Potassium voltage-gated channel protein Shaw

Overview
NamePotassium voltage-gated channel protein Shaw
Smed IDSMED30008719
Length (bp)1696
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium voltage-gated channel protein Shaw (SMED30008719) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium voltage-gated channel protein Shaw (SMED30008719) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel protein Shaw (SMED30008719) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel protein Shaw (SMED30008719) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008719

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30008719SMESG000059794.1 SmedASXL_003754SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008719SMESG000059794.1 dd_Smed_v6_69522_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008719SMESG000059794.1 dd_Smed_v6_28883_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008719SMESG000059794.1 OX_Smed_1.0.07126ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC1 (potassium voltage-gated channel subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:6233])

HSP 1 Score: 307.76 bits (787), Expect = 1.179e-97
Identity = 181/449 (40.31%), Postives = 271/449 (60.36%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLD--------------ADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFI-IDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            D + R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR+ +E +       LD               D   +  +  +  L +         W++++PR+W + E+PYSS  A+ ++  S+ FI++SI  FC++T    N +  K      ++ N  +   +      ++++    I+ +C ++FT E + R+   PN V FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER               F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKT-----EIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC1 (potassium voltage-gated channel subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:6233])

HSP 1 Score: 307.76 bits (787), Expect = 7.990e-97
Identity = 181/449 (40.31%), Postives = 271/449 (60.36%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLD--------------ADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFI-IDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            D + R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR+ +E +       LD               D   +  +  +  L +         W++++PR+W + E+PYSS  A+ ++  S+ FI++SI  FC++T    N +  K      ++ N  +   +      ++++    I+ +C ++FT E + R+   PN V FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER               F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKT-----EIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC4 (potassium voltage-gated channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:6236])

HSP 1 Score: 289.271 bits (739), Expect = 2.670e-89
Identity = 180/464 (38.79%), Postives = 277/464 (59.70%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLN---------------EYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDA------DKMSD---ETLYGKFGLYEKYLNNS-----CNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSS-----EWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            +++ ++I+NVGG RHETY++TL+ +P TRL+ L +      P  +               E+FFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR+ +E + + +  +         D+  D   E    + G +E    +      C  WQ   PR+W + E+PYSS +A++++  S+ FI++SI  FC++T    N    +N +  + + N +S     E   +P+       +  I+ +C ++FT+E + R+   P+ + F+++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER        + +    F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   33 EASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQ---PRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNID--RNVTEILRVGNITSVHFRREVETEPI-------LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 484          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC4 (potassium voltage-gated channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:6236])

HSP 1 Score: 289.271 bits (739), Expect = 3.278e-89
Identity = 180/464 (38.79%), Postives = 277/464 (59.70%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLN---------------EYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDA------DKMSD---ETLYGKFGLYEKYLNNS-----CNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSS-----EWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            +++ ++I+NVGG RHETY++TL+ +P TRL+ L +      P  +               E+FFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR+ +E + + +  +         D+  D   E    + G +E    +      C  WQ   PR+W + E+PYSS +A++++  S+ FI++SI  FC++T    N    +N +  + + N +S     E   +P+       +  I+ +C ++FT+E + R+   P+ + F+++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER        + +    F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   33 EASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQ---PRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNID--RNVTEILRVGNITSVHFRREVETEPI-------LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 484          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC4 (potassium voltage-gated channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:6236])

HSP 1 Score: 289.271 bits (739), Expect = 3.766e-89
Identity = 180/464 (38.79%), Postives = 277/464 (59.70%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLN---------------EYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDA------DKMSD---ETLYGKFGLYEKYLNNS-----CNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSS-----EWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            +++ ++I+NVGG RHETY++TL+ +P TRL+ L +      P  +               E+FFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR+ +E + + +  +         D+  D   E    + G +E    +      C  WQ   PR+W + E+PYSS +A++++  S+ FI++SI  FC++T    N    +N +  + + N +S     E   +P+       +  I+ +C ++FT+E + R+   P+ + F+++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER        + +    F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   33 EASEKIIINVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQ---PRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNID--RNVTEILRVGNITSVHFRREVETEPI-------LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 484          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 454.521 bits (1168), Expect = 2.986e-155
Identity = 253/462 (54.76%), Postives = 328/462 (71.00%), Query Frame = 2
Query:   11 NRTPKSMTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPG--------------INTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRP 1354
            N T  S  D+ +RVILNVGGIRHETY   LKKIPATRLSRLT  LANYDPVLNEYFFDRHP VF  ILNYYR GKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWMTYT HR+TQ+T+A+++ L+LD D  + E +  KFG  + Y   + + WQ+ +PR+W + +EP+SS  A+++SSLSV FI+ S   F +KT P               ++   FKNY  +I           D        + F +D +CNI+FT+EL+ R    P+   F++SPL IID +S  +F+F+    +   Q    V ++FLS+I ++R+FKLT+H SGLKILI TFKASA+EL LLVFF+++ IV+FAAL+YYAER + +  N+F SI +GLWW++VT++TVG+GD  P +  GM+VG+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRRVL    V+P
Sbjct:   14 NETSLSWMDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTI---------GTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKP 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 454.136 bits (1167), Expect = 5.186e-155
Identity = 252/458 (55.02%), Postives = 327/458 (71.40%), Query Frame = 2
Query:   23 KSMTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPG--------------INTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRP 1354
            KS  D+ +RVILNVGGIRHETY   LKKIPATRLSRLT  LANYDPVLNEYFFDRHP VF  ILNYYR GKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWMTYT HR+TQ+T+A+++ L+LD D  + E +  KFG  + Y   + + WQ+ +PR+W + +EP+SS  A+++SSLSV FI+ S   F +KT P               ++   FKNY  +I           D        + F +D +CNI+FT+EL+ R    P+   F++SPL IID +S  +F+F+    +   Q    V ++FLS+I ++R+FKLT+H SGLKILI TFKASA+EL LLVFF+++ IV+FAAL+YYAER + +  N+F SI +GLWW++VT++TVG+GD  P +  GM+VG+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRRVL    V+P
Sbjct:   15 KSWMDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTI---------GTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKP 463          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 452.595 bits (1163), Expect = 1.272e-154
Identity = 251/458 (54.80%), Postives = 327/458 (71.40%), Query Frame = 2
Query:   23 KSMTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPG--------------INTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRP 1354
            +S  D+ +RVILNVGGIRHETY   LKKIPATRLSRLT  LANYDPVLNEYFFDRHP VF  ILNYYR GKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWMTYT HR+TQ+T+A+++ L+LD D  + E +  KFG  + Y   + + WQ+ +PR+W + +EP+SS  A+++SSLSV FI+ S   F +KT P               ++   FKNY  +I           D        + F +D +CNI+FT+EL+ R    P+   F++SPL IID +S  +F+F+    +   Q    V ++FLS+I ++R+FKLT+H SGLKILI TFKASA+EL LLVFF+++ IV+FAAL+YYAER + +  N+F SI +GLWW++VT++TVG+GD  P +  GM+VG+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRRVL    V+P
Sbjct:    8 ESWMDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTI---------GTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKP 456          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 452.21 bits (1162), Expect = 3.151e-154
Identity = 251/458 (54.80%), Postives = 327/458 (71.40%), Query Frame = 2
Query:   23 KSMTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPG--------------INTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRP 1354
            +S  D+ +RVILNVGGIRHETY   LKKIPATRLSRLT  LANYDPVLNEYFFDRHP VF  ILNYYR GKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWMTYT HR+TQ+T+A+++ L+LD D  + E +  KFG  + Y   + + WQ+ +PR+W + +EP+SS  A+++SSLSV FI+ S   F +KT P               ++   FKNY  +I           D        + F +D +CNI+FT+EL+ R    P+   F++SPL IID +S  +F+F+    +   Q    V ++FLS+I ++R+FKLT+H SGLKILI TFKASA+EL LLVFF+++ IV+FAAL+YYAER + +  N+F SI +GLWW++VT++TVG+GD  P +  GM+VG+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRRVL    V+P
Sbjct:   21 ESWMDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTI---------GTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKP 469          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 451.055 bits (1159), Expect = 3.867e-154
Identity = 250/454 (55.07%), Postives = 325/454 (71.59%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPG--------------INTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRP 1354
            D+ +RVILNVGGIRHETY   LKKIPATRLSRLT  LANYDPVLNEYFFDRHP VF  ILNYYR GKLHYP +VCGPLFEEEL+FWGLD+NQVEPCCWMTYT HR+TQ+T+A+++ L+LD D  + E +  KFG  + Y   + + WQ+ +PR+W + +EP+SS  A+++SSLSV FI+ S   F +KT P               ++   FKNY  +I           D        + F +D +CNI+FT+EL+ R    P+   F++SPL IID +S  +F+F+    +   Q    V ++FLS+I ++R+FKLT+H SGLKILI TFKASA+EL LLVFF+++ IV+FAAL+YYAER + +  N+F SI +GLWW++VT++TVG+GD  P +  GM+VG+LCA+ GVLTI+LPVPVIVSNFS  YSH+QAR+KLPKKRRRVL    V+P
Sbjct:    2 DTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVVDEGGFKNYHKTI---------GTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAILIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQARAKLPKKRRRVLQAHEVKP 446          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089274)

HSP 1 Score: 507.679 bits (1306), Expect = 4.552e-176
Identity = 278/439 (63.33%), Postives = 339/439 (77.22%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVR 1351
            DS NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR+TQET+A+LD+L+LD +K S+E L  KFG  E Y   + + WQ+ +PR+W + +EPYSS +AK +  +SV FI +SI  FC+KT P +     +N   ++   N S+ W LD        + F I+ +CN +FT E++ R   SPN   FI+S +NIID ++ +SFY D      +S L+    +EF SIIR+MR+FKLTRH SGLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER + +  N F+SI +GLWWA+VTMTTVGYGD AP +  GM VGALCA+ GVLTI+LPVPVIVSNF+ +YSHTQAR+KLPKKRRRVLPVE  R
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRN--ITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPR 443          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332184)

HSP 1 Score: 507.294 bits (1305), Expect = 7.482e-176
Identity = 278/439 (63.33%), Postives = 339/439 (77.22%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVR 1351
            DS NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR+TQET+A+LD+L+LD +K S+E L  KFG  E Y   + + WQ+ +PR+W + +EPYSS +AK +  +SV FI +SI  FC+KT P +     +N   ++   N S+ W LD        + F I+ +CN +FT E++ R   SPN   FI+S +NIID ++ +SFY D      +S L+    +EF SIIR+MR+FKLTRH SGLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER + +  N F+SI +GLWWA+VTMTTVGYGD AP +  GM VGALCA+ GVLTI+LPVPVIVSNF+ +YSHTQAR+KLPKKRRRVLPVE  R
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRN--ITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPR 443          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332185)

