SMED30008716

Overview
NameSMED30008716
Smed IDSMED30008716
Length (bp)2274
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30008716 (SMED30008716) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30008716 (SMED30008716) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30008716 (SMED30008716) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30008716 (SMED30008716) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008716

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008716SMESG000057434.1 Contig3389GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008716SMESG000020938.1 SMESG000020939.1 Contig3389GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30008716SMESG000020939.1 SmedASXL_012033SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30008716SMESG000020939.1 SMESG000020938.1 dd_Smed_v4_2743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008716SMESG000020939.1 SMESG000020938.1 dd_Smed_v4_2743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30008716 vs. Ensembl Human
Match: SHOC2 (SHOC2 leucine rich repeat scaffold protein [Source:HGNC Symbol;Acc:HGNC:15454])

HSP 1 Score: 214.927 bits (546), Expect = 4.295e-60
Identity = 167/451 (37.03%), Postives = 262/451 (58.09%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LTELY+Y NK+  LP E+G L+NL  L + EN + SLP  + + K L+ LD+RHN L +   +V        + L  +   T    I  L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N++++LP+TIGNL  L  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P +++    ++    ++ N F   P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+S L  LE L L+NNLL  LP  +G L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  125 LTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIK-QLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 573          

HSP 2 Score: 68.5514 bits (166), Expect = 2.366e-11
Identity = 92/318 (28.93%), Postives = 154/318 (48.43%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFP-SCIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            LDLSK  I I+P+ + E T+L  L    NK+  LP  +G L  L  + +  N L  +P+SL +   L+ L++  N + EIPS +V +   +    +  N+   + K   + S K+   +   N I ++   +    +L  L++ +N L  L   +I N   + +L+L  N L DLP  I  LS L  L L  N L+ +P+ +     L+ LNLE+N +  +P+     L KL +L ++ N  + +P     +   +  LN+  N   ++P  I +    L+ L +KDN  L +LP+      ++  L+L    L  IP
Sbjct:  105 LDLSKRSIHILPSSIKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPS-VVYRLDSLTTLYLRFNRITTVEKDIKNLS-KLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPK-EIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-QLTSLPLDFGTWTSMVELNLATNQLTKIP 418          
BLAST of SMED30008716 vs. Ensembl Human
Match: SHOC2 (SHOC2 leucine rich repeat scaffold protein [Source:HGNC Symbol;Acc:HGNC:15454])

HSP 1 Score: 177.178 bits (448), Expect = 4.994e-47
Identity = 156/451 (34.59%), Postives = 231/451 (51.22%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LTELY+Y NK+  LP E+G L+NL  L + EN + SLP                                              D +  LKKL  L ++ NKL   +   + +L  + TL L  NRI  +  ++   +KL  L+   NKI +LP  IGNL  L  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P +++    ++    ++ N F   P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+S L  LE L L+NNLL  LP  +G L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  125 LTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLP----------------------------------------------DSLDNLKKLRMLDLRHNKLR-EIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 527          
BLAST of SMED30008716 vs. Ensembl Human
Match: SHOC2 (SHOC2 leucine rich repeat scaffold protein [Source:HGNC Symbol;Acc:HGNC:15454])

HSP 1 Score: 152.91 bits (385), Expect = 6.086e-40
Identity = 134/362 (37.02%), Postives = 202/362 (55.80%), Query Frame = 3
Query:  741 LKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LKKL  L ++ NKL   +   + +L  + TL L  NRI  +  ++   +KL  L+   NKI +LP  IGNL  L  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P +++    ++    ++ N F   P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+S L  LE L L+NNLL  LP  +G L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:    4 LKKLRMLDLRHNKLR-EIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 363          

HSP 2 Score: 60.4622 bits (145), Expect = 4.830e-9
Identity = 62/227 (27.31%), Postives = 121/227 (53.30%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTR--LDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPK 1148
            L+ L I  NKI +LP EIGNL +L  L ++ N + ++P  +  C  L+ L++ +N+++     +L+SLV L  L +  N F    + G  +   + +L ++ N++         +   +  L++  N++  +P + G  T +  LN   N++ ++PE +  L  LE + +  N L+K+P  L +   L+EL++E N +E +P+ I    + + K  +++N+   LP+
Sbjct:   53 LSMLSIRENKIKQLPAEIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIA-YLKDLQKLVLTNNQLTTLPR 278          

