I+D  FY   L +  F F+    +E+W  + FL +Y IY+   ++S++L+ R
Sbjct:  178 GAGLFVTTMVLAVTIFTRPFKAEVFSSIRDIAFYLVALAFLAFCFVYYDHVEIWMPITFLGVYLIYVCTVILSQILHNR 256          
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20311487 (tr|A0A0H3YKA1|A0A0H3YKA1_SCHMD Slc24a-2 OS=Schmidtea mediterranea OX=79327 GN=slc24a-2 PE=2 SV=1)

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 402/446 (90.13%), Postives = 414/446 (92.83%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRXXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANKNITVNNIEITVTAPNDEDDQKNDLDIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENDLNELKSDSSSISDFNCINVERSNTGVSLGGSLRNDYSYDNPNYVHDNHKDHFSRASTTLSSFKSNFSSINENPKFIKECFEDKLDHLNVPQINYQGKSRLVTTQHSCPHESECNAKKRVYDYSNSYQFERSYNXX--XXXXXXXXXXXXHQKHSYSIKRKHHSARNFMTRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHFRSISLTIINESPPKTKIRFWSMSENEKSKSGLT 1775
            GAGIFVNSITAGIIMIITPFKLMKRP+IKDFLFYFS LIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR+IKSK TTI+TNNSNITIRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKAN+NITVNNIEITVTA NDEDDQKNDL+IAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQEN LNELKS SSSISDFNCIN+ERSNT VS GGSLRNDYSYDNPNYVH+NHKDHFSRASTTLSSFKSNFSSIN+ P FIKEC+EDKLDHLNVPQ NYQGKSRLVT+QHSCPHESECNAKKRVYDY NSYQFERSYNS               HQKHSYSIKRKHHSARN MTRSSSHRSIGSLAQIIIDKEHEKER+EKHP SKKI HFRSISLTIINESP KTKIRF SMSENEKSKS +T
Sbjct:  129 GAGIFVNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHIKSKATTIKTNNSNITIRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANQNITVNNIEITVTASNDEDDQKNDLNIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENYLNELKSISSSISDFNCINIERSNTRVSFGGSLRNDYSYDNPNYVHENHKDHFSRASTTLSSFKSNFSSINDKPNFIKECYEDKLDHLNVPQTNYQGKSRLVTSQHSCPHESECNAKKRVYDYLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDIT 574          

HSP 2 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 316/320 (98.75%), Postives = 318/320 (99.38%), Query Frame = 2
Query: 1805 SDITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2764
            SDITNEWGIIKGNHKIPPENENENKFN+ETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVT LNLLCLPLMKFQPKRFYGIILI IY+IYFVLVILFAVDIIKVTL
Sbjct:  571 SDITNEWGIIKGNHKIPPENENENKFNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTTLNLLCLPLMKFQPKRFYGIILIIIYIIYFVLVILFAVDIIKVTL 890          

HSP 3 Score: 235.728 bits (600), Expect = 2.537e-61
Identity = 125/128 (97.66%), Postives = 125/128 (97.66%), Query Frame = 1
Query:   46 MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL 429
            MDLCTPLNFSSSNYSNICQYITFFSSCIPN GFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAAD FLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS SNPNVGLAFGGIL
Sbjct:    1 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNVGLAFGGIL 128          
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20323549 (tr|A0A0H3YFD7|A0A0H3YFD7_SCHMD Slc24a-7 OS=Schmidtea mediterranea OX=79327 GN=slc24a-7 PE=2 SV=1)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 314/320 (98.12%), Postives = 318/320 (99.38%), Query Frame = 2
Query: 1805 SDITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2764
            SDITNEW I++GN+K+ PENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL
Sbjct:  532 SDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 851          

HSP 2 Score: 369.777 bits (948), Expect = 0.000e+0
Identity = 221/464 (47.63%), Postives = 283/464 (60.99%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRXXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANKNIT-VNNIEITVTAP-----NDEDDQKNDLDIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENDLNELKSDSSSISDFNCINVERSNTGVS-----------LGGSLR--NDYSYDNPNYVHDNHKDHFSRASTTLSSFKSNFSSINENPKFIKECFEDKLDHLNVPQINYQGKSRLVTTQHSCPHESECNAKKRVY-DYSNSYQFERSYNXXXXXXXXXXXXXXHQKHSYSIKRKHHSARNFMTRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHFRSISLTIINESPPKTKIRFWSMSENEKSKSGLT 1775
            GAG+FVN+ITAGIIMI++PFK+MKRP++KD LFYF  LIWCM IFI++QIELWSSLVFL +Y IYILVTVISRLLYVR                                                    K+NK I   NNI IT+T P     N E  Q+N     +    SI DFI I +D +SK N N   N+I IT+  P D + QENDLN     SS+ISDF  I++ RS+T  +           + GSLR  N YSYDNPNY+ DN  D    AST  S+F++NF SIN+NP  +KE + DK DHLNVP   YQ K  L+ +Q+SCP++SEC++ KR+   Y N  Q ER YN++ S   S   +  H K+S SIK+K+ S R+ + RS+SHRSI S+A+IIID EHEKER+E HP +KK N  +S+SLT++NE   K+ IR+WSM E +K+KS +T
Sbjct:  129 GAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVR--------------------------------------------------NEKSNKTIIQTNNISITITTPATNVENAEIQQQN-----IEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVN--HLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDIT 535          

HSP 3 Score: 196.052 bits (497), Expect = 0.000e+0
Identity = 107/128 (83.59%), Postives = 110/128 (85.94%), Query Frame = 1
Query:   46 MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL 429
            M  CTPL FSS NYSN C YIT F  C PNSG INY+QWQYC+F NRWAP ILM LWFLFLLTGI T+AD FLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS SNPNVGLAFG IL
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAIL 128          
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20318920 (tr|A0A0H3YF40|A0A0H3YF40_SCHMD Slc24a-5 OS=Schmidtea mediterranea OX=79327 GN=slc24a-5 PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 8.465e-94
Identity = 170/319 (53.29%), Postives = 227/319 (71.16%), Query Frame = 2
Query: 1811 ITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS-GPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2764
            I+ E  I K +        +E+  ++ET +     V FPG +KHF + I+P++ EEW+EQS FSK LS+IQSP MFILTLTIP+V+E  YLKGWCK+LNC+HC+LS + W+        P G+  F+L++L +I+G    +  A TSK + PP Y   FAF+G +TSI WIY IANEIVNIL  FGVV +I   ILGL++LAFANS GDLVSN+ LA+  +PRI Y+AC+GGPLFNLLVGIG+PFSI     G I V+L   +IVLI TI+L+T +NL+ LP+M+F+ +  YGII+I IYV++ + V+LFA ++IKVTL
Sbjct:  372 ISEENQIEKSSVDSTLHTSSESDIDVETKD-----VQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKVTL 685          

HSP 2 Score: 144.821 bits (364), Expect = 9.592e-62
Identity = 83/128 (64.84%), Postives = 94/128 (73.44%), Query Frame = 1
Query:   46 MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL 429
            M+ C P N + +   + C Y+    SC  +SGFINYFQWQ+C FDNR  PTILM LWFL LL  +A  AD F APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSAV S S+PNV LA G IL
Sbjct:    1 MESCNPKNKTFN--ESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSIL 126          