HSP 1 Score: 510.375 bits (1313), Expect = 1.034e-175
Identity = 278/439 (63.33%), Postives = 339/439 (77.22%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVR 1351
            DS NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR+TQET+A+LD+L+LD +K S+E L  KFG  E Y   + + WQ+ +PR+W + +EPYSS +AK +  +SV FI +SI  FC+KT P +     +N   ++   N S+ W LD        + F I+ +CN +FT E++ R   SPN   FI+S +NIID ++ +SFY D      +S L+    +EF SIIR+MR+FKLTRH SGLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER + +  N F+SI +GLWWA+VTMTTVGYGD AP +  GM VGALCA+ GVLTI+LPVPVIVSNF+ +YSHTQAR+KLPKKRRRVLPVE  R
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRN--ITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPR 443          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089275)

HSP 1 Score: 509.99 bits (1312), Expect = 1.419e-175
Identity = 278/439 (63.33%), Postives = 339/439 (77.22%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVR 1351
            DS NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR+TQET+A+LD+L+LD +K S+E L  KFG  E Y   + + WQ+ +PR+W + +EPYSS +AK +  +SV FI +SI  FC+KT P +     +N   ++   N S+ W LD        + F I+ +CN +FT E++ R   SPN   FI+S +NIID ++ +SFY D      +S L+    +EF SIIR+MR+FKLTRH SGLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER + +  N F+SI +GLWWA+VTMTTVGYGD AP +  GM VGALCA+ GVLTI+LPVPVIVSNF+ +YSHTQAR+KLPKKRRRVLPVE  R
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRN--ITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPR 443          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0289989)

HSP 1 Score: 510.375 bits (1313), Expect = 2.193e-175
Identity = 278/439 (63.33%), Postives = 339/439 (77.22%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVR 1351
            DS NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR+TQET+A+LD+L+LD +K S+E L  KFG  E Y   + + WQ+ +PR+W + +EPYSS +AK +  +SV FI +SI  FC+KT P +     +N   ++   N S+ W LD        + F I+ +CN +FT E++ R   SPN   FI+S +NIID ++ +SFY D      +S L+    +EF SIIR+MR+FKLTRH SGLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER + +  N F+SI +GLWWA+VTMTTVGYGD AP +  GM VGALCA+ GVLTI+LPVPVIVSNF+ +YSHTQAR+KLPKKRRRVLPVE  R
Sbjct:   22 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRN--ITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPR 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 311.227 bits (796), Expect = 1.238e-98
Identity = 186/447 (41.61%), Postives = 274/447 (61.30%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTE---------------ALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKY-LNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSID-LTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            D   RVILNVGG RHETY++TLK +P TRL+ L                     Y    NEYFFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR+ +E    LD   ++ D   D+    + G+ +    + + + W++++P +W + ++PYSS +A+ ++  S+ FI++SI  FC++T    NT+  K      + LT+ S ++      I+   ++  ++ +C ++FT E + R+  SP+ + FI+S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER               F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    5 DERERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEA---LDVFEMNVDTEEDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAFNTIINKTDPLRNETLTDISQQY-----EIETDPALTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 443          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 311.612 bits (797), Expect = 2.970e-98
Identity = 186/447 (41.61%), Postives = 274/447 (61.30%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTE---------------ALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKY-LNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSID-LTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            D   RVILNVGG RHETY++TLK +P TRL+ L                     Y    NEYFFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR+ +E    LD   ++ D   D+    + G+ +    + + + W++++P +W + ++PYSS +A+ ++  S+ FI++SI  FC++T    NT+  K      + LT+ S ++      I+   ++  ++ +C ++FT E + R+  SP+ + FI+S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER               F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    5 DERERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEA---LDVFEMNVDTEEDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLETHEAFNTIINKTDPLRNETLTDISQQY-----EIETDPALTYVEGVCVLWFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPNDPTASHHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 443          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 310.457 bits (794), Expect = 4.679e-98
Identity = 178/441 (40.36%), Postives = 283/441 (64.17%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLN--------EYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEK--YLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIF-IIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + ++++I+NVGG RHETY++TL+ IP +RL+ L +  +  +P  +        E+FFDRHP +F  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR+ +E + + +  + + D   D+ +  +FG+ +        C +WQ   P++W + E+PYSS +A++++ +S+ FI++SI  FC++T        F N++ +   TNS++      + +  ++ +  +++ +C ++FT E + R+   PN + FI++ LNIID ++++ FY + +   ++S+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   D       +   F +I +G WWA+VTMTT+GYGD  P +  GMIVGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   33 EDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPDADTGQTHPNSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFEPPDPE-DAEDDQDMPRRFGIEDSPDRSRGCCEVWQ---PKIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAF--FEFHNHTDTKSATNSTT-----IIQVMDTKPVLTVVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIIDFVAILPFYLERSLIGNTSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc3b (potassium voltage-gated channel, Shaw-related subfamily, member 3b [Source:ZFIN;Acc:ZDB-GENE-100901-2])

HSP 1 Score: 312.383 bits (799), Expect = 4.970e-98
Identity = 186/437 (42.56%), Postives = 275/437 (62.93%), Query Frame = 2
Query:   41 ANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDE--TLYGKFGLYEKYLNNS---CNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFK-------YDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + ++++N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH PNDVCGPLFEEEL FWG+D   VE CCWM Y  HR+ +E    LD       ++ D+   L G   L    L         W+ +RPR+W + E+PYSS  A+ ++  S++FI++SI+ FC++T    NT+    Y+ + ++T  +         +     +  ++ +C ++FT+E+ TR+   P+ + F +SPLNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER           +   F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   35 SEKIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEA---LDSFETPEPEVPDDDPALAGDGDLKRLCLQEDGRKAGWWRVWRPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTI----YNKTENVTEGNVTREEIVYEVVTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKMEFFKSPLNIIDFVAVLPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 464          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 310.842 bits (795), Expect = 6.211e-98
Identity = 178/441 (40.36%), Postives = 283/441 (64.17%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLN--------EYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEK--YLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIF-IIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + ++++I+NVGG RHETY++TL+ IP +RL+ L +  +  +P  +        E+FFDRHP +F  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR+ +E + + +  + + D   D+ +  +FG+ +        C +WQ   P++W + E+PYSS +A++++ +S+ FI++SI  FC++T        F N++ +   TNS++      + +  ++ +  +++ +C ++FT E + R+   PN + FI++ LNIID ++++ FY + +   ++S+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   D       +   F +I +G WWA+VTMTT+GYGD  P +  GMIVGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   33 EDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPDADTGQTHPNSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFEPPDPE-DAEDDQDMPRRFGIEDSPDRSRGCCEVWQ---PKIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAF--FEFHNHTDTKSATNSTT-----IIQVMDTKPVLTVVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIIDFVAILPFYLERSLIGNTSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 318.161 bits (814), Expect = 5.187e-101
Identity = 191/481 (39.71%), Postives = 292/481 (60.71%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLT--------------EALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMS-----DETLYGKFGLYEKYL-NNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLN-------KFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGGLTYQEM 1390
            D   R+ILNVGG RHETY++TLK +P TRL+ L                   N     NE+FFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR+ +E + + +  +L   +       +E L  +  + +    +     W++ +PR+W + E+PYSS +A+ ++  S+ FI++SI  FC++T    NT+  K      +  N+ +E  +  + I+   ++  ++ +C ++FT E + R+   P+ + FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER      +       +F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A+ KLP+KR++ +P        +TG  T+ +M
Sbjct:    5 DENERIILNVGGTRHETYRSTLKTVPGTRLALLACESQSEQGLDQQTVSGSFNITSRGNEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLITGEPPPIDEYEEDLGKRLAIEDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNTIINKT-----ETVNNGTEL-ISLIEIETDPALTYVEGVCVVWFTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP-----HAPQTGSPTFCKM 474          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: KCNC2 (potassium channel, voltage gated Shaw related subfamily C, member 2 [Source:NCBI gene;Acc:100489216])

HSP 1 Score: 317.775 bits (813), Expect = 1.358e-100
Identity = 191/481 (39.71%), Postives = 292/481 (60.71%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLT--------------EALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMS-----DETLYGKFGLYEKYL-NNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLN-------KFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGGLTYQEM 1390
            D   R+ILNVGG RHETY++TLK +P TRL+ L                   N     NE+FFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VEPCCWMTY  HR+ +E + + +  +L   +       +E L  +  + +    +     W++ +PR+W + E+PYSS +A+ ++  S+ FI++SI  FC++T    NT+  K      +  N+ +E  +  + I+   ++  ++ +C ++FT E + R+   P+ + FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER      +       +F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A+ KLP+KR++ +P        +TG  T+ +M
Sbjct:    5 DENERIILNVGGTRHETYRSTLKTVPGTRLALLACESQSEQGLDQQTVSGSFNITSRGNEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLITGEPPPIDEYEEDLGKRLAIEDVVCPDGKVGRWRRLQPRMWALFEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNTIINKT-----ETVNNGTEL-ISLIEIETDPALTYVEGVCVVWFTFEFLVRVIFCPDKLEFIRNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGASPSDPSASKHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKYIP-----HAPQTGSPTFCKM 474          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 302.753 bits (774), Expect = 6.128e-95
Identity = 182/437 (41.65%), Postives = 273/437 (62.47%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYS---IDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKY--DSL-----NKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + ++++++NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF  +LNYYR GKLH P DVCGPL+EEEL FWG+D   VE CCWM Y  HR+ +E +   +      ++   +    +  L E         W++ +P++W + E+PYSS +A+ ++  S+ FI++SI  FC++T    N V  K   ++   I  T +  E   +P        +  ++ +C I+FT E + R+   P+ + FI+S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER     D +       F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   33 EDSDKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGD--LKRLCLQED--GRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPF-------LTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 302.368 bits (773), Expect = 7.919e-95
Identity = 182/437 (41.65%), Postives = 273/437 (62.47%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYS---IDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKY--DSL-----NKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + ++++++NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF  +LNYYR GKLH P DVCGPL+EEEL FWG+D   VE CCWM Y  HR+ +E +   +      ++   +    +  L E         W++ +P++W + E+PYSS +A+ ++  S+ FI++SI  FC++T    N V  K   ++   I  T +  E   +P        +  ++ +C I+FT E + R+   P+ + FI+S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER     D +       F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   33 EDSDKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGD--LKRLCLQED--GRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPF-------LTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 302.753 bits (774), Expect = 9.914e-95
Identity = 182/437 (41.65%), Postives = 273/437 (62.47%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYS---IDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKY--DSL-----NKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + ++++++NVGGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF  +LNYYR GKLH P DVCGPL+EEEL FWG+D   VE CCWM Y  HR+ +E +   +      ++   +    +  L E         W++ +P++W + E+PYSS +A+ ++  S+ FI++SI  FC++T    N V  K   ++   I  T +  E   +P        +  ++ +C I+FT E + R+   P+ + FI+S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER     D +       F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   33 EDSDKIVINVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGD--LKRLCLQED--GRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPF-------LTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 307.76 bits (787), Expect = 9.403e-98
Identity = 181/449 (40.31%), Postives = 271/449 (60.36%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLD--------------ADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFI-IDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            D + R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR+ +E +       LD               D   +  +  +  L +         W++++PR+W + E+PYSS  A+ ++  S+ FI++SI  FC++T    N +  K      ++ N  +   +      ++++    I+ +C ++FT E + R+   PN V FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER               F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKT-----EIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 307.76 bits (787), Expect = 5.544e-97
Identity = 181/449 (40.31%), Postives = 271/449 (60.36%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLD--------------ADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFI-IDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            D + R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR+ +E +       LD               D   +  +  +  L +         W++++PR+W + E+PYSS  A+ ++  S+ FI++SI  FC++T    N +  K      ++ N  +   +      ++++    I+ +C ++FT E + R+   PN V FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER               F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKT-----EIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc3 (potassium voltage gated channel, Shaw-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96669])