HSP 3 Score: 60.077 bits (144), Expect = 6.469e-9
Identity = 82/308 (26.62%), Postives = 135/308 (43.83%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTK-LKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLE 1388
            +LT LY+  N+I+ + K+I NL  L  L ++EN I  LP E+ +   L  L +R+N L+     +        + L  +N  T  +  +  L KL +LT+  N  +        +   + +L++  NRI  IP  +    K L +LN + N++  LP   G    +  + +  NQL KIPE +S    L+ L                         +S+N    LP    +   K+ + + E N +  +   +   + L+ L L  N L+ L    I +L  L  L L  N L+ LP++I  L +LE
Sbjct:   29 SLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPAEIGNLSSLSRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLI------------------------LSNNLLKKLPHGLGNLR-KLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPR-GIGHLTNLTHLGLGENLLTHLPEEIGTLENLE 310          
BLAST of SMED30008716 vs. Ensembl Human
Match: ERBIN (erbb2 interacting protein [Source:HGNC Symbol;Acc:HGNC:15842])

HSP 1 Score: 105.916 bits (263), Expect = 1.058e-22
Identity = 123/430 (28.60%), Postives = 200/430 (46.51%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL--DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            Q+L +L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK+L  ++   N      L    S +     L  ++ F        GRL KL+ L ++ N+L+  L K++ +L  +  LDL  N    +P  L + + LK    + N++  +P  IG+LK+L ++ +  N +E + E +S C  L++L                         +S N    LP     E+I                GS+ N  +LK+     N L  L    I  L+ + +L+ +FN +  LP  I +L++L +    +N L  LP EIG  KN+  L L SN L  +P+E  +++KLK +N+S N+LK  P    KL+ L  + +S+N    L     E D  T   +  N +    P T    +++ F+S N
Sbjct:   69 QSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVN--PISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLK-MLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFIPGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLL------------------------LSSNSLQQLP-----ETI----------------GSLKNITTLKI---DENQLMYLPD-SIGGLISVEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDSETQKMVLTNYMFPQQPRT----EDVMFISDN 442          

HSP 2 Score: 85.1149 bits (209), Expect = 3.701e-16
Identity = 99/352 (28.12%), Postives = 167/352 (47.44%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNI---SHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            K LE L +  N++E  L K L     +  L L  N +  +P  +     L+ L+   N I E PE I N K L  +    N + K+P+  S    L +L +    +E +P+     F ++ K  I     N+   LPK  N  + ++E+ +   N  + +   +     LK   +  N L+ +    I +L  L  L+++ N++  + + IS   +L+ L L++N L  LP+ IG LKN+  L ++ N L+ +PD    L  ++ L+ S N+++  PS I +L NL       N+  +LP  I     +T LFL  N  L TLP  +  M+ L  ++L+   L ++P  + K
Sbjct:   46 KTLEELYLDANQIE-ELPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPA----NFGRLTKLQILELRENQLKMLPKTMNRLT-QLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFIPGF-IGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITTLKIDENQLMYLPDSIGGLISVEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVLFLHSN-KLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTK 389          
BLAST of SMED30008716 vs. Ensembl Human
Match: ERBIN (erbb2 interacting protein [Source:HGNC Symbol;Acc:HGNC:15842])

HSP 1 Score: 105.916 bits (263), Expect = 1.107e-22
Identity = 120/417 (28.78%), Postives = 193/417 (46.28%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL--DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVT 1712
            Q+L +L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK+L  ++   N      L    S +     L  ++ F        GRL KL+ L ++ N+L+  L K++ +L  +  LDL  N    +P  L + + LK    + N++  +P  IG+LK+L ++ +  N +E + E +S C  L++L                         +S N    LP     E+I                GS+ N  +LK+     N L  L    I  L+ + +L+ +FN +  LP  I +L++L +    +N L  LP EIG  KN+  L L SN L  +P+E  +++KLK +N+S N+LK  P    KL+ L  + +S+N    L     E D  T   +  N +    P T
Sbjct:   69 QSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVN--PISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLK-MLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFIPGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLL------------------------LSSNSLQQLP-----ETI----------------GSLKNITTLKI---DENQLMYLPD-SIGGLISVEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDSETQKMVLTNYMFPQQPRT 433          