HSP 3 Score: 124.79 bits (312), Expect = 9.592e-62
Identity = 53/78 (67.95%), Postives = 66/78 (84.62%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAGI VN++TAGIIMII PF +M+RP+IKD +FY   L+WCMFI IRRQIELWSS+VFLI+Y IY+ VT +SR +YV+
Sbjct:  127 GAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVK 204          
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Match: gnl|BL_ORD_ID|21120992 (tr|A0A2T7PD60|A0A2T7PD60_POMCA Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06777 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.120e-54
Identity = 128/310 (41.29%), Postives = 183/310 (59.03%), Query Frame = 2
Query: 1850 IPPENENENK-FNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIV-----DETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS--GPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIK 2755
            + PE + ENK   IE             P K F +++ P++ EEW +   F+K   I +SP + +L LT+P+V     DE     GW + LN IHCL   VF +   NV     G   F L  L +I+G ++   V FTS  D+ P Y   FA++G + +++WIY +ANEIVNIL  FG+V NIS+ I+GL++LA+ NS GD V+++TLA+  YPR+G SAC GGPLFNLL+GIGIPF+I   +  G   +Q+T   + L   + +    +L+ +PL  F   R YGI LI +YV++ VL +L   D+IK
Sbjct:  241 LRPETDEENKAIEIELIMRRPKHHEPQQPLKMFLMSVNPINTEEWSKMRIFAKAYEIFKSPLLLVLKLTVPVVVYADDDEN---HGWNRYLNTIHCLTGPVFTIFAVNVGFKTIG-GVFPLYGLVLIIGAVLATAVFFTSTNDQKPRYHDLFAYLGFVVAVVWIYSMANEIVNILQTFGIVLNISNSIIGLTLLAWGNSIGDFVADLTLARQGYPRMGISACFGGPLFNLLLGIGIPFTIACINKGGVFKLQVTLEELFLAGGVAVSLVSSLIIVPLSGFHMSRGYGIYLIILYVVFLVLAVLIETDVIK 546          

HSP 2 Score: 87.0409 bits (214), Expect = 4.947e-23
Identity = 49/121 (40.50%), Postives = 76/121 (62.81%), Query Frame = 1
Query:   70 FSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWA--PTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGI 426
            F   N +++C +++  S C  + GFINY  + YC   +       I++  W+LFL  G+A  AD F  P LVV++KT+R+S N+AGVT LA GNG+ D+FS+++A+ +A   + GLA G +
Sbjct:   11 FHFENITDLCTFVSSTSDCQTDDGFINYTNFVYCCLSSHLVVLSVIILFFWWLFLFCGLAVTADDFFCPSLVVISKTLRLSHNIAGVTFLAFGNGSPDIFSAIAAIGNAKAGDAGLAIGAL 131          

HSP 3 Score: 52.7582 bits (125), Expect = 4.947e-23
Identity = 27/76 (35.53%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLY 671
            GAG+FV ++  G I  + PF  M+RP ++D +FY   + W  +I  +++I    ++ F++LY +Y++V V+ RL Y
Sbjct:  133 GAGVFVTTVIVGTISTVCPFDAMQRPFLRDVIFYLGAVFWAFYIMWKKEIHTLEAVGFILLYVVYVIVVVVGRLFY 208          
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18330827 (tr|A0A1I8IHV2|A0A1I8IHV2_9PLAT Na_Ca_ex domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 5.722e-53
Identity = 126/289 (43.60%), Postives = 189/289 (65.40%), Query Frame = 2
Query: 1889 ETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN--TPF-GTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANS-TGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS-GPIPVQLTGTSIVLIFTIMLVTAL--NLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2734
            + GE+ D V     P K F  +++PVDLEE+ E + ++K   II++P +F+L L+ P VD    L GW +ILN +HC ++ VF  L    YN   PF G   F +V + +I+G  +G++V FTS   +PP Y   FAFIG +T+I+WIY  ANE+VNIL   G +F ISS ILGL+VLA+ANS  GD+++N  LA+ N+PR+  SAC GGPLFNLL+G+GIPF+I+  S G   +++  + + L+  + +  +L  +++ L +M+F+  R YGIILI +Y+ + V+ +L
Sbjct:   60 DAGED-DEVDENQSPIKEFFYSLVPVDLEEFPEMTWYNKVYEIIKAPLLFLLLLSTPFVDYDQPLNGWSRILNSVHCAIAPVFIALAFKGYNWMIPFEGGGGFPIVVIVLIVGIALGILVYFTSSDFEPPKYHAAFAFIGFLTAIVWIYTFANEVVNILESVGSIFRISSTILGLTVLAWANSIGGDVIANTVLARQNFPRVAISACFGGPLFNLLLGVGIPFTIKLLSDGTTEMRIEASVVQLLLVVSVTASLIVSMVYLTVMRFKLGRVYGIILIVLYLAFLVVALL 347          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:103022341])

HSP 1 Score: 134.42 bits (337), Expect = 2.725e-32
Identity = 94/272 (34.56%), Postives = 149/272 (54.78%), Query Frame = 2
Query: 1937 KHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPI----PVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVIL 2734
            K F  +I PVD   WR      + L IIQ PF  +L LT+P+VD       W + LNC+H +   +  VL      Y       +F +  L  ++G  +  +V  T+  ++PP Y   F+ +G + S LWI  +A+EIV++L + G+V ++S+ +LGL++LA+ NS GD  S++T+A+  YPR+  SAC GG +FN+L G+G+   ++ F   +    P  L G   VL   + L   L+ + +PL +F   R YGI L+  Y  + V+ +L
Sbjct:  313 KIFLKSISPVDTRIWRRSHWAWRALKIIQLPFEVVLLLTVPVVDTDKEDHNWKRPLNCLHIITGPLVCVLTFQSGHYGLYLIQGDFPVWLLTALIGVFLSGIVFCTTNNERPPPYHFLFSLLGFVVSALWISTVASEIVSVLHLLGIVLSLSNTVLGLTLLAWGNSIGDCFSDITIARQGYPRMAISACFGGIIFNMLFGVGLGCLLQMFHNGVVMLEPEGLLG--WVLSGALGLSLVLSFVLVPLQRFHLNRAYGIFLLIFYAAFLVVALL 582          

HSP 2 Score: 63.929 bits (154), Expect = 4.853e-20
Identity = 28/78 (35.90%), Postives = 48/78 (61.54%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAGIFV ++ AG + ++ PF +  RP ++D +FY + + W   I  +  I+L  +L +L LY +Y++  V+S  +Y R
Sbjct:  185 GAGIFVTTVVAGSVTLVKPFTVASRPFLRDIIFYMAAVFWTFTILYKGWIDLKEALGYLGLYVLYVITVVVSTYIYRR 262          

HSP 3 Score: 54.6842 bits (130), Expect = 4.853e-20
Identity = 42/124 (33.87%), Postives = 64/124 (51.61%), Query Frame = 1
Query:   64 LNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATA--ADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            +N S+++    C+++     C    GFINY +  +C       P  + L     L+  +     A  F  P L  ++ T+R++ N+AGVT LALGNGA DVFS+++A    S P   GLA G +
Sbjct:   66 MNLSAADR---CEFVLNTPDCAAEGGFINYPKITFCLLAPNLLPLAIFLYIVWLLVMFLVLGLIASQFFCPNLSAISSTLRLTHNVAGVTFLALGNGAPDVFSAMAAF---SRPQTAGLAIGAL 183          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Match: slc24a3 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:103023188])