HSP 1 Score: 297.745 bits (761), Expect = 1.284e-91
Identity = 179/463 (38.66%), Postives = 279/463 (60.26%), Query Frame = 2
Query:   47 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNS-------------C--------------------NIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLN-------KFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            ++++NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWMTY  HR+ +E +   +  +  A+  ++       GL ++                  C                      W++++PR+W + E+PYSS +A+ ++  S+ FI++SI  FC++T  G   ++ K  + +  +  +  E ++  + ++    +  ++ +C ++FT E + R+   P+ V F++S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   D  +        F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEALDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPE-NITNVEVETEPFLTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 552          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc3 (potassium voltage gated channel, Shaw-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96669])

HSP 1 Score: 297.745 bits (761), Expect = 1.355e-91
Identity = 179/463 (38.66%), Postives = 279/463 (60.26%), Query Frame = 2
Query:   47 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNS-------------C--------------------NIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLN-------KFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            ++++NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWMTY  HR+ +E +   +  +  A+  ++       GL ++                  C                      W++++PR+W + E+PYSS +A+ ++  S+ FI++SI  FC++T  G   ++ K  + +  +  +  E ++  + ++    +  ++ +C ++FT E + R+   P+ V F++S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   D  +        F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEALDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPE-NITNVEVETEPFLTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 552          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc3 (potassium voltage gated channel, Shaw-related subfamily, member 3 [Source:MGI Symbol;Acc:MGI:96669])

HSP 1 Score: 298.13 bits (762), Expect = 1.880e-91
Identity = 179/463 (38.66%), Postives = 279/463 (60.26%), Query Frame = 2
Query:   47 RVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNS-------------C--------------------NIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLN-------KFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            ++++NVGG+RHETY++TL+ +P TRL+ LTE  A    +YDP  +E+FFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG+D   VE CCWMTY  HR+ +E +   +  +  A+  ++       GL ++                  C                      W++++PR+W + E+PYSS +A+ ++  S+ FI++SI  FC++T  G   ++ K  + +  +  +  E ++  + ++    +  ++ +C ++FT E + R+   P+ V F++S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   D  +        F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   91 KIVINVGGVRHETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEALDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPE-NITNVEVETEPFLTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 552          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P17972|KCNAW_DROME (Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1)

HSP 1 Score: 507.679 bits (1306), Expect = 4.563e-175
Identity = 278/439 (63.33%), Postives = 339/439 (77.22%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVR 1351
            DS NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF Q+LNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR+TQET+A+LD+L+LD +K S+E L  KFG  E Y   + + WQ+ +PR+W + +EPYSS +AK +  +SV FI +SI  FC+KT P +     +N   ++   N S+ W LD        + F I+ +CN +FT E++ R   SPN   FI+S +NIID ++ +SFY D      +S L+    +EF SIIR+MR+FKLTRH SGLKILI TF+ASAKEL+LLVFFLV+ IV+FA+L+YYAER + +  N F+SI +GLWWA+VTMTTVGYGD AP +  GM VGALCA+ GVLTI+LPVPVIVSNF+ +YSHTQAR+KLPKKRRRVLPVE  R
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRN--ITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKRRRVLPVEQPR 443          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|G5EFC3|KCNAG_CAEEL (Potassium voltage-gated channel protein egl-36 OS=Caenorhabditis elegans OX=6239 GN=egl-36 PE=1 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 7.646e-142
Identity = 249/467 (53.32%), Postives = 324/467 (69.38%), Query Frame = 2
Query:   44 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDAD---KMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGIN--TVTFKNYSYSIDLTNSSSEW-SLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVR-----------PKTKTGGLTYQEMI 1393
             R++LNVGG+RHETY+ATLKKIPATRLSRLT +LAN+DP+LNEYFFDRHP VF  ILNYYR GKLHYP DVCGPLFEEEL +WGLD++  EPCCWM     ++TQET+A+LD+++ D +   ++ ++    KFG  E Y       W K +P++W + +EPYSS +AK+++ +SV+FI +SI  FC+KT        +  +N +    +   S E  S +PL I        I+ LCNI+FT+ELI R    P+ + F +SPLN+ID ++ +SFY D            +V +EFLS+IR+ R+FKLT+H  GL+ILI TF+ASAKEL LLVFFL++ IV+FAAL+YYAE+ + +  N+F SI +GLWWAI TMTTVGYGD  P +  G +VG+LCAV GVLTI+LPVPVIVSNF+ FYSH QAR KLPK+RRRVLPVE +R           P    GGL   + I
Sbjct:   37 ERIVLNVGGVRHETYQATLKKIPATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMILNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDTEPCCWMQLLHAKDTQETLAVLDRMDADHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGISVLFIFISIFSFCLKTHQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPIFGQ-----IEMLCNIWFTLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAMMVRVVEDEPKDV-VEFLSMIRIFRLFKLTQHHQGLQILIHTFRASAKELILLVFFLILGIVIFAALVYYAEKMEANPNNQFQSIPLGLWWAICTMTTVGYGDMTPHTSFGRLVGSLCAVMGVLTIALPVPVIVSNFAMFYSHNQARDKLPKRRRRVLPVEQIRLQARRHAAVLEPSASQGGLGGGQAI 497          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P48547|KCNC1_HUMAN (Potassium voltage-gated channel subfamily C member 1 OS=Homo sapiens OX=9606 GN=KCNC1 PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 5.663e-97
Identity = 181/449 (40.31%), Postives = 271/449 (60.36%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLD--------------ADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFI-IDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            D + R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR+ +E +       LD               D   +  +  +  L +         W++++PR+W + E+PYSS  A+ ++  S+ FI++SI  FC++T    N +  K      ++ N  +   +      ++++    I+ +C ++FT E + R+   PN V FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER               F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKT-----EIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P15388|KCNC1_MOUSE (Potassium voltage-gated channel subfamily C member 1 OS=Mus musculus OX=10090 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 6.577e-97
Identity = 181/449 (40.31%), Postives = 271/449 (60.36%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLD--------------ADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFI-IDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            D + R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR+ +E +       LD               D   +  +  +  L +         W++++PR+W + E+PYSS  A+ ++  S+ FI++SI  FC++T    N +  K      ++ N  +   +      ++++    I+ +C ++FT E + R+   PN V FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER               F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKT-----EIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P25122|KCNC1_RAT (Potassium voltage-gated channel subfamily C member 1 OS=Rattus norvegicus OX=10116 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 3.878e-96
Identity = 181/449 (40.31%), Postives = 271/449 (60.36%), Query Frame = 2
Query:   35 DSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLD--------------ADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFI-IDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            D + R+++NVGG RH+TY++TL+ +P TRL+ L E  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR+ +E +       LD               D   +  +  +  L +         W++++PR+W + E+PYSS  A+ ++  S+ FI++SI  FC++T    N +  K      ++ N  +   +      ++++    I+ +C ++FT E + R+   PN V FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER               F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKT-----EIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A267GF75 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000359g2 PE=3 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 298/450 (66.22%), Postives = 362/450 (80.44%), Query Frame = 2
Query:   29 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMX--XXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGG 1372
            M+D+ NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR TQET+ +LD+L+LD DK+++E LY KFG  E++L+N  N WQ+ +P+LW + +EPYSS++AKI++ +SV FI++SI  FC+KT PG+      N +  ID  N S+ + L     +   +   I+ +CN +FT E+ITR  ++P+ + F++SP+NIID ++ +S           S  +  Y V +EF SIIR+MR+FKLTRHI+GLKILI TFKASAKEL LLVFFL+VFIV+FAALIYYAER +Y+  N FDSI +GLWWAIVTMTTVGYGD AP + AGM+VGALCA+TGVLTI+LPVPVIVSNFS FYSHTQARSKLPKKRRRVLPVEAVRPK+++ G
Sbjct:    1 MSDADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTSHRETQETLGILDRLDLDTDKLAEEDLYKKFGWEEEFLSNELNFWQRIKPKLWALFDEPYSSMAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIISNETVLID-ENGSTSFVLHKHRSEPHTAFLYIECVCNSWFTFEIITRFAVTPDKLEFLKSPVNIIDFIATLSFYMDMVLNQVLSEEETSYEV-LEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIQYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMLVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKSQSAG 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A267FE93 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007473g1 PE=3 SV=1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 302/450 (67.11%), Postives = 361/450 (80.22%), Query Frame = 2
Query:   29 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQ--YNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGG 1372
            M D+ NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR TQET+ +LD+L+LD DK++ E LY KFGL +KY NN  N+WQK +P+LW + +EPYSS++AKI++ +SV FI++SI  FC+KT PG+      N +  +D +N +  ++L     +   + F I+ +CN +FT E++TR  ++P+   F++SP+NIID ++ +SFY D       S+ +  Y V +EF SIIR+MR+FKLTRHI+GLKILI TFKASAKEL LLVFFL+VFIV+FAALIYYAER  Y+  N FDSI +GLWWAIVTMTTVGYGD AP + AGM VGALCA+TGVLTI+LPVPVIVSNFS FYSHTQARSKLPKKRRRVLPVEAVRPK    G
Sbjct:    1 MADADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTTHRETQETLTILDRLDLDTDKLAPEDLYKKFGLEDKYENNELNLWQKVKPKLWALFDEPYSSVAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIITNVTVVVD-SNDTMSYALYKTRSEPHSAFFYIECVCNSWFTFEIVTRFSVTPDKFEFLKSPVNIIDFIATLSFYMDLVLNQVLSEAEASYEV-LEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIHYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMFVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKVAGTG 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A267EKG7 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004927g1 PE=3 SV=1)