HSP 2 Score: 85.1149 bits (209), Expect = 3.502e-16
Identity = 99/352 (28.12%), Postives = 167/352 (47.44%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNI---SHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            K LE L +  N++E  L K L     +  L L  N +  +P  +     L+ L+   N I E PE I N K L  +    N + K+P+  S    L +L +    +E +P+     F ++ K  I     N+   LPK  N  + ++E+ +   N  + +   +     LK   +  N L+ +    I +L  L  L+++ N++  + + IS   +L+ L L++N L  LP+ IG LKN+  L ++ N L+ +PD    L  ++ L+ S N+++  PS I +L NL       N+  +LP  I     +T LFL  N  L TLP  +  M+ L  ++L+   L ++P  + K
Sbjct:   46 KTLEELYLDANQIE-ELPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPA----NFGRLTKLQILELRENQLKMLPKTMNRLT-QLERLDLGSNEFTEVPEVLEQLSGLKEFWMDANRLTFIPGF-IGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITTLKIDENQLMYLPDSIGGLISVEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVLFLHSN-KLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTK 389          
BLAST of SMED30008716 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 212.231 bits (539), Expect = 6.798e-60
Identity = 170/452 (37.61%), Postives = 252/452 (55.75%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD-GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            LTEL++Y NK++ LP EIG L+NLK+L + EN + SLP  + S + L+ LD+RHN LT+   ++        + L  +N+   +D  IG L KL+ L V+ NK+   L  ++GKL  +V   +S N +  +P E+G+C  L +L+ ++N + ELP +IG L  L  IGI+YN++  IP  L  C  L+E  +ESN ++ +P  ++    ++   N+S N+    P     + +     N E+N IS+I  G    A  L  LNL  N L  L  LD+ +   + +LNL+ N L  LP+DI +L +LE L L+NN L  LP +IG L  L+ L+LE N L  +P E   L+ L  L + SN++ T P  I  L +L+ L + EN    +P+ I  LD L  L+L DN  L+ LP  LA  ++L  +S+   PL  IP E     P  VI YLK
Sbjct:   88 LTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLR-YNRIVAVDEQIGNLSKLKMLDVRENKIR-ELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSL-PLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEITAGGPSLVIQYLK 536          

HSP 2 Score: 82.0333 bits (201), Expect = 4.934e-16
Identity = 86/305 (28.20%), Postives = 158/305 (51.80%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTV--KGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVC--LIDLNLAFNHLSDLPKDIS 1370
             +LT+L +  N +S+LP  IG L+NL  + ++ N I  +P E++SC+ L+   +  NHL      +LT L  +  + ++ N+ T     G  + + T+T+  + N++         K   +  L+L +N +V +P ++G  T +  LN   N++  LPE I  L  LE + +  NQL+K+P  + +   L+EL++E N +E +P+ I    Q + K  +  NK + LP+   +    ++      NN++ I   + +  SLK L L  N+ S L +L  +  +C  L  +++  + LS +P +I+
Sbjct:  224 HSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGF-LQHLTKLWVQSNKILTLPRSIGN-LCSLQDLRLGENNLTAIPEEIGHLDSLKSLYL--NDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEIT 524          