HSP 1 Score: 61.6178 bits (148), Expect = 2.958e-9
Identity = 41/165 (24.85%), Postives = 90/165 (54.55%), Query Frame = 2
Query: 2267 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS---GPIPVQLTGTSIVLIFTIMLVTA-LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDI 2749
            P ++ +F F   I+S LWI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T +   G + + L    +++   ++L +  L +L + L K+   +  GI+ + +Y ++    IL   ++
Sbjct:  462 PRWERWFMFT-FISSTLWIAGFSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGLPWALQTLAIDYGSV-IHLNSRGLIISVGLLLASVFLTVLGVHLNKWTLDKRLGILCLLMYAVFLCFSILIEFNV 624          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Match: slc24a3 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:103023188])

HSP 1 Score: 61.2326 bits (147), Expect = 3.867e-9
Identity = 41/167 (24.55%), Postives = 90/167 (53.89%), Query Frame = 2
Query: 2261 KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS---GPIPVQLTGTSIVLIFTIMLVTA-LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDI 2749
              P ++ +F F   I+S LWI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T +   G + + L    +++   ++L +  L +L + L K+   +  GI+ + +Y ++    IL   ++
Sbjct:  422 NSPRWERWFMFT-FISSTLWIAGFSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGLPWALQTLAIDYGSV-IHLNSRGLIISVGLLLASVFLTVLGVHLNKWTLDKRLGILCLLMYAVFLCFSILIEFNV 586          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Match: slc24a6a (solute carrier family 24 member 6a [Source:ZFIN;Acc:ZDB-GENE-100922-39])

HSP 1 Score: 59.3066 bits (142), Expect = 1.488e-8
Identity = 39/160 (24.38%), Postives = 87/160 (54.37%), Query Frame = 2
Query: 2267 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTA---LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILF 2737
            P ++ +F  +  + S LWI   +  +V ++++     +I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++L+G+G P+++RT +      +   S  L+++++L+ A   L +L + L  ++  R  G+ L+ +Y I+ +  I F
Sbjct:  379 PRWERWF-MVTFVASTLWIAVFSYLMVWMVTIISYTLDIPDVIMGITFLAAGTSVPDCMASLLVARQGMGDMAVSNSIGSNIFDILLGLGFPWALRTLAVDYGSTVFINSRGLVYSVILLLASVFLTVLSVHLNHWRLDRRLGLGLMVLYSIFLLCSICF 537          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Match: slc24a4a (solute carrier family 24 member 4a [Source:ZFIN;Acc:ZDB-GENE-050417-291])

HSP 1 Score: 55.0694 bits (131), Expect = 2.571e-7
Identity = 39/165 (23.64%), Postives = 87/165 (52.73%), Query Frame = 2
Query: 2264 PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLV---TALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDI 2749
             P ++ FF  +    S LWI   +  +V ++++ G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P+ I+T +      +   S  L+++++L+    AL +L + + K++     G+ ++ +Y ++    IL   ++
Sbjct:  338 KPRWERFF-MLSFFLSTLWIAVFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGIQTMAVNYGSVVVINSRGLVYSVVLLLGSVALTVLGIHVNKWKLDFKLGMYVLILYGVFLCFSILIEYNV 501          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Sea Lamprey
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 138.658 bits (348), Expect = 8.486e-36
Identity = 99/310 (31.94%), Postives = 167/310 (53.87%), Query Frame = 2
Query: 1859 ENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCL---LSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI--------VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIK 2755
            +N N++ ++ E      S+    G    F L++ P+D  EWR +    + L ++  P   +L LT+P+++     + W + LNC+  +   L+ ++ +     +  P G +  L ++  I+    +  VVAF +  ++PP +Q  FA +G + S LW+  IANE+VN+L  FGVVF ISS +LGL++LA+ NS  D V+++T+A+  YPR+  SAC GG +FN+LVGIG+       S P P  +    +        VL  ++ +   L+ + LPL  F   R YG+ L  +Y+ +  + +L    II+
Sbjct:   62 KNTNDDDYD-EPRRRVASIQQ--GKLYRFLLSLSPLDPAEWRRRGYIWRLLKVVVLPVELLLILTVPVMNVMHEDRKWNRPLNCLQLMTGPLAALYSLNGGLYFMLPVGGT--LPLWSLILAIGCLLAVVAFITTSEQPPAFQLAFAVLGFVVSALWMNAIANEVVNLLQTFGVVFGISSTVLGLTLLAWGNSVPDFVADITMARQGYPRMAISACFGGIVFNILVGIGLGC---LLSMP-PSHMQQAQLVPDVPLVWVLCASLGISLVLSFVALPLQGFYLTRKYGVCLFALYLAFLTVALLTEFKIIR 362          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Sea Lamprey
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 54.299 bits (129), Expect = 9.436e-8
Identity = 35/152 (23.03%), Postives = 81/152 (53.29%), Query Frame = 2
Query: 2303 ITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTA---LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDI 2749
            + S +WI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T        +   S  LI++++L+ A   + +L + L  ++  R  G+  + +Y ++    I+   ++
Sbjct:  384 VISTIWIAVFSYVMVWMVTVIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWALQTLLVDYGSHVEINSRGLIYSVVLLLASVGITVLGIYLNNWKLDRKLGLACLFVYAVFLCFSIMIEFNV 535          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Yeast
Match: YDL206W_mRNA (Putative protein of unknown function; YDL206W is not an essential protein [Source:SGD;Acc:S000002365])

HSP 1 Score: 54.6842 bits (130), Expect = 5.933e-8
Identity = 28/55 (50.91%), Postives = 33/55 (60.00%), Query Frame = 2
Query: 2372 VFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIG 2536
            VFNIS  ILGL++  + NS GDLVSN+T  K     I   AC G PL   L G+G
Sbjct:  620 VFNISETILGLTIFTWGNSIGDLVSNITFVKIGVLEIAIGACFGSPLLYFLFGVG 674          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Yeast
Match: ECM27 (Protein involved in calcium homeostasis and exit from quiescence; required for proper trehalose levels during quiescence; may play a role in cell wall biosynthesis, mutants are hypersensitive to antifungal, Papulacandin B; null mutants have increased plasmid loss; interacts with Pdr5p [Source:SGD;Acc:S000003867])

HSP 1 Score: 49.6766 bits (117), Expect = 2.243e-6
Identity = 23/84 (27.38%), Postives = 46/84 (54.76%), Query Frame = 2
Query: 2330 IANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAK---------------NNYPRIGYSACVGGPLFNLLVGIG 2536
            +AN ++ ++ ++  +  +S  ILGL++ A+ NS GDL+SN+++ +                 +  I  ++C+GG + N + GIG
Sbjct:  545 LANSLIEMMEIYQKILGLSKAILGLTIFAWGNSVGDLISNISMCRLYKTQTHYQDRVRLATKFFMISCASCLGGVMLNSMGGIG 628          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Nematostella
Match: EDO31950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWG6])