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 301/450 (66.89%), Postives = 365/450 (81.11%), Query Frame = 2
Query:   29 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQ--YNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGG 1372
            M+D+ NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR TQET+ +LD+L+LD DK+++E LY KFG  E++L+N  N WQ+ +P+LW + +EPYSS++AKI++ +SV FI++SI  FC+KT PG+      N +  ID  N S+ + L     +   +   I+ +CN +FT E+ITR  ++P+   F++SP+NIID ++ +SFY D       S+ +  Y V +EF SIIR+MR+FKLTRHI+GLKILI TFKASAKEL LLVFFL+VFIV+FAALIYYAER +Y+  N FDSI +GLWWAIVTMTTVGYGD AP + AGM+VGALCA+TGVLTI+LPVPVIVSNFS FYSHTQARSKLPKKRRRVLPVEAVRPK+++ G
Sbjct:    1 MSDADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTSHRETQETLGILDRLDLDTDKLAEEDLYKKFGWEEEFLSNKLNFWQRIKPKLWALFDEPYSSMAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIISNETVLID-ENGSTSFVLHKHRSEPHTAFLYIECVCNSWFTFEIITRFAVTPDKREFLKSPVNIIDFIATLSFYMDMVLNQVLSEEETSYEV-LEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIQYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMLVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKSQSAG 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A267FAP8 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025928g1 PE=3 SV=1)

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 301/450 (66.89%), Postives = 365/450 (81.11%), Query Frame = 2
Query:   29 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQ--YNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGG 1372
            M+D+ NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR TQET+ +LD+L+LD DK+++E LY KFG  E++L+N  N WQ+ +P+LW + +EPYSS++AKI++ +SV FI++SI  FC+KT PG+      N +  ID  N S+ + L     +   +   I+ +CN +FT E+ITR  ++P+   F++SP+NIID ++ +SFY D       S+ +  Y V +EF SIIR+MR+FKLTRHI+GLKILI TFKASAKEL LLVFFL+VFIV+FAALIYYAER +Y+  N FDSI +GLWWAIVTMTTVGYGD AP + AGM+VGALCA+TGVLTI+LPVPVIVSNFS FYSHTQARSKLPKKRRRVLPVEAVRPK+++ G
Sbjct:    1 MSDADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTSHRETQETLGILDRLDLDTDKLAEEDLYKKFGWEEEFLSNKLNFWQRIKPKLWALFDEPYSSMAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIISNETVLID-ENGSTSFVLHKHRSEPHTAFLYIECVCNSWFTFEIITRFAVTPDKREFLKSPVNIIDFIATLSFYMDMVLNQVLSEEETSYEV-LEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIQYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMLVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKSQSAG 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A1I8FX17 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 301/450 (66.89%), Postives = 365/450 (81.11%), Query Frame = 2
Query:   29 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQ--YNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGG 1372
            M+D+ NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDP+LNEYFFDRHP VF QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR TQET+ +LD+L+LD DK+++E LY KFG  E++L+N  N WQ+ +P+LW + +EPYSS++AKI++ +SV FI++SI  FC+KT PG+      N +  ID  N S+ + L     +   +   I+ +CN +FT E+ITR  ++P+   F++SP+NIID ++ +SFY D       S+ +  Y V +EF SIIR+MR+FKLTRHI+GLKILI TFKASAKEL LLVFFL+VFIV+FAALIYYAER +Y+  N FDSI +GLWWAIVTMTTVGYGD AP + AGM+VGALCA+TGVLTI+LPVPVIVSNFS FYSHTQARSKLPKKRRRVLPVEAVRPK+++ G
Sbjct:    1 MSDADNRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTSHRETQETLGILDRLDLDTDKLAEEDLYKKFGWEEEFLSNKLNFWQRIKPKLWALFDEPYSSMAAKIVAVVSVFFIVISILSFCLKTFPGLRVPIISNETVLID-ENGSTSFVLHKHRSEPHTAFLYIECVCNSWFTFEIITRFAVTPDKREFLKSPVNIIDFIATLSFYMDMVLNQVLSEEETSYEV-LEFFSIIRIMRLFKLTRHIAGLKILIHTFKASAKELLLLVFFLIVFIVVFAALIYYAERIQYNPENSFDSIPIGLWWAIVTMTTVGYGDMAPKTYAGMLVGALCALTGVLTIALPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKSQSAG 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: ENSAMXT00000048024.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 311.227 bits (796), Expect = 3.177e-98
Identity = 183/436 (41.97%), Postives = 275/436 (63.07%), Query Frame = 2
Query:   41 ANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYL----NNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + R+++N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH PNDVCGPLFEEEL FWG+D   VE CCWM Y  HR+ +E +   +    +A         G  G  ++      N     W+ ++PR+W + E+PYSS  A+ ++  S++FI++SI+ FC++T    NT+   N + ++ + N + E  +    +     +  ++ +C ++FT+E+ TR+   P+   F +S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   +       +   F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   35 SERIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTI--YNKTENVTVGNVTREEIV--YEVVTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: ENSAMXT00000049045.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 311.612 bits (797), Expect = 6.840e-98
Identity = 183/436 (41.97%), Postives = 275/436 (63.07%), Query Frame = 2
Query:   41 ANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYL----NNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + R+++N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH PNDVCGPLFEEEL FWG+D   VE CCWM Y  HR+ +E +   +    +A         G  G  ++      N     W+ ++PR+W + E+PYSS  A+ ++  S++FI++SI+ FC++T    NT+   N + ++ + N + E  +    +     +  ++ +C ++FT+E+ TR+   P+   F +S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   +       +   F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   35 SERIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTI--YNKTENVTVGNVTREEIV--YEVVTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: ENSAMXT00000012289.2 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 310.842 bits (795), Expect = 7.790e-98
Identity = 183/436 (41.97%), Postives = 275/436 (63.07%), Query Frame = 2
Query:   41 ANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYL----NNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + R+++N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH PNDVCGPLFEEEL FWG+D   VE CCWM Y  HR+ +E +   +    +A         G  G  ++      N     W+ ++PR+W + E+PYSS  A+ ++  S++FI++SI+ FC++T    NT+   N + ++ + N + E  +    +     +  ++ +C ++FT+E+ TR+   P+   F +S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   +       +   F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    7 SERIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTI--YNKTENVTVGNVTREEIV--YEVVTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 438          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: ENSAMXT00000031881.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 311.227 bits (796), Expect = 1.193e-97
Identity = 183/436 (41.97%), Postives = 275/436 (63.07%), Query Frame = 2
Query:   41 ANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYL----NNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + R+++N GG+RHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP VF  ILNYYR GKLH PNDVCGPLFEEEL FWG+D   VE CCWM Y  HR+ +E +   +    +A         G  G  ++      N     W+ ++PR+W + E+PYSS  A+ ++  S++FI++SI+ FC++T    NT+   N + ++ + N + E  +    +     +  ++ +C ++FT+E+ TR+   P+   F +S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   +       +   F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   35 SERIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFESPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTI--YNKTENVTVGNVTREEIV--YEVVTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnc3a (potassium voltage-gated channel, Shaw-related subfamily, member 3a [Source:ZFIN;Acc:ZDB-GENE-100901-1])