HSP 3 Score: 80.8777 bits (198), Expect = 1.203e-15
Identity = 83/336 (24.70%), Postives = 161/336 (47.92%), Query Frame = 3
Query:  789 SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            S+   + +L  +  L L KN++  +P E+G+   LK+L    N +  LP+++ +L+ LE + +++N+L ++P  +   G L+ L +  N I  +   I     ++   ++  NK   LP      +  +      YN+++R+   + +  SL  L+L +N+LSEL    I  LV L+ + + +N +  +P ++     LE   + +N L  LP                      P+    L K+  +N+S N+L  FP+    +  +   +N+  N  +++P  I ++  RLT L LK+N L+ +LP+ +    ++  L+L+   L  +P +  K
Sbjct:   77 SIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIG-NLSKLKMLDVRENKIRELPSAIGKLTSLVVCL-VSYNHLTRVPEEIGDCHSLTQLDLQHNDLSEL-PYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLP----------------------PNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELV-SLPLDMGSWTSITELNLSTNQLKVLPEDIEK 386          
BLAST of SMED30008716 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 211.846 bits (538), Expect = 9.983e-60
Identity = 170/452 (37.61%), Postives = 252/452 (55.75%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD-GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            LTEL++Y NK++ LP EIG L+NLK+L + EN + SLP  + S + L+ LD+RHN LT+   ++        + L  +N+   +D  IG L KL+ L V+ NK+   L  ++GKL  +V   +S N +  +P E+G+C  L +L+ ++N + ELP +IG L  L  IGI+YN++  IP  L  C  L+E  +ESN ++ +P  ++    ++   N+S N+    P     + +     N E+N IS+I  G    A  L  LNL  N L  L  LD+ +   + +LNL+ N L  LP+DI +L +LE L L+NN L  LP +IG L  L+ L+LE N L  +P E   L+ L  L + SN++ T P  I  L +L+ L + EN    +P+ I  LD L  L+L DN  L+ LP  LA  ++L  +S+   PL  IP E     P  VI YLK
Sbjct:   97 LTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLR-YNRIVAVDEQIGNLSKLKMLDVRENKIR-ELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSL-PLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEITAGGPSLVIQYLK 545          

HSP 2 Score: 82.0333 bits (201), Expect = 6.516e-16
Identity = 86/305 (28.20%), Postives = 158/305 (51.80%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTV--KGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVC--LIDLNLAFNHLSDLPKDIS 1370
             +LT+L +  N +S+LP  IG L+NL  + ++ N I  +P E++SC+ L+   +  NHL      +LT L  +  + ++ N+ T     G  + + T+T+  + N++         K   +  L+L +N +V +P ++G  T +  LN   N++  LPE I  L  LE + +  NQL+K+P  + +   L+EL++E N +E +P+ I    Q + K  +  NK + LP+   +    ++      NN++ I   + +  SLK L L  N+ S L +L  +  +C  L  +++  + LS +P +I+
Sbjct:  233 HSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGF-LQHLTKLWVQSNKILTLPRSIGN-LCSLQDLRLGENNLTAIPEEIGHLDSLKSLYL--NDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEIT 533          

HSP 3 Score: 80.8777 bits (198), Expect = 1.321e-15
Identity = 83/336 (24.70%), Postives = 161/336 (47.92%), Query Frame = 3
Query:  789 SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            S+   + +L  +  L L KN++  +P E+G+   LK+L    N +  LP+++ +L+ LE + +++N+L ++P  +   G L+ L +  N I  +   I     ++   ++  NK   LP      +  +      YN+++R+   + +  SL  L+L +N+LSEL    I  LV L+ + + +N +  +P ++     LE   + +N L  LP                      P+    L K+  +N+S N+L  FP+    +  +   +N+  N  +++P  I ++  RLT L LK+N L+ +LP+ +    ++  L+L+   L  +P +  K
Sbjct:   86 SIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIG-NLSKLKMLDVRENKIRELPSAIGKLTSLVVCL-VSYNHLTRVPEEIGDCHSLTQLDLQHNDLSEL-PYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLP----------------------PNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELV-SLPLDMGSWTSITELNLSTNQLKVLPEDIEK 395          
BLAST of SMED30008716 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 211.846 bits (538), Expect = 1.208e-59
Identity = 170/452 (37.61%), Postives = 252/452 (55.75%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD-GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            LTEL++Y NK++ LP EIG L+NLK+L + EN + SLP  + S + L+ LD+RHN LT+   ++        + L  +N+   +D  IG L KL+ L V+ NK+   L  ++GKL  +V   +S N +  +P E+G+C  L +L+ ++N + ELP +IG L  L  IGI+YN++  IP  L  C  L+E  +ESN ++ +P  ++    ++   N+S N+    P     + +     N E+N IS+I  G    A  L  LNL  N L  L  LD+ +   + +LNL+ N L  LP+DI +L +LE L L+NN L  LP +IG L  L+ L+LE N L  +P E   L+ L  L + SN++ T P  I  L +L+ L + EN    +P+ I  LD L  L+L DN  L+ LP  LA  ++L  +S+   PL  IP E     P  VI YLK
Sbjct:   98 LTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLR-YNRIVAVDEQIGNLSKLKMLDVRENKIR-ELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSL-PLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEITAGGPSLVIQYLK 546          

HSP 2 Score: 82.0333 bits (201), Expect = 5.299e-16
Identity = 86/305 (28.20%), Postives = 158/305 (51.80%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTV--KGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVC--LIDLNLAFNHLSDLPKDIS 1370
             +LT+L +  N +S+LP  IG L+NL  + ++ N I  +P E++SC+ L+   +  NHL      +LT L  +  + ++ N+ T     G  + + T+T+  + N++         K   +  L+L +N +V +P ++G  T +  LN   N++  LPE I  L  LE + +  NQL+K+P  + +   L+EL++E N +E +P+ I    Q + K  +  NK + LP+   +    ++      NN++ I   + +  SLK L L  N+ S L +L  +  +C  L  +++  + LS +P +I+
Sbjct:  234 HSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGF-LQHLTKLWVQSNKILTLPRSIGN-LCSLQDLRLGENNLTAIPEEIGHLDSLKSLYL--NDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEIT 534          

HSP 3 Score: 80.8777 bits (198), Expect = 1.433e-15
Identity = 85/342 (24.85%), Postives = 162/342 (47.37%), Query Frame = 3
Query:  789 SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNA------EYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            S+   + +L  +  L L KN++  +P E+G+   LK+L    N +  LP+++ +L+ LE + +++N+L ++P  +   G L+ L +  N I  +   I     ++   ++  NK   LP         I K  +       YN+++R+   + +  SL  L+L +N+LSEL    I  LV L+ + + +N +  +P ++     LE   + +N L  LP                      P+    L K+  +N+S N+L  FP+    +  +   +N+  N  +++P  I ++  RLT L LK+N L+ +LP+ +    ++  L+L+   L  +P +  K
Sbjct:   87 SIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIG-NLSKLKMLDVRENKIRELPS-------AIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSEL-PYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLP----------------------PNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELV-SLPLDMGSWTSITELNLSTNQLKVLPEDIEK 396          
BLAST of SMED30008716 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 211.846 bits (538), Expect = 1.208e-59
Identity = 170/452 (37.61%), Postives = 252/452 (55.75%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD-GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            LTEL++Y NK++ LP EIG L+NLK+L + EN + SLP  + S + L+ LD+RHN LT+   ++        + L  +N+   +D  IG L KL+ L V+ NK+   L  ++GKL  +V   +S N +  +P E+G+C  L +L+ ++N + ELP +IG L  L  IGI+YN++  IP  L  C  L+E  +ESN ++ +P  ++    ++   N+S N+    P     + +     N E+N IS+I  G    A  L  LNL  N L  L  LD+ +   + +LNL+ N L  LP+DI +L +LE L L+NN L  LP +IG L  L+ L+LE N L  +P E   L+ L  L + SN++ T P  I  L +L+ L + EN    +P+ I  LD L  L+L DN  L+ LP  LA  ++L  +S+   PL  IP E     P  VI YLK
Sbjct:   98 LTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLR-YNRIVAVDEQIGNLSKLKMLDVRENKIR-ELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSL-PLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEITAGGPSLVIQYLK 546          

HSP 2 Score: 82.0333 bits (201), Expect = 5.299e-16
Identity = 86/305 (28.20%), Postives = 158/305 (51.80%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTV--KGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVC--LIDLNLAFNHLSDLPKDIS 1370
             +LT+L +  N +S+LP  