HSP 1 Score: 113.235 bits (282), Expect = 1.699e-26
Identity = 68/223 (30.49%), Postives = 113/223 (50.67%), Query Frame = 2
Query: 1880 FNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGT------SNFLLVYXX-XXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLV 2527
            F++ T    +     P P +     +LP    ++     F+K   I+++P   +L +TIP++D     + W K LN +H +   +F VL         G        +++++Y               F S++ K    Q  F ++  I S++WIY  ANEIVNIL  FG+V  +S+ ILGL+ LA+ NS GDLV++ T+A+  +P +   AC GGP+ ++L+
Sbjct:  212 FSLNTHRACNRSANLP-PMQKLVRGVLPFTSADFELSGIFNKVFLILKAPAAVVLNVTIPVIDYDEPYQNWNKWLNVLHLITGPMFCVLATRAAKVSLGRLYKPPRCHWVVLYKPPRCHWVGFTSRQGFCSQIHKNCFLQ-MFGYLAFIVSVVWIYVTANEIVNILQSFGIVLGLSNAILGLTFLAWGNSIGDLVADTTMARQGFPNMATGACFGGPMLSILL 432          

HSP 2 Score: 70.0922 bits (170), Expect = 9.124e-17
Identity = 43/112 (38.39%), Postives = 65/112 (58.04%), Query Frame = 1
Query:   97 CQYITFFSSCIPNSGFINYFQWQYCSFDNRWA-PTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSAS-NPNVGLAFGGI 426
            C ++   S C  + GFI Y  + YC          +++ +  LFL   +   AD +  P L V++KT+R+S+N+AGVT LA GNGA D+FS+++AV++ S NPN      GI
Sbjct:    1 CAFVQANSDCDLSDGFIQYIHFIYCKLPKAIPLALVILFVLMLFLFIVLGITADDYFCPSLTVISKTLRLSQNVAGVTFLAYGNGAPDIFSAIAAVSAHSKNPNAAQLGAGI 112          

HSP 3 Score: 35.8094 bits (81), Expect = 9.124e-17
Identity = 25/74 (33.78%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITP-FKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISR 662
            GAGIFV ++  G + + T  F L  RP  +D LFY   + W      R++I +  ++ F+I Y  Y++V ++ R
Sbjct:  109 GAGIFVTTVVVGSVTLCTGGFHLNNRPFTRDVLFYLGAVSWMFITMYRQRITMLEAIGFIIFYFAYVVVVIVGR 182          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Nematostella
Match: EDO35212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM57])

HSP 1 Score: 51.2174 bits (121), Expect = 1.741e-6
Identity = 23/82 (28.05%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 2309 SILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIR 2554
            SI+WI  ++  +V ++   G + N+    +GL ++A   S  D +S++ +A++ +  +  S  +G  +F++ +G+G+PF IR
Sbjct:  364 SIVWIAILSFGLVTVVGRSGCILNVDKFTMGLVIIAIGTSVPDALSSIIVARDGFGDMAVSNAIGSNVFDINLGLGLPFVIR 445          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Nematostella
Match: EDO32048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW69])

HSP 1 Score: 50.447 bits (119), Expect = 2.359e-6
Identity = 42/159 (26.42%), Postives = 80/159 (50.31%), Query Frame = 2
Query: 2252 KVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRT----FSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIY 2716
             V KP   +  +  +  I  I+WI   +  +V +++V G  F I   ++GLS++AF +S  D +S++ +A+     +  S  VG  +F++L+ +GIP+ I+T    +   + +   G  I   F I+   A+ L+ +   K+   +  G I +  Y I+
Sbjct:  311 DVKKPSCEK--WVVLSFIICIVWIGVTSYVLVWMVTVIGYTFLIPDSVMGLSLVAFGSSVPDCLSSLFVARKGDGDMAVSHTVGSNVFDILLCLGIPWLIKTTVWEYDSSVVINSHGLFISCFF-ILGSIAVTLIIIWYYKWTLNKKVGCIYLVFYFIF 466          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:101159512])

HSP 1 Score: 131.339 bits (329), Expect = 9.884e-32
Identity = 88/262 (33.59%), Postives = 149/262 (56.87%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVI 2731
            PVD  +WR +S   + L ++++P   +L L +P+VD     K W + LNC+H +++ V  VL      Y        F L  L ++LGF +  +V  T+  D PP Y   FA +G + S + I   A+E+V++L + GVV ++S+ +LGL++LA+ NS GD  S++T+A+  YPR+  SAC GG +FN+++G+G+   ++       VQ     +   +L  ++ L   L+ + +PL +F   R YGI L+  YVI+ ++ +
Sbjct:  231 PVDSRKWRRKSWRWRVLKVLKTPLEVLLLLCVPVVDPDKEDKNWRRPLNCLHLVIAPVVCVLAFQSGKYGNYMIQEQFPLWVLILLLGFFLAAIVFCTTTNDHPPKYHAVFALLGFVVSAVLISAAASEVVSLLHMLGVVLSLSNTVLGLTLLAWGNSIGDCFSDITIAQQGYPRMAISACFGGIIFNMVIGVGLGCLVQMVKTNSDVQFESEGLLTWILAGSLGLSLVLSFIIVPLSQFHLGRTYGIFLLAFYVIFLIIAL 492          

HSP 2 Score: 60.8474 bits (146), Expect = 8.821e-19
Identity = 27/78 (34.62%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+FV ++ AG + +  PF +  RP ++D +FY   + W   +  R    L  +L +L LY +Y+L  +IS  +Y R
Sbjct:  120 GAGVFVTTVVAGSVSLFKPFAVASRPFLRDVIFYMVAVFWTFLMLYRGTTTLGETLGYLSLYVLYVLTVIISTYIYKR 197          

HSP 3 Score: 53.5286 bits (127), Expect = 8.821e-19
Identity = 41/113 (36.28%), Postives = 60/113 (53.10%), Query Frame = 1
Query:   97 CQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP-TIXXXXXXXXXXTGI-ATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            C ++     C    GFINY    +C       P TI +   +LF L  I    A  F  P L  ++ ++ ++ N+AGVT LALGNGA D+FS+++A    S+P+  GLA G +
Sbjct:    9 CTFVKNTPDCDMEDGFINYLNVVFCLLPPNLTPFTITLCCMWLFFLFMILGLTASKFFCPNLSAISSSLHLTHNVAGVTFLALGNGAPDIFSAMAAF---SHPHTAGLAVGAL 118          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:101159512])

HSP 1 Score: 131.339 bits (329), Expect = 1.551e-31
Identity = 88/262 (33.59%), Postives = 149/262 (56.87%), Query Frame = 2
Query: 1961 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSI---VLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVI 2731
            PVD  +WR +S   + L ++++P   +L L +P+VD     K W + LNC+H +++ V  VL      Y        F L  L ++LGF +  +V  T+  D PP Y   FA +G + S + I   A+E+V++L + GVV ++S+ +LGL++LA+ NS GD  S++T+A+  YPR+  SAC GG +FN+++G+G+   ++       VQ     +   +L  ++ L   L+ + +PL +F   R YGI L+  YVI+ ++ +
Sbjct:  261 PVDSRKWRRKSWRWRVLKVLKTPLEVLLLLCVPVVDPDKEDKNWRRPLNCLHLVIAPVVCVLAFQSGKYGNYMIQEQFPLWVLILLLGFFLAAIVFCTTTNDHPPKYHAVFALLGFVVSAVLISAAASEVVSLLHMLGVVLSLSNTVLGLTLLAWGNSIGDCFSDITIAQQGYPRMAISACFGGIIFNMVIGVGLGCLVQMVKTNSDVQFESEGLLTWILAGSLGLSLVLSFIIVPLSQFHLGRTYGIFLLAFYVIFLIIAL 522          