HSP 1 Score: 306.605 bits (784), Expect = 3.747e-96
Identity = 182/436 (41.74%), Postives = 274/436 (62.84%), Query Frame = 2
Query:   41 ANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYL----NNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + ++++N GGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP+ F  ILNYYR GKLH P+DVCGPLFEEEL FWG+D   VE CCWM Y  HR+ +E +   +    +  +       G  G  ++          + W  ++PR+W + E+PYSS  A+ ++  S++FI++SI+ FC++T    NT+   N + ++ + N + E       +     +  ++ +C I+FT+E+ TR+   P+   F +S LNIID ++++ FY + A +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   D       +   F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   35 SEKIVINCGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPNTFAFILNYYRTGKLHCPSDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPEVPEDDPALTGGADGDLKRLCLQEDGRKPSWWSIWQPRIWNLFEDPYSSKYARYVAFGSLLFILISISTFCLETHEAFNTI--YNKTENVTVGNVTREEV--SFEVVTDSWLTYVEGMCVIWFTIEVFTRVIFCPDKAEFFKSSLNIIDFVAILPFYLEVALSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPEDPTASAHTAFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 320.087 bits (819), Expect = 6.689e-102
Identity = 186/438 (42.47%), Postives = 285/438 (65.07%), Query Frame = 2
Query:   32 TDSANRVILNVGGIRHETYKATLKKIPATRLSRLTE--ALAN--YDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKM--SDETLYGKFGLYEKYLNNS-CNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            +D   RV++NVGG RHETY+ TL+ +P TRLS LTE  A AN  YD   NE+FFDRHP VF  ILNYYR GKLH P++VCGPLFEEEL FWG+D   VEPCCWM Y  HR+ +E +   +  +++ +     D  +  +FGL E+  +       ++++PR+W + E+PYSS +A+I++  S++FI++SI  FC++T    NTV  K  +Y+I+   +   +    ++++    +  ++ +C  +F+ E + R+   P+   FI++ LN+ID ++++ FY +   +S +S+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +I+YAERF  +           F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NFS +YS   A
Sbjct:   32 SDENERVVINVGGTRHETYRGTLRTLPGTRLSWLTEPDAFANFDYDAKGNEFFFDRHPTVFAHILNYYRTGKLHCPSEVCGPLFEEELIFWGIDETDVEPCCWMNYRQHRDAEEALVSFENPDINGNDEVNEDGEVSKRFGLDERSPDGGKLGFLRRWQPRMWALFEDPYSSRAARIVALASLLFILISITTFCLETHEAFNTVLNKTENYTINNVTTQKVY----VDVETDPVLMYVEGVCVAWFSFEFLVRIICCPDKKVFIKNYLNVIDFVAILPFYLEVGLSSLTSKPARDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIFYAERFGANPNDPTASDHTSFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFSMYYSLAMA 465          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.794 bits (582), Expect = 2.202e-69
Identity = 161/458 (35.15%), Postives = 254/458 (55.46%), Query Frame = 2
Query:   47 RVILNVGGIRHETYKATLKKIPATRLSRL---------TEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLM---XXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGGLT 1378
            RV LNVGG+ HE    TL+++P TRL RL         +E   +Y    NEYFFDRHP  F  +LN+YR G+LH   ++C   F +ELD+WG+D   +E CC   Y  H+  ++   M ++L  +A+   +          +++    C      R +LW++LE P SSL+AK ++ +S++FI+LS     + T+P +       +S+ ID             N + +Q    ++A+C  +FT+E + R   +PN   F +  LN+ID ++++      F    +   SQ Q NV   ++   I+R++R+ KL RH +GL+ L  T + S  EL LL+ FL + I++F++L+++AE+ + D+  KF SI    WWA +TMTTVGYGD  P ++ G I+G LC + GVL I+LP+P+IV+NFS FY   + + K  K+R      EA+    + G + 
Sbjct:    1 RVRLNVGGLVHEVLWRTLERLPRTRLGRLHATNTHGALSELCDDYSIADNEYFFDRHPGAFASVLNFYRTGRLHMSEEMCALSFGQELDYWGVDEIYLETCCQARY--HQKKEQ---MSEELRREAESARERE-------GDEFEGTCC---ADKRRKLWELLENPNSSLAAKGMAIVSILFIVLSTIALSLNTLPDLQHK--DEFSHIID-------------NPKLAQ----VEAVCIAWFTMEYLLRFMSAPNKWKFFKGALNVIDLMAILPYYITIFLTESSRGVSQFQ-NVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEPDT--KFHSIPASFWWATITMTTVGYGDIYPMTLLGKIIGGLCCIAGVLVIALPIPIIVNNFSEFYKEQKRQEKAVKRR------EALERAKRNGSIV 415          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 196.823 bits (499), Expect = 7.528e-58
Identity = 155/419 (36.99%), Postives = 229/419 (54.65%), Query Frame = 2
Query:   44 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAG-KLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGI---NTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQ-YNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYS 1285
            NRV++NV G R ET   TL + P + L    +    +DP+ NEYFFDR    F  IL YY++G +L  P DV   +F EE++F+ L                   +E +A   +  LD  +  +E ++GK                 ++  +W++ E    S++AK+LS +S +  ILSI + C++T+P     N V      +SI     +S ++LDP         F+++  C ++F  EL  R +  P+  +F++  +N ID L++M ++          Q Q     ++ + ++R++R+FKL+RH   L+IL LT KAS +EL++L FFL V +V+F+  IYY E    D    F SI    WWA+VTMT VGYGD  P +V G IVGALCA+TGVLTISLPVPVIVSNF  FY+
Sbjct:    9 NRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELG------------------EEAVAKYGENTLDTPE--EENVHGK----------------DFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSI----RTSIYNLDPF--------FMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 377          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 194.897 bits (494), Expect = 5.391e-57
Identity = 154/419 (36.75%), Postives = 228/419 (54.42%), Query Frame = 2
Query:   44 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAG-KLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGI---NTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQ-YNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYS 1285
             RV++NV G R ET   TL + P + L    +    +DP+ NEYFFDR    F  IL YY++G +L  P DV   +F EE++F+ L                   +E +A   +  LD  +  +E ++GK                 ++  +W++ E    S++AK+LS +S +  ILSI + C++T+P     N V      +SI     +S ++LDP         F+++  C ++F  EL  R +  P+  +F++  +N ID L++M ++          Q Q     ++ + ++R++R+FKL+RH   L+IL LT KAS +EL++L FFL V +V+F+  IYY E    D    F SI    WWA+VTMT VGYGD  P +V G IVGALCA+TGVLTISLPVPVIVSNF  FY+
Sbjct:    1 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELG------------------EEAVAKYGENTLDTPE--EENVHGK----------------DFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSI----RTSIYNLDPF--------FMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 369          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcna1b (potassium voltage-gated channel, shaker-related subfamily, member 1b [Source:ZFIN;Acc:ZDB-GENE-140515-1])

HSP 1 Score: 194.126 bits (492), Expect = 8.303e-57
Identity = 154/419 (36.75%), Postives = 228/419 (54.42%), Query Frame = 2
Query:   44 NRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAG-KLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGI---NTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQ-YNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYS 1285
             RV++NV G R ET   TL + P + L    +    +DP+ NEYFFDR    F  IL YY++G +L  P DV   +F EE++F+ L                   +E +A   +  LD  +  +E ++GK                 ++  +W++ E    S++AK+LS +S +  ILSI + C++T+P     N V      +SI     +S ++LDP         F+++  C ++F  EL  R +  P+  +F++  +N ID L++M ++          Q Q     ++ + ++R++R+FKL+RH   L+IL LT KAS +EL++L FFL V +V+F+  IYY E    D    F SI    WWA+VTMT VGYGD  P +V G IVGALCA+TGVLTISLPVPVIVSNF  FY+
Sbjct:    5 QRVVINVSGERFETQLKTLDQFPDSLLGHPDKRARYFDPLQNEYFFDRSHVNFDAILFYYQSGGRLCKPVDVPSDVFREEVEFYELG------------------EEAVAKYGENTLDTPE--EENVHGK----------------DFQQHVWRLFESRDGSIAAKMLSLMSFVTTILSITVMCLETLPQFRKDNQVHANRTEFSI----RTSIYNLDPF--------FMLETACVVWFIFELAVRFYACPSKTSFMKDFMNAIDILAIMPYFITVVLEIMQQQDQTRQPLLKIIRLVRVLRIFKLSRHCQDLQILGLTLKASLRELAMLSFFLFVAVVIFSGAIYYVE--ADDPQKHFSSIPDAFWWAVVTMTLVGYGDMWPMTVGGKIVGALCAITGVLTISLPVPVIVSNFKYFYN 373          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 322.398 bits (825), Expect = 3.223e-105
Identity = 192/439 (43.74%), Postives = 275/439 (62.64%), Query Frame = 2
Query:   23 KSMTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTE---ALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMS--DETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRR 1324
            +  T++ +RV++NVGG +HETY  TLK IP TRL  +TE    L  +DP  +E+FFDRHP VF Q+LN+YR GKLH PNDVCGPLFE+EL FWG+D  QVEPCCW+ Y  HR  Q  +   D  + D + +   D ++YG      +  N +   W+KY+PR+W M EEPYSS+ A++L+ +++  II S+ +FC++TVP                         D     +   ++I++A+C  +FT+E + RL   P+ ++F + P+N ID  +++   F        S  +  V +  + +IR+ R+FKL+RH  GL+IL  T ++S  EL LLVFFL + +V+F+++I+YAE  K      F +I    WWA+VTMTT+GYGD  P +  G IVG+LCAV GVL I+LPVPVIVSNFS +YSH +AR KLP+++R
Sbjct:    9 EEQTNAGDRVVINVGGQKHETYIGTLKNIPDTRLYWITENGTQLPEFDPNTSEFFFDRHPGVFAQVLNFYRTGKLHCPNDVCGPLFEDELAFWGIDELQVEPCCWLNYKQHREAQANLDPFDHHDSDNESVGDMDMSVYGLVADSIRQRNRTW--WKKYQPRIWTMFEEPYSSIPAQVLAFITMFLIISSVCLFCLETVP-----------------------KFDNPKTSEGFVLYILEAVCVAWFTLEFLFRLIFCPDKLSFFKKPMNWIDLGAIL--PFYLTLIVRESNFKTIVVLRVVRLIRVFRIFKLSRHSYGLQILGHTLRSSCSELFLLVFFLTIGVVIFSSVIFYAE--KDTKGTHFTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKARMKLPRRKR 418          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 316.62 bits (810), Expect = 3.966e-103
Identity = 196/433 (45.27%), Postives = 267/433 (61.66%), Query Frame = 2
Query:   44 NRVILNVGGIRHETYKATLKKIPATRLSRLTEA---LANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETL-YGKFGL-YEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRR 1327
            +RV +NVGG+RHETYK+TLK IP TRLS + EA    A++DP   EYFFDRHP VF  +LNYYR GKLH P DVCGPLFE+EL FWG+D  QVE CCW+TY  HR+ QET+A  + +  + +   DE    G++G  +          W++Y+PR+W ++EEP+                        +  V    T+T    S  I    S  ++S   L       + I++ +C ++FT+EL+ R    P    F +  +N ID L+++ FY    F ++++ +     +  + +IR+ R+FKL+RH SGL+IL  T +AS +EL LL+FFL++ +VLFA+LI+Y E  K     KF  I    WWA+VTMTTVGYGD AP S +G  +G+LCAV GVLTI+LPVPVIV+NFS +YSH QAR KLPKKRRR
Sbjct:    1 DRVSINVGGVRHETYKSTLKNIPDTRLSWIAEASAGAADFDPSTGEYFFDRHPGVFANVLNYYRTGKLHCPLDVCGPLFEDELGFWGIDDQQVESCCWLTYRQHRDAQETLAAFEGVEFENEYEDDEEPDLGRYGFNFAAESEPDKTWWERYQPRIWTLMEEPH---------------------SSTLAKVIAYTTLTLILVSVGIFCLESMEKFSEKYLK----DLLVILEGICVVWFTLELMVRFVFCPAKCEFFKKIMNWIDFLAIVPFYVSLGFNNNNNDID---ALMIIRLIRIFRIFKLSRHSSGLQILGHTLRASFRELLLLIFFLLIGVVLFASLIFYCE--KKIPGTKFVDIPSSFWWAVVTMTTVGYGDMAPQSPSGKFIGSLCAVCGVLTIALPVPVIVNNFSLYYSHAQARLKLPKKRRR 403          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO38237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ4])