HSP 2 Score: 61.2326 bits (147), Expect = 6.091e-19
Identity = 27/78 (34.62%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAG+FV ++ AG + +  PF +  RP ++D +FY   + W   +  R    L  +L +L LY +Y+L  +IS  +Y R
Sbjct:  120 GAGVFVTTVVAGSVSLFKPFAVASRPFLRDVIFYMVAVFWTFLMLYRGTTTLGETLGYLSLYVLYVLTVIISTYIYKR 197          

HSP 3 Score: 53.5286 bits (127), Expect = 6.091e-19
Identity = 41/113 (36.28%), Postives = 60/113 (53.10%), Query Frame = 1
Query:   97 CQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP-TIXXXXXXXXXXTGI-ATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNV-GLAFGGI 426
            C ++     C    GFINY    +C       P TI +   +LF L  I    A  F  P L  ++ ++ ++ N+AGVT LALGNGA D+FS+++A    S+P+  GLA G +
Sbjct:    9 CTFVKNTPDCDMEDGFINYLNVVFCLLPPNLTPFTITLCCMWLFFLFMILGLTASKFFCPNLSAISSSLHLTHNVAGVTFLALGNGAPDIFSAMAAF---SHPHTAGLAVGAL 118          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Match: ENSORLT00000000373.2 (sodium/potassium/calcium exchanger 3 [Source:NCBI gene;Acc:101174615])

HSP 1 Score: 60.4622 bits (145), Expect = 7.094e-9
Identity = 40/164 (24.39%), Postives = 87/164 (53.05%), Query Frame = 2
Query: 2267 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTA---LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDI 2749
            P ++  F  +  ++S LWI  ++  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T +      +   S  LIF++ L+     L +L + L K+   +  G+  + +Y+++     L   +I
Sbjct:  396 PRWEKCF-MLSFVSSTLWIAGLSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWALKTLAINYGSDIKLNSKGLIFSVGLLLGSVFLTVLGVHLNKWTLDKRLGVCCLLLYLVFLCFSCLIEYNI 558          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Match: slc24a4b (solute carrier family 24 member 4 [Source:NCBI gene;Acc:101164447])

HSP 1 Score: 59.6918 bits (143), Expect = 1.004e-8
Identity = 40/164 (24.39%), Postives = 88/164 (53.66%), Query Frame = 2
Query: 2267 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLV---TALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDI 2749
            P ++ FF  +  I S +WI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++I+T       ++   S  L+++++L+    AL +L +   K++     G+ ++ +Y ++    IL   ++
Sbjct:  436 PRWERFF-MLSFILSTVWIAIFSYVMVWMVTVAGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWAIQTICVSYGSEVAINSRGLVYSVVLLLGSVALTVLGIHFNKWRLDFKLGVYVLVLYAVFLCFSILIEYNV 598          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Match: ENSORLT00000003048.2 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:101170984])

HSP 1 Score: 55.0694 bits (131), Expect = 3.079e-7
Identity = 36/156 (23.08%), Postives = 82/156 (52.56%), Query Frame = 2
Query: 2291 FIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTA---LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDI 2749
             +   T+ +WI  ++  +V +++V G    +  VI+G++ LA   S  D +++V +A+     +  S  +G  +F++LVG+G+P++++T        +   S  L+F++ L+ A     +L + L K+      G++ + +Y ++  + IL   ++
Sbjct:  497 MVSFFTATIWIAGLSYIMVWMVTVIGFTLGLPDVIMGITFLAAGTSVPDCMASVIVARQGMGDMAISNSIGSNVFDILVGLGLPWALQTLCIDYGSVIHLNSRGLVFSVGLLLASVFFTVLGVHLNKWTLDWRLGLVCLVMYAVFLCISILIEFNV 652          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000022802.1 (SMESG000022802.1)

HSP 1 Score: 803.512 bits (2074), Expect = 0.000e+0
Identity = 442/494 (89.47%), Postives = 443/494 (89.68%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRXXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANKNITVNNIEITVTAPNDEDDQKNDLDIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTP--------------------------------------------------PKDDIYQENDLNELKSDSSSISDFNCINVERSNTGVSLGGSLRNDYSYDNPNYVHDNHKDHFSRASTTLSSFKSNFSSINENPKFIKECFEDKLDHLNVPQINYQGKSRLVTTQHSCPHESECNAKKRVYDYSNSYQFERSYNXXXXXXXXXXXXXXHQKHSYSIKRKHHSARNFMTRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHFRSISLTIINESPPKTKIRFWSMSENEKSKSGLT 1775
            GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRNIKSKTTTIETNNSNITIRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANKNITVNNIEITVTAPNDEDDQKNDLDIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTP                                                  PKDDIYQENDLNELKSDSSSISDFNCINVERSNTGVSLGGSLRNDYSYDNPNYVHDNHKDHFSRASTTLSSFKSNFSSINENPKFIKECFEDKLDHLNVPQINYQGKSRLVTTQHSCPHESECNAKKRVYDYSNSYQFERSYNSIESTLSSLRSSIIHQKHSYSIKRKHHSARNFMTRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHFRSISLTIINESPPKTKIRFWSMSENEKSKS +T
Sbjct:  129 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRNIKSKTTTIETNNSNITIRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANKNITVNNIEITVTAPNDEDDQKNDLDIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPSKDDIYQENDLNELKSDSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENDLNELKSDSSSISDFNCINVERSNTGVSLGGSLRNDYSYDNPNYVHDNHKDHFSRASTTLSSFKSNFSSINENPKFIKECFEDKLDHLNVPQINYQGKSRLVTTQHSCPHESECNAKKRVYDYSNSYQFERSYNSIESTLSSLRSSIIHQKHSYSIKRKHHSARNFMTRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHFRSISLTIINESPPKTKIRFWSMSENEKSKSDIT 622          

HSP 2 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 320/320 (100.00%), Postives = 320/320 (100.00%), Query Frame = 2
Query: 1805 SDITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2764
            SDITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL
Sbjct:  619 SDITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 938          

HSP 3 Score: 241.891 bits (616), Expect = 9.275e-67
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 1
Query:   46 MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL 429
            MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL
Sbjct:    1 MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL 128          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000022803.1 (SMESG000022803.1)

HSP 1 Score: 369.777 bits (948), Expect = 0.000e+0
Identity = 221/464 (47.63%), Postives = 283/464 (60.99%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRXXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANKNIT-VNNIEITVTAP-----NDEDDQKNDLDIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENDLNELKSDSSSISDFNCINVERSNTGVS-----------LGGSLR--NDYSYDNPNYVHDNHKDHFSRASTTLSSFKSNFSSINENPKFIKECFEDKLDHLNVPQINYQGKSRLVTTQHSCPHESECNAKKRVY-DYSNSYQFERSYNXXXXXXXXXXXXXXHQKHSYSIKRKHHSARNFMTRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHFRSISLTIINESPPKTKIRFWSMSENEKSKSGLT 1775
            GAG+FVN+ITAGIIMI++PFK+MKRP++KD LFYF  LIWCM IFI++QIELWSSLVFL +Y IYILVTVISRLLYVR                                                    K+NK I   NNI IT+T P     N E  Q+N     +    SI DFI I +D +SK N N   N+I IT+  P D + QENDLN     SS+ISDF  I++ RS+T  +           + GSLR  N YSYDNPNY+ DN  D    AST  S+F++NF SIN+NP  +KE + DK DHLNVP   YQ K  L+ +Q+SCP++SEC++ KR+   Y N  Q ER YN++ S   S   +  H K+S SIK+K+ S R+ + RS+SHRSI S+A+IIID EHEKER+E HP +KK N  +S+SLT++NE   K+ IR+WSM E +K+KS +T
Sbjct:  129 GAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVR--------------------------------------------------NEKSNKTIIQTNNISITITTPATNVENAEIQQQN-----IEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVN--HLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDIT 535          

HSP 2 Score: 243.432 bits (620), Expect = 0.000e+0
Identity = 111/117 (94.87%), Postives = 115/117 (98.29%), Query Frame = 2
Query: 1805 SDITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 2155
            SDITNEW I++GN+K+ PENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN
Sbjct:  532 SDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 648          

HSP 3 Score: 197.208 bits (500), Expect = 0.000e+0
Identity = 107/128 (83.59%), Postives = 110/128 (85.94%), Query Frame = 1
Query:   46 MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL 429
            M  CTPL FSS NYSN C YIT F  C PNSG INY+QWQYC+F NRWAP ILM LWFLFLLTGI T+AD FLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS SNPNVGLAFG IL
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAIL 128          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000022803.1 (SMESG000022803.1)

HSP 1 Score: 358.992 bits (920), Expect = 0.000e+0
Identity = 218/464 (46.98%), Postives = 280/464 (60.34%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRXXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANKNIT-VNNIEITVTAP-----NDEDDQKNDLDIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENDLNELKSDSSSISDFNCINVERSNTGVS-----------LGGSLR--NDYSYDNPNYVHDNHKDHFSRASTTLSSFKSNFSSINENPKFIKECFEDKLDHLNVPQINYQGKSRLVTTQHSCPHESECNAKKRVY-DYSNSYQFERSYNXXXXXXXXXXXXXXHQKHSYSIKRKHHSARNFMTRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHFRSISLTIINESPPKTKIRFWSMSENEKSKSGLT 1775
            GAG+FVN+ITAGIIMI++PFK+MKRP++KD LFYF  LIWCM IFI++QIELWSSL    +Y IYILVTVISRLLYVR                                                    K+NK I   NNI IT+T P     N E  Q+N     +    SI DFI I +D +SK N N   N+I IT+  P D + QENDLN     SS+ISDF  I++ RS+T  +           + GSLR  N YSYDNPNY+ DN  D    AST  S+F++NF SIN+NP  +KE + DK DHLNVP   YQ K  L+ +Q+SCP++SEC++ KR+   Y N  Q ER YN++ S   S   +  H K+S SIK+K+ S R+ + RS+SHRSI S+A+IIID EHEKER+E HP +KK N  +S+SLT++NE   K+ IR+WSM E +K+KS +T
Sbjct:  129 GAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLA---IYVIYILVTVISRLLYVR--------------------------------------------------NEKSNKTIIQTNNISITITTPATNVENAEIQQQN-----IEDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNTLPSERPSTEVN--HLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDIT 532          

HSP 2 Score: 243.432 bits (620), Expect = 0.000e+0
Identity = 111/117 (94.87%), Postives = 115/117 (98.29%), Query Frame = 2
Query: 1805 SDITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 2155
            SDITNEW I++GN+K+ PENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN
Sbjct:  529 SDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 645          

HSP 3 Score: 197.208 bits (500), Expect = 0.000e+0
Identity = 107/128 (83.59%), Postives = 110/128 (85.94%), Query Frame = 1
Query:   46 MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL 429
            M  CTPL FSS NYSN C YIT F  C PNSG INY+QWQYC+F NRWAP ILM LWFLFLLTGI T+AD FLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS SNPNVGLAFG IL
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAIL 128          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000022808.1 (SMESG000022808.1)

HSP 1 Score: 355.14 bits (910), Expect = 9.417e-110
Identity = 177/294 (60.20%), Postives = 229/294 (77.89%), Query Frame = 2
Query: 1886 IETGENGDSV-VTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2764
            +++  N DS  +TFPG +KHF LTILPVDL++W   S F K L+I+QSP MFILTLTI +V+E  +LKGWCKILNC+HC+LS + W+   +V   P GT  F++ YL +I+G + G+ VA TSK + PPIYQPFFAF+G ITSI WIYEI NEIVN+L   GVVF+I   ILGLS+LAFANS GDLVSN+TLAK NYPRI Y+AC+GGPLFNLLVGIG+PFSI+T   PI + L   ++VL+FTI LVT +NL+ LP++KF+  + YGIIL+TIY+++F+L+I FA ++I VT+
Sbjct:  420 LQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 713          

HSP 2 Score: 166.777 bits (421), Expect = 1.151e-68
Identity = 87/128 (67.97%), Postives = 104/128 (81.25%), Query Frame = 1
Query:   46 MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL 429
            M+ C P N + +NYSN CQY+   S+C+ +SGF+NYF+WQYC FD+R  PTILM+LWFL LL  +AT AD F APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSA+ S++NPNVGLA G IL
Sbjct:    1 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSIL 128          

HSP 3 Score: 114.39 bits (285), Expect = 1.151e-68
Identity = 48/78 (61.54%), Postives = 63/78 (80.77%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAGI VN+ITAGIIMII PF++M+RP+IKD +FY   L+WC  I +RR+IE WSS+VFL +Y +Y+ VT ISR LY++
Sbjct:  129 GAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALYLK 206          

HSP 4 Score: 51.6026 bits (122), Expect = 3.230e-6
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 3
Query: 1530 KRKHHSARNFM-TRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHF--RSISLTIINE-SPPKTKIRFWSMSENEKSK 1763
            ++  +S+ N    RS+SHRS+GS A+III  EHE+E ++K+   K       RS+SL+ +N+ S PK KIRF+S   N  ++
Sbjct:  305 RKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKCLKRSVSLSALNDCSVPKLKIRFYSADTNMAAR 386          
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000022809.1 (SMESG000022809.1)