HSP 1 Score: 280.796 bits (717), Expect = 2.896e-89
Identity = 176/430 (40.93%), Postives = 253/430 (58.84%), Query Frame = 2
Query:   41 ANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKS-QSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRR 1327
            ++R+I+NVGG RHET  +TL+ IP TRLS + E     +    EYFFDRHP  F Q+LN+YR GKLH P ++CGP+FEEEL FWG+D  Q+EPCCW TYT HR  +E +     +    + + DE      G Y     N  N W++ +P+LW+ L+EP+SS  AKI S  S +FI LSIA FC  T+P I     KN                   NI  S + +  I+  C+I+F+ EL  RL   P+ + F +  +N ID ++++ FY +            N  +    +IR+MR+F+  +   GL+I+I T KAS+ EL LL+  +++ +V+F++++YY E        +F S+    WW ++TMTTVGYGD  P +  G I+G  CA+ GVL ++LP+ VI SNF+ +Y+H QAR KLP K+RR
Sbjct:   15 SSRIIINVGGFRHETSVSTLQNIPDTRLSWIAENSTVNEDNKREYFFDRHPTAFCQVLNFYRTGKLHCPTEMCGPMFEEELIFWGIDEKQMEPCCWGTYTQHREAEENLKAF--VGPGFNDLKDEPAENHMGSYGSI--NELNCWKRIQPQLWETLDEPHSSKMAKIFSYTSCLFIALSIATFCATTMPAIR----KN-------------------NIMGSREGLDHIEMFCSIFFSFELFMRLISCPSKLHFCRGIMNWIDFVAIIPFYVNI--------FYPNPIVRMFLVIRIMRLFRFIKLSYGLQIMIQTLKASSHELVLLLLMVLIPMVMFSSIVYYVEVIIEGRGAQFTSVPESFWWCLITMTTVGYGDMTPQTWPGKIIGGACAICGVLIVALPISVIGSNFNLYYAHAQARLKLPVKQRR 409          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO45172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTZ3])

HSP 1 Score: 265.774 bits (678), Expect = 4.062e-83
Identity = 182/445 (40.90%), Postives = 257/445 (57.75%), Query Frame = 2
Query:   20 PKSMTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA---NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSD-----ETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRV 1330
            P+ +  +  R+ LNVGG +HETY +T++  P TRL  + E +    +Y     E FFDRHP +F Q+LNYYR GKLH PNDVCGPLFEEEL +WG+D  ++EPCCW TYT HR  +  +   +  +   D  SD     ET     GL+          W KY+PR+W +LEEP SS +AK    LSV+ I+LS+A  C  T+P   T      S S                     +  +I+ +C ++FT+EL  RL   PN  TF +S    +D LS++ FY    F         +   + L +IRL+R+F+  R + GL++++ T KAS+ EL LL+  L++ +VLF+++IYY E+       KF SI    WW+++TMTTVGYGD  P +  G I+G  CA+ GVL ++LP+ VI SNFS +Y+H QAR KLPKK+ ++
Sbjct:    2 PQVVDTTQKRITLNVGGQKHETYLSTIRNYPDTRLYWVVENVTKAIDYHSEKIELFFDRHPKIFDQVLNYYRTGKLHCPNDVCGPLFEEELAYWGIDEKEMEPCCWTTYTQHREAEHNLKSFNVTDFSTDIDSDRQEETETTSKAKGLHP--------FWVKYQPRIWAILEEPRSSRTAKAFWILSVLLIVLSVATACAITLPQFATEGGSVSSESSAYV-----------------AFTVIEYICGVWFTIELGLRLLFCPNKRTFFKSYSFWVDVLSVIPFYVRLIFP------HEHDLADALQVIRLLRLFRFFRLLYGLQVIMHTLKASSYELFLLLLILLIPVVLFSSIIYYVEKNIDGKTTKFRSIPESFWWSLITMTTVGYGDMTPRTWEGKIIGGACAIFGVLMVALPISVIGSNFSLYYAHAQARLKLPKKKTKI 415          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO48066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ5])

HSP 1 Score: 263.077 bits (671), Expect = 1.285e-82
Identity = 182/441 (41.27%), Postives = 262/441 (59.41%), Query Frame = 2
Query:   44 NRVILNVGGIRHETYKATLKKIPATRLSRLTE---ALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRH---ISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRR 1327
            +RVILNVGG RHETY +TL+ +P +RL+ + E     A+YDP  NE FFDRHP VF  +LNYYR GKLH P DVCGPLFEEEL FWG++  Q+EPCCW  YT HR+ Q T+   + L  D +    E         E+         Q++    W +LE+PYSS  A+IL+ +S++ IILS+  FCI+++P  +   FK                         +   I++ L  ++FT E + R    P+ V FI++ +  +D LS++  Y  FA        + +  ++FL ++RL+R+F+L R    +SG++++  T +ASA+EL LLV  L++ +V+F+ L++YAE+        + +S  +F SI    WWAI+TMTTVGYGD  P +  G  +G LCA  GVL ++LPV VI SNF+ FYSH QA+ KLPKK+ +
Sbjct:    6 DRVILNVGGYRHETYLSTLRVVPDSRLAWIGENASKQADYDPETNEIFFDRHPGVFANVLNYYRTGKLHCPGDVCGPLFEEELAFWGIEELQMEPCCWSNYTQHRDAQATLKAFEGLQKDTEDSEYEA-------GERLARRQKTKMQQF----WALLEQPYSSKYAQILAMVSLVIIILSVTTFCIESMPFAD--AFK-------------------------KEFQILEILYCVWFTFEFVARAIACPSKVEFIKNFMTWVDVLSIIPLYISFA--------KGDQTLDFLFVLRLVRIFRLFRFFRTMSGMQVIGHTLRASARELFLLVLILLIPMVIFSTLVFYAEKSVSKFLNQRINSKGEFPSIPDAFWWAIITMTTVGYGDVTPKTPHGRFIGTLCACIGVLIVALPVSVIGSNFTLFYSHAQAQLKLPKKKHK 400          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 322.783 bits (826), Expect = 8.285e-103
Identity = 186/462 (40.26%), Postives = 283/462 (61.26%), Query Frame = 2
Query:   26 SMTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKL----------NLDADKMSDET--LYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLP 1336
             ++D  +R+++NVGGIRH+TY++TL+ +P TRLS L E  A    +YD  + E+FFDRHP VF  ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR  +E +                + + +   DE   +  +    +     S ++W +++ R+W + E+PYSS  A+ ++  S+ FI++SI  FC++T    N +  + Y   +D   + + +       + +  +  I+ +C ++FT E + R+   PN   FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER        +     +F +I +G WWA+VTMTT+GYGD  P +  GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A+ KLPKK+ R +P
Sbjct:    2 GLSDDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLETHEAFNPIVNRTYVEHLDNITTENTYQ----ETETAAYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNRHIP 459          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 322.783 bits (826), Expect = 1.008e-102
Identity = 186/462 (40.26%), Postives = 283/462 (61.26%), Query Frame = 2
Query:   26 SMTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKL----------NLDADKMSDET--LYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERF-------KYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLP 1336
             ++D  +R+++NVGGIRH+TY++TL+ +P TRLS L E  A    +YD  + E+FFDRHP VF  ILNYYR GKLH P DVCGPL+EEEL FWG+D   VEPCCWMTY  HR  +E +                + + +   DE   +  +    +     S ++W +++ R+W + E+PYSS  A+ ++  S+ FI++SI  FC++T    N +  + Y   +D   + + +       + +  +  I+ +C ++FT E + R+   PN   FI++ LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER        +     +F +I +G WWA+VTMTT+GYGD  P +  GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A+ KLPKK+ R +P
Sbjct:    2 GLSDDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLETHEAFNPIVNRTYVEHLDNITTENTYQ----ETETAAYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPNDPRASDHTQFKNIPIGFWWAVVTMTTLGYGDMYPKTTFGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNRHIP 459          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: ENSORLT00000045623.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:101168545])

HSP 1 Score: 321.627 bits (823), Expect = 4.348e-102
Identity = 196/455 (43.08%), Postives = 287/455 (63.08%), Query Frame = 2
Query:   26 SMTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYL-----NNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLP 1336
            S +DS  ++++N GGIRHETY++TLK +P TRLS LTE  A    +YDP  +E+FFDRHP  F  ILNYYR GKLH P+DVCGPLFEEEL FWG+D   VE CCWM Y  HR+ +E +   +    DA +  D  L G      K L           WQ ++P +W + E+PYSS  A+ ++  S+ FI+LSI+ FC++T    NT+   N + ++ + N + E  +    +     +  ++ +C I+FT+E++ R+   P+   F +S LNIID ++++ FY + A +  SS+   ++  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   D       +   F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A+ KLPKKR + +P
Sbjct:    4 SASDS-EKIVINCGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPATFAFILNYYRTGKLHCPSDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPDAPE-DDPALTGCADGDLKRLCMQEDGRRATRWQVWQPWMWALFEDPYSSKYARYVAFASLFFILLSISTFCLETHEAFNTI--YNKTENVTVGNFTHEEIV--YEVVTDGWLTYVEGVCVIWFTIEVMARVIFCPDKAEFFRSALNIIDFVAIVPFYLEVALSGLSSKTAKDILSFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPNDPTAAAHTTFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKRNKHIP 452          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: ENSORLT00000008692.2 (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101159863])

HSP 1 Score: 308.145 bits (788), Expect = 1.959e-97
Identity = 184/436 (42.20%), Postives = 276/436 (63.30%), Query Frame = 2
Query:   41 ANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNS----CNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + ++++N GG+RHETY++TLK +P TRLS LTE  A    +YDP L+E+FFDRHP VF  ILNYYR GKLH PNDVCGPLFEEEL FWG+D   VE CCWM Y  HR+ +E +   +          D  L G  G  ++            W+ ++PR+W + E+PYSS  A+ ++ +S+ FI++SI+ FC++T    NT+   N + ++ + N + E  +    +     +  ++ +C I+FT+E++ R+   P+ + F +S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   D       +   F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:    7 SEKIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKLDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEP-DAPDDDPALGGADGDLKRLCMQEDARRAGWWKTWQPRIWALFEDPYSSKYARYVAFMSLFFILISISTFCMETHEAFNTI--YNKTENVTIGNVTREEIV--YEVVTDSWLTYVEGVCVIWFTIEVLLRVTFCPDKLEFFKSALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 437          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: ENSORLT00000039227.1 (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101159863])

HSP 1 Score: 308.916 bits (790), Expect = 3.226e-97
Identity = 184/436 (42.20%), Postives = 276/436 (63.30%), Query Frame = 2
Query:   41 ANRVILNVGGIRHETYKATLKKIPATRLSRLTEALA----NYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNS----CNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNV--YIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYD-------SLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQA 1297
            + ++++N GG+RHETY++TLK +P TRLS LTE  A    +YDP L+E+FFDRHP VF  ILNYYR GKLH PNDVCGPLFEEEL FWG+D   VE CCWM Y  HR+ +E +   +          D  L G  G  ++            W+ ++PR+W + E+PYSS  A+ ++ +S+ FI++SI+ FC++T    NT+   N + ++ + N + E  +    +     +  ++ +C I+FT+E++ R+   P+ + F +S LNIID ++++ FY +   +  SS+   +V  ++  +  +R++R+FKLTRH  GL++L  T +AS  E  LL+ FL + +++FA +IYYAER   D       +   F +I +G WWA+VTMTT+GYGD  P + +GM+VGALCA+ GVLTI++PVPVIV+NF  +YS   A
Sbjct:   35 SEKIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKLDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEP-DAPDDDPALGGADGDLKRLCMQEDARRAGWWKTWQPRIWALFEDPYSSKYARYVAFMSLFFILISISTFCMETHEAFNTI--YNKTENVTIGNVTREEIV--YEVVTDSWLTYVEGVCVIWFTIEVLLRVTFCPDKLEFFKSALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 465          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000059794.1 (SMESG000059794.1)

HSP 1 Score: 969.533 bits (2505), Expect = 0.000e+0
Identity = 544/544 (100.00%), Postives = 544/544 (100.00%), Query Frame = 2
Query:   29 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGGLTYQEMIAXXXXXXXXXXXXXAIAPRDKASTDEIKPAVANGLESSNELPLAISNQEQNPMKDFKNSSRAVGRKSINFIHSNNDNNIKHGALPNAVL 1660
            MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYSSLSAKILSSLSVIFIILSIAIFCIKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMSFYFDFAFASSSSQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSLLVFFLVVFIVLFAALIYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGGLTYQEMIAVHNVVNNYRRRHNAIAPRDKASTDEIKPAVANGLESSNELPLAISNQEQNPMKDFKNSSRAVGRKSINFIHSNNDNNIKHGALPNAVL
Sbjct:    1 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYSSLSAKILSSLSVIFIILSIAIFCIKTVPGINTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMSFYFDFAFASSSSQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSLLVFFLVVFIVLFAALIYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGGLTYQEMIAVHNVVNNYRRRHNAIAPRDKASTDEIKPAVANGLESSNELPLAISNQEQNPMKDFKNSSRAVGRKSINFIHSNNDNNIKHGALPNAVL 544          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000039493.1 (SMESG000039493.1)

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 296/449 (65.92%), Postives = 366/449 (81.51%), Query Frame = 2
Query:   29 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPG--INTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTG 1369
            M DS NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHPHVF QILNYYR GKLHYP DVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHR+T++T+ +LD L+LD+ +   E LY KFG+ E  +N S   WQ+ RP+LWQ++EE YSS ++K+++  S+ FI++SI  FC+K++PG  I  ++  N +++ + T  +   S  P+     ++   IDA+CN++FT EL+ RL ++  +  FIQSPLNIID  +L+SFY +F+F  S   +  N   +F S+IRLMRVFKLTR+ISGLKIL++TFKASAKELSLLVFFL+VFIV+FAAL+YYAERF  +  NKFDSII+GLWWAI+TMTTVG+GD+ P + +GM++GALCAVTGVLT+SLPVPVIVSNFS FYSHTQARSKLPK+RRRVLP+E++RPKTK G
Sbjct:   96 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSW--WQRNRPKLWQLMEESYSSRASKVITGFSITFIVVSIISFCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPI---AHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSLLVFFLIVFIVIFAALVYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPG 539          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000039493.1 (SMESG000039493.1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 296/449 (65.92%), Postives = 366/449 (81.51%), Query Frame = 2
Query:   29 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPG--INTVTFKNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTG 1369
            M DS NRV+LNVGGIRHETYKATLKKIPATRLSRLTEALANYDP LNEYFFDRHPHVF QILNYYR GKLHYP DVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHR+T++T+ +LD L+LD+ +   E LY KFG+ E  +N S   WQ+ RP+LWQ++EE YSS ++K+++  S+ FI++SI  FC+K++PG  I  ++  N +++ + T  +   S  P+     ++   IDA+CN++FT EL+ RL ++  +  FIQSPLNIID  +L+SFY +F+F  S   +  N   +F S+IRLMRVFKLTR+ISGLKIL++TFKASAKELSLLVFFL+VFIV+FAAL+YYAERF  +  NKFDSII+GLWWAI+TMTTVG+GD+ P + +GM++GALCAVTGVLT+SLPVPVIVSNFS FYSHTQARSKLPK+RRRVLP+E++RPKTK G
Sbjct:    1 MCDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPALNEYFFDRHPHVFSQILNYYRVGKLHYPMDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRSTEDTLRILDALDLDSIRSKPEDLYRKFGILEDDMNLSW--WQRNRPKLWQLMEESYSSRASKVITGFSITFIVVSIISFCLKSIPGFQIQNISLVNATFTPNETTVNYFTSAAPI---AHRAFIYIDAVCNVFFTFELLIRLAVTTRLSNFIQSPLNIIDLFALISFYLEFSFYVSVHPINNNAVFQFFSVIRLMRVFKLTRYISGLKILVVTFKASAKELSLLVFFLIVFIVIFAALVYYAERFNSNPENKFDSIIIGLWWAIITMTTVGFGDYVPVTNSGMLIGALCAVTGVLTVSLPVPVIVSNFSMFYSHTQARSKLPKERRRVLPIESIRPKTKPG 444          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000013590.1 (SMESG000013590.1)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 291/448 (64.96%), Postives = 364/448 (81.25%), Query Frame = 2
Query:   29 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNSSSEWSL---DPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTK 1363
            MTD+ NRV+LNVGGIRHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHP+VF QILNYYR GKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYT+HR+TQ+ + +LDK+++D+DKMS+E LY KFGL +++ +N  +IWQ+ +P+LWQ +EEPYSS  AKIL  +SV FII+S+  FC+K+VP +          S+++T SS+ W++   D +      +   ++ +CN YFT+ELI RLF +P+I  F +SP+N+ID  +L SFY        +S +++N+Y+E  +++RL R+FKLTRHISGLKILILTF+AS KEL LL+FFL VFIV+FAA IYYAER   +   +F SII GLWW+++TMTTVGYGD++P S+ GM+VGALCAVTGVLTISLP+PVIVSNFS FYSHTQAR+KLPK+RRRVLPVEAVRPK K
Sbjct:    1 MTDAGNRVVLNVGGIRHETYKATLKKIPATRLSKLTEALANYDPILNEYFFDRHPNVFSQILNYYRTGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTLHRSTQDILTILDKVDIDSDKMSEEDLYKKFGLLDRFQDNEMSIWQRNQPKLWQTMEEPYSSQLAKILGYISVFFIIISLIAFCLKSVPVLKVANI----VSVNIT-SSNTWAITAKDGVGPDPYIAFLYVELICNSYFTIELIVRLFATPSIFAFFKSPINLIDIFALFSFYLYLVLYYLNSPVRFNIYLETFNVVRLFRIFKLTRHISGLKILILTFQASMKELILLMFFLFVFIVVFAAFIYYAERLDSNIDTQFMSIIDGLWWSLITMTTVGYGDYSPRSLPGMLVGALCAVTGVLTISLPIPVIVSNFSMFYSHTQARAKLPKQRRRVLPVEAVRPKGK 443          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000054802.1 (SMESG000054802.1)