HSP 1 Score: 323.553 bits (828), Expect = 1.069e-98
Identity = 170/319 (53.29%), Postives = 227/319 (71.16%), Query Frame = 2
Query: 1811 ITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS-GPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 2764
            I+ E  I K +        +E+  ++ET +     V FPG +KHF + I+P++ EEW+EQS FSK LS+IQSP MFILTLTIP+V+E  YLKGWCK+LNC+HC+LS + W+        P G+  F+L++L +I+G    +  A TSK + PP Y   FAF+G +TSI WIY IANEIVNIL  FGVV +I   ILGL++LAFANS GDLVSN+ LA+  +PRI YSAC+GGPLFNLLVGIG+PFSI     G I V+L   +IVLI TI+L+T +NL+ LP+M+F+ +  YGII+I IYV++ + V+LFA ++IK+TL
Sbjct:  321 ISEENQIEKSSVDSTLHTSSESDIDVETKD-----VQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYSACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKITL 634          

HSP 2 Score: 124.79 bits (312), Expect = 1.585e-51
Identity = 53/78 (67.95%), Postives = 66/78 (84.62%), Query Frame = 3
Query:  444 GAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 677
            GAGI VN++TAGIIMII PF +M+RP+IKD +FY   L+WCMFI IRRQIELWSS+VFLI+Y IY+ VT +SR +YV+
Sbjct:   76 GAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVK 153          

HSP 3 Score: 98.9821 bits (245), Expect = 1.585e-51
Identity = 49/65 (75.38%), Postives = 53/65 (81.54%), Query Frame = 1
Query:  235 GIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGIL 429
             +A  AD F APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSAV S S+PNV LA G IL
Sbjct:   11 AVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSIL 75          
The following BLAST results are available for this feature:
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC8B13.598e-3935.06solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B18.452e-3935.06solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B18.452e-3935.06solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B13.005e-3539.49solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B19.162e-1535.29solute carrier family 8 member B1 [Source:HGNC Sym... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncx-73.707e-3834.50Putative sodium/calcium exchanger 7 [Source:UniPr... [more]
ncx-63.979e-3631.07Putative sodium/calcium exchanger 6 [Source:UniPr... [more]
ncx-98.680e-3029.43Mitochondrial sodium/calcium exchanger protein [S... [more]
ncx-101.753e-2728.10Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q96... [more]
ncx-103.603e-2728.10Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q96... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG123761.008e-2126.99gene:FBgn0033323 transcript:FBtr0339335[more]
CG123761.540e-2126.99gene:FBgn0033323 transcript:FBtr0088706[more]
CG147447.424e-2125.00gene:FBgn0033324 transcript:FBtr0307024[more]
CG147431.850e-2025.65gene:FBgn0033326 transcript:FBtr0307023[more]
CG53481.851e-2026.01gene:FBgn0034156 transcript:FBtr0305318[more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b11.499e-2238.14solute carrier family 8 member B1 [Source:ZFIN;Acc... [more]
BX088721.19.942e-923.75solute carrier family 24 member 6a [Source:NCBI ge... [more]
slc24a6a1.641e-823.75solute carrier family 24 member 6a [Source:ZFIN;Ac... [more]
slc24a31.090e-723.84solute carrier family 24 member 3 [Source:ZFIN;Acc... [more]
CABZ01081780.14.076e-723.49sodium/potassium/calcium exchanger 2-like [Source:... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b15.994e-4030.23solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b17.157e-4030.23solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b11.830e-3930.13solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b12.533e-3931.56solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b17.313e-1535.40solute carrier family 8 (sodium/lithium/calcium ex... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc8b14.459e-3834.56solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b17.773e-3834.56solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b18.193e-3834.56solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b11.144e-2033.16solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc24a45.150e-1025.61solute carrier family 24 (sodium/potassium/calcium... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AXS0|NCLX_RAT1.568e-3834.93Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|Q6J4K2|NCLX_HUMAN4.059e-3835.06Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|P34322|NCX7_CAEEL4.715e-3734.50Putative sodium/calcium exchanger 7 OS=Caenorhabdi... [more]
sp|Q925Q3|NCLX_MOUSE5.437e-3734.56Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|P34315|NCX6_CAEEL5.061e-3531.07Putative sodium/calcium exchanger 6 OS=Caenorhabdi... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203114872.537e-6190.13tr|A0A0H3YKA1|A0A0H3YKA1_SCHMD Slc24a-2 OS=Schmidt... [more]
gnl|BL_ORD_ID|203235490.000e+098.13tr|A0A0H3YFD7|A0A0H3YFD7_SCHMD Slc24a-7 OS=Schmidt... [more]
gnl|BL_ORD_ID|203189208.465e-9453.29tr|A0A0H3YF40|A0A0H3YF40_SCHMD Slc24a-5 OS=Schmidt... [more]
gnl|BL_ORD_ID|211209921.120e-5441.29tr|A0A2T7PD60|A0A2T7PD60_POMCA Uncharacterized pro... [more]
gnl|BL_ORD_ID|183308275.722e-5343.60tr|A0A1I8IHV2|A0A1I8IHV2_9PLAT Na_Ca_ex domain-con... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b12.725e-3234.56solute carrier family 8 member B1 [Source:NCBI gen... [more]
slc24a32.958e-924.85solute carrier family 24 member 3 [Source:NCBI gen... [more]
slc24a33.867e-924.55solute carrier family 24 member 3 [Source:NCBI gen... [more]
slc24a6a1.488e-824.38solute carrier family 24 member 6a [Source:ZFIN;Ac... [more]
slc24a4a2.571e-723.64solute carrier family 24 member 4a [Source:ZFIN;Ac... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SLC8B18.486e-3631.94solute carrier family 8 member B1 [Source:HGNC Sym... [more]
slc24a4b9.436e-823.03solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YDL206W_mRNA5.933e-850.91Putative protein of unknown function; YDL206W is n... [more]
ECM272.243e-627.38Protein involved in calcium homeostasis and exit f... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO319501.699e-2630.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352121.741e-628.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320482.359e-626.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b19.884e-3233.59solute carrier family 8 member B1 [Source:NCBI gen... [more]
slc8b11.551e-3133.59solute carrier family 8 member B1 [Source:NCBI gen... [more]
ENSORLT00000000373.27.094e-924.39sodium/potassium/calcium exchanger 3 [Source:NCBI ... [more]
slc24a4b1.004e-824.39solute carrier family 24 member 4 [Source:NCBI gen... [more]
ENSORLT00000003048.23.079e-723.08solute carrier family 24 member 3 [Source:NCBI gen... [more]
back to top
BLAST of mitochondrial sodium/calcium exchanger protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022802.19.275e-6789.47SMESG000022802.1[more]
SMESG000022803.10.000e+047.63SMESG000022803.1[more]
SMESG000022803.10.000e+046.98SMESG000022803.1[more]
SMESG000022808.19.417e-11060.20SMESG000022808.1[more]
SMESG000022809.11.069e-9853.29SMESG000022809.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008728 ID=SMED30008728|Name=mitochondrial sodium/calcium exchanger protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2820bp
AAAGTAAGTAATGATGTGAAGACAATTAATTTATTATAATATTTTATGGA
TTTATGCACTCCTTTAAACTTCAGTAGCTCTAACTATTCGAATATATGCC
AGTATATTACCTTTTTCAGCAGTTGTATTCCAAATTCGGGGTTTATTAAT
TATTTCCAATGGCAGTATTGTTCGTTTGATAATCGTTGGGCTCCGACAAT
ACTTATGCTCTTATGGTTTTTATTTTTGCTCACCGGTATAGCAACTGCAG
CTGATGGTTTTTTGGCACCTTGCCTTGTTGTCGTGGCAAAAACCATGAGA
ATGAGTGAAAATTTAGCAGGAGTTACTTTATTGGCTCTCGGAAATGGGGC
TGCTGATGTATTTAGTTCCTTATCAGCAGTTACATCAGCTAGTAATCCGA
ATGTTGGTTTAGCTTTTGGAGGAATTTTAGATCTACATTTGCAGGAGCTG
GGATATTTGTCAATTCAATAACCGCTGGTATAATAATGATAATTACTCCT
TTCAAACTCATGAAGAGGCCAGTTATAAAAGATTTTTTGTTTTATTTTTC
GGGCTTAATTTGGTGTATGTTCATTTTTATCAGAAGACAGATTGAATTGT
GGTCTTCGTTAGTGTTTTTAATATTATACGCCATCTATATTTTGGTCACA
GTAATATCAAGATTACTTTATGTTCGAAATATTAAATCAAAAACGACAAC
CATTGAAACAAATAATTCAAATATAACAATTAGAACACCTGATTTGAATG
TAGAAAATGCAGAAATTCAACAAAAAGACAACAGAGACTCTTCAACTTCA
AATTCAGTTCTCATTTTCAAAGACAACAGATCTAAAGCAAATAAAAATAT
AACTGTAAATAATATTGAAATCACCGTTACGGCCCCAAACGATGAAGATG
ATCAGAAAAATGATTTAGATATAGCAATGAGGAAGTCATCGTCGATTTCA
GATTTTATTCCCATTTACAAAGACATCAAATCTAAAACAAATACAAATAA
AATTGTAAATAATATTGAAATAACGGTTACACCCCCTAAAGACGATATTT
ATCAAGAAAATGATTTGAATGAACTAAAAAGCGATTCATCGTCGATTTCG
GATTTCAACTGCATTAATGTCGAAAGATCAAATACAGGAGTGTCCCTTGG
AGGAAGTTTGAGGAACGATTATTCCTATGACAATCCAAATTATGTTCATG
ATAACCACAAAGACCACTTTAGCAGAGCTTCAACTACTCTTTCGAGTTTC
AAAAGCAATTTCAGTTCCATAAATGAAAACCCAAAGTTTATCAAAGAATG
TTTTGAAGACAAATTGGATCATTTAAATGTACCTCAAATCAACTATCAAG
GAAAATCTAGGCTAGTCACAACTCAACATTCTTGTCCGCATGAATCTGAA
TGCAATGCAAAAAAGAGGGTATATGACTATTCAAATTCATACCAATTTGA
AAGATCTTACAATTCTATTGAAAGCACTTTGTCATCATTGAGATCTTCGA
TTATCCATCAAAAGCATTCTTATTCCATCAAAAGAAAGCATCATTCTGCT
AGAAATTTCATGACCAGATCATCAAGTCATCGATCAATCGGATCTTTGGC
ACAAATAATTATAGATAAAGAACATGAGAAAGAAAGAATAGAAAAACATC
CAATATCTAAGAAAATTAATCATTTTAGATCTATTTCATTGACAATAATA
AATGAAAGTCCCCCTAAAACTAAAATACGCTTTTGGTCCATGAGTGAAAA
TGAAAAATCTAAATCAGGTTTGACTTTTGATAATAAAATATCTAATTTAA
TTAATCAGATATTACAAATGAATGGGGCATTATAAAAGGCAATCATAAAA
TCCCTCCAGAAAATGAAAATGAAAATAAATTTAACATTGAAACTGGTGAA
AATGGAGATTCCGTCGTTACTTTTCCAGGCCCGTGGAAACATTTTGCATT
GACGATTTTACCTGTAGACTTGGAAGAATGGCGAGAGCAGTCGGGTTTCT
CAAAGTTTCTCTCAATTATTCAATCTCCTTTTATGTTTATTTTAACATTA
ACAATTCCAATAGTTGATGAAACTGCTTATCTCAAAGGCTGGTGTAAAAT
CCTGAACTGTATTCACTGTTTATTATCCCTTGTTTTTTGGGTCTTACTGC
CTAATGTATACAATACCCCTTTTGGAACGAGTAACTTCTTGTTGGTATAT
TTATTCATAATTTTGGGATTTATTGTCGGTGTTGTTGTCGCATTTACCTC
AAAAGTCGACAAACCTCCAATATATCAGCCATTCTTTGCTTTTATTGGCC
TCATCACTTCAATATTGTGGATATATGAAATTGCAAATGAAATAGTCAAC
ATTCTTTCAGTTTTTGGAGTAGTTTTCAATATATCTTCCGTGATTTTAGG
GCTGAGTGTATTGGCCTTTGCTAATTCAACCGGAGATTTGGTTTCCAATG
TCACTCTTGCGAAAAATAATTATCCACGGATTGGTTATTCAGCTTGTGTT
GGAGGTCCACTCTTTAATCTTTTAGTTGGAATTGGAATTCCATTTTCAAT
TAGGACTTTCAGTGGTCCTATACCAGTTCAGCTAACAGGAACTTCAATTG
TTTTAATATTCACAATCATGCTAGTTACCGCCTTGAACTTGTTATGCTTA
CCCTTGATGAAGTTTCAACCAAAAAGATTTTACGGAATAATTCTGATAAC
CATATATGTCATATATTTTGTTTTGGTCATTCTTTTTGCTGTTGATATTA
TCAAAGTTACGTTATAAAGATAGATTAGATTATATATATTAGGTTAATTA
CTTATTTTTTATGATGGATG
back to top