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 293/446 (65.70%), Postives = 355/446 (79.60%), Query Frame = 2
Query:   29 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYXXXXXXXXXXXXXXXXXXXXXXXXXKTVPGINTVTFKNYSYSIDLTNS-SSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMXXXXXXXXXXXXXQLQYNVYIEFLSIIRLMRVFKLTRHISGLKILILTFKASAKELSXXXXXXXXXXXXXXXXXYYAERFKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGVLTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTK 1363
            MTD+ NRVILNVGGIRHETYKATLKKIPATRLS+LTEALANYDP+LNEYFFDRHP VF QILNYYR GKLHYP DVCGPLFEEEL+FWGLDSNQVEPCCWMTYT HR+TQ+T+ +LD++++D ++ S+  LY +FGL E++ +N  + WQK+RPR+W +LEEPYSS+ AK++S + +  I++SI  FC+KT PG +     N++Y++ +       WSL    IQ     F  + +CN +F++ELI R+ ++ +  +F    LNIID  +L+SFY D +F   + +  +   IEF+SI+R+MR+FKLTRHISGLKILILTFKASAKELSLLVFFLVVFI +FAALIYYAE+F  + LN F SI  GLWWAI TMTTVGYGD  P +  GM+VGALCAVTGVLTISLPVPVIVSNFS FYSHTQARSKLPKKRRRVLPVEAVRPK K
Sbjct:    1 MTDAENRVILNVGGIRHETYKATLKKIPATRLSKLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRSTQDTLQILDRIDIDTERTSESELYKRFGLEEEFEDNELSFWQKWRPRIWSVLEEPYSSVLAKLVSGIGISIILISIISFCMKTYPGYSIPLILNHTYNVSIGGDLFQSWSLSQKEIQPHTVFFYTECICNAWFSIELILRMIVTASCRSFFHDVLNIIDIFALLSFYIDVSFVYFNIEKSH--LIEFMSILRIMRLFKLTRHISGLKILILTFKASAKELSLLVFFLVVFIAVFAALIYYAEKFTKNELNDFTSIPNGLWWAICTMTTVGYGDMVPKTYPGMLVGALCAVTGVLTISLPVPVIVSNFSMFYSHTQARSKLPKKRRRVLPVEAVRPKFK 444          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC11.179e-9740.31potassium voltage-gated channel subfamily C member... [more]
KCNC17.990e-9740.31potassium voltage-gated channel subfamily C member... [more]
KCNC42.670e-8938.79potassium voltage-gated channel subfamily C member... [more]
KCNC43.278e-8938.79potassium voltage-gated channel subfamily C member... [more]
KCNC43.766e-8938.79potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shw-12.986e-15554.76SHaW family of potassium channels [Source:UniProt... [more]
shw-15.186e-15555.02SHaW family of potassium channels [Source:UniProt... [more]
shw-11.272e-15454.80SHaW family of potassium channels [Source:UniProt... [more]
shw-13.151e-15454.80SHaW family of potassium channels [Source:UniProt... [more]
shw-13.867e-15455.07SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shaw4.552e-17663.33gene:FBgn0003386 transcript:FBtr0089274[more]
Shaw7.482e-17663.33gene:FBgn0003386 transcript:FBtr0332184[more]
Shaw1.034e-17563.33gene:FBgn0003386 transcript:FBtr0332185[more]
Shaw1.419e-17563.33gene:FBgn0003386 transcript:FBtr0089275[more]
Shaw2.193e-17563.33gene:FBgn0003386 transcript:FBtr0289989[more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc21.238e-9841.61potassium voltage-gated channel, Shaw-related subf... [more]
kcnc22.970e-9841.61potassium voltage-gated channel, Shaw-related subf... [more]
kcnc44.679e-9840.36potassium voltage-gated channel, Shaw-related subf... [more]
kcnc3b4.970e-9842.56potassium voltage-gated channel, Shaw-related subf... [more]
kcnc46.211e-9840.36potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC25.187e-10139.71potassium channel, voltage gated Shaw related subf... [more]
KCNC21.358e-10039.71potassium channel, voltage gated Shaw related subf... [more]
tamm416.128e-9541.65TAM41 mitochondrial translocator assembly and main... [more]
tamm417.919e-9541.65TAM41 mitochondrial translocator assembly and main... [more]
tamm419.914e-9541.65TAM41 mitochondrial translocator assembly and main... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnc19.403e-9840.31potassium voltage gated channel, Shaw-related subf... [more]
Kcnc15.544e-9740.31potassium voltage gated channel, Shaw-related subf... [more]
Kcnc31.284e-9138.66potassium voltage gated channel, Shaw-related subf... [more]
Kcnc31.355e-9138.66potassium voltage gated channel, Shaw-related subf... [more]
Kcnc31.880e-9138.66potassium voltage gated channel, Shaw-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17972|KCNAW_DROME4.563e-17563.33Potassium voltage-gated channel protein Shaw OS=Dr... [more]
sp|G5EFC3|KCNAG_CAEEL7.646e-14253.32Potassium voltage-gated channel protein egl-36 OS=... [more]
sp|P48547|KCNC1_HUMAN5.663e-9740.31Potassium voltage-gated channel subfamily C member... [more]
sp|P15388|KCNC1_MOUSE6.577e-9740.31Potassium voltage-gated channel subfamily C member... [more]
sp|P25122|KCNC1_RAT3.878e-9640.31Potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GF750.000e+066.22BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267FE930.000e+067.11BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267EKG70.000e+066.89BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A267FAP80.000e+066.89BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8FX170.000e+066.89BTB domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048024.13.177e-9841.97potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000049045.16.840e-9841.97potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000012289.27.790e-9841.97potassium voltage-gated channel subfamily C member... [more]
ENSAMXT00000031881.11.193e-9741.97potassium voltage-gated channel subfamily C member... [more]
kcnc3a3.747e-9641.74potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a6.689e-10242.47potassium voltage-gated channel, Shaw-related subf... [more]
ENSPMAT00000004235.12.202e-6935.15pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
kcna1b7.528e-5836.99potassium voltage-gated channel, shaker-related su... [more]
kcna1b5.391e-5736.75potassium voltage-gated channel, shaker-related su... [more]
kcna1b8.303e-5736.75potassium voltage-gated channel, shaker-related su... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398043.223e-10543.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427243.966e-10345.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382372.896e-8940.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451724.062e-8340.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480661.285e-8241.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1b8.285e-10340.26potassium voltage-gated channel subfamily C member... [more]
kcnc1b1.008e-10240.26potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000045623.14.348e-10243.08potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000008692.21.959e-9742.20potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000039227.13.226e-9742.20potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059794.10.000e+0100.00SMESG000059794.1[more]
SMESG000039493.10.000e+065.92SMESG000039493.1[more]
SMESG000039493.10.000e+065.92SMESG000039493.1[more]
SMESG000013590.10.000e+064.96SMESG000013590.1[more]
SMESG000054802.10.000e+065.70SMESG000054802.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008719 ID=SMED30008719|Name=Potassium voltage-gated channel protein Shaw|organism=Schmidtea mediterranea sexual|type=transcript|length=1696bp
AAGATCCTAGAATCGAACACCTAAATCAATGACAGATTCTGCAAATCGAG
TGATTTTAAATGTCGGAGGAATTCGACACGAAACGTACAAAGCTACATTG
AAAAAAATCCCAGCAACTAGACTTTCCCGTTTAACGGAAGCATTGGCCAA
TTATGATCCGGTTTTAAATGAATATTTTTTCGACCGACATCCCCATGTTT
TTGGGCAAATTCTGAACTATTATCGAGCCGGTAAGCTTCATTACCCAAAT
GATGTCTGTGGGCCTCTGTTTGAAGAAGAATTAGACTTTTGGGGTCTTGA
TTCAAATCAAGTTGAACCTTGCTGTTGGATGACTTATACAATACATCGAA
ATACTCAAGAGACAATGGCAATGCTAGATAAGCTTAATCTTGATGCCGAT
AAAATGTCTGACGAAACTCTATATGGAAAATTTGGATTGTATGAGAAATA
TCTAAACAATTCTTGTAATATTTGGCAAAAGTATCGACCAAGACTTTGGC
AAATGCTTGAAGAGCCTTACTCGTCACTATCAGCCAAAATTCTATCGAGC
CTTTCGGTCATATTCATAATCTTGTCCATCGCCATTTTCTGTATCAAAAC
AGTGCCTGGGATTAACACAGTAACCTTCAAAAACTATTCTTACAGCATTG
ACTTAACAAACTCATCCAGTGAATGGTCCTTAGATCCTTTGAACATTCAA
AAATCCCAATCAATTTTCATCATTGATGCACTCTGTAATATCTATTTCAC
CGTAGAACTGATCACTCGCCTATTCATCAGTCCGAACATTGTCACATTCA
TCCAATCGCCACTGAATATCATTGACACTTTGTCTCTAATGAGTTTCTAT
TTTGATTTCGCGTTCGCCTCATCAAGCAGTCAACTTCAATACAATGTCTA
TATTGAATTTTTGAGTATAATTCGCCTTATGCGAGTTTTTAAATTAACTC
GACACATATCCGGATTGAAGATTTTGATACTCACTTTCAAAGCAAGCGCA
AAGGAATTATCATTATTGGTTTTCTTTTTGGTAGTCTTCATTGTACTTTT
TGCTGCACTGATCTATTATGCGGAAAGATTTAAATATGATTCCTTAAATA
AGTTCGATTCAATTATTGTTGGACTTTGGTGGGCCATTGTTACTATGACA
ACTGTTGGTTATGGGGATTTTGCTCCAACTTCGGTGGCAGGTATGATAGT
TGGGGCGTTGTGTGCTGTGACTGGAGTACTGACAATCTCATTACCGGTTC
CTGTGATTGTGAGCAATTTTTCAACATTTTACTCTCACACTCAGGCCCGA
TCAAAGTTGCCTAAGAAACGAAGAAGAGTTTTGCCGGTTGAGGCTGTCAG
GCCGAAAACTAAAACTGGTGGTCTCACGTATCAGGAAATGATAGCCGTTC
ACAACGTGGTCAACAATTACCGGCGACGACACAACGCTATTGCTCCCCGT
GATAAGGCCAGTACAGATGAAATCAAACCAGCTGTTGCAAATGGATTAGA
ATCATCGAATGAACTTCCGCTAGCCATTTCAAATCAAGAACAAAATCCAA
TGAAAGATTTTAAAAATTCATCAAGAGCAGTTGGTAGGAAGTCAATTAAT
TTTATTCATTCAAACAACGACAACAACATCAAACACGGAGCACTACCAAA
TGCAGTATTATAATCATCAGTTTATAATATTCAGCTTCAAATTGAT
back to top

protein sequence of SMED30008719-orf-1

>SMED30008719-orf-1 ID=SMED30008719-orf-1|Name=SMED30008719-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=545bp
MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYF
FDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWGLDSNQVEPCCW
MTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQ
KYRPRLWQMLEEPYSSLSAKILSSLSVIFIILSIAIFCIKTVPGINTVTF
KNYSYSIDLTNSSSEWSLDPLNIQKSQSIFIIDALCNIYFTVELITRLFI
SPNIVTFIQSPLNIIDTLSLMSFYFDFAFASSSSQLQYNVYIEFLSIIRL
MRVFKLTRHISGLKILILTFKASAKELSLLVFFLVVFIVLFAALIYYAER
FKYDSLNKFDSIIVGLWWAIVTMTTVGYGDFAPTSVAGMIVGALCAVTGV
LTISLPVPVIVSNFSTFYSHTQARSKLPKKRRRVLPVEAVRPKTKTGGLT
YQEMIAVHNVVNNYRRRHNAIAPRDKASTDEIKPAVANGLESSNELPLAI
SNQEQNPMKDFKNSSRAVGRKSINFIHSNNDNNIKHGALPNAVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR015572Shaw_inv
IPR003968K_chnl_volt-dep_Kv
IPR028325VG_K_chnl
IPR003974K_chnl_volt-dep_Kv3
IPR000210BTB/POZ_dom
IPR003131T1-type_BTB
IPR005821Ion_trans_dom
IPR027359Volt_channel_dom_sf
IPR011333SKP1/BTB/POZ_sf
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0051260protein homooligomerization
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003974Potassium channel, voltage dependent, Kv3PRINTSPR01498SHAWCHANNELcoord: 161..173
score: 48.29
coord: 50..63
score: 72.62
coord: 65..80
score: 83.33
coord: 425..439
score: 59.63
coord: 83..104
score: 79.55
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 400..411
score: 78.06
coord: 49..59
score: 71.59
coord: 327..341
score: 47.78
coord: 303..311
score: 62.87
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 164..192
score: 40.21
coord: 327..350
score: 49.44
coord: 298..324
score: 50.71
coord: 232..255
score: 36.04
coord: 360..382
score: 65.84
coord: 258..278
score: 32.79
coord: 389..415
score: 66.74
coord: 49..68
score: 59.59
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 311..423
e-value: 7.2E-29
score: 101.7
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 3..117
e-value: 3.4E-51
score: 174.2
NoneNo IPR availableCDDcd18416BTB_Shaw-likecoord: 7..117
e-value: 4.08493E-83
score: 252.19
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 170..416
NoneNo IPR availableTMHMMTMhelixcoord: 230..252
NoneNo IPR availableTMHMMTMhelixcoord: 330..349
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 390..412
NoneNo IPR availableTMHMMTMhelixcoord: 364..383
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 7..107
e-value: 8.5E-13
score: 58.5
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 9..99
e-value: 2.5E-28
score: 98.2
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 143..310
e-value: 1.4E-39
score: 137.2
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 171..422
e-value: 1.7E-33
score: 115.8
IPR015572Potassium channel, voltage dependent, Shaw, invertebratePANTHERPTHR11537:SF257POTASSIUM VOLTAGE-GATED CHANNEL PROTEIN SHAWcoord: 4..450
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 4..450
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 7..107