protein sequence of SMED30008728-orf-1

>SMED30008728-orf-1 ID=SMED30008728-orf-1|Name=SMED30008728-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=245bp
MFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTS
NFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEI
ANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRI
GYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTA
LNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL*
back to top

protein sequence of SMED30008728-orf-2

>SMED30008728-orf-2 ID=SMED30008728-orf-2|Name=SMED30008728-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=142bp
MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAP
TILMLLWFLFLLTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGN
GAADVFSSLSAVTSASNPNVGLAFGGILDLHLQELGYLSIQ*
back to top

protein sequence of SMED30008728-orf-3

>SMED30008728-orf-3 ID=SMED30008728-orf-3|Name=SMED30008728-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=450bp
MIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAI
YILVTVISRLLYVRNIKSKTTTIETNNSNITIRTPDLNVENAEIQQKDNR
DSSTSNSVLIFKDNRSKANKNITVNNIEITVTAPNDEDDQKNDLDIAMRK
SSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENDLNELKSD
SSSISDFNCINVERSNTGVSLGGSLRNDYSYDNPNYVHDNHKDHFSRAST
TLSSFKSNFSSINENPKFIKECFEDKLDHLNVPQINYQGKSRLVTTQHSC
PHESECNAKKRVYDYSNSYQFERSYNSIESTLSSLRSSIIHQKHSYSIKR
KHHSARNFMTRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHFRSI
SLTIINESPPKTKIRFWSMSENEKSKSGLTFDNKISNLINQILQMNGAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000047collecting duct
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000141dorsal region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004837NaCa_Exmemb
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 41..63
NoneNo IPR availableTMHMMTMhelixcoord: 17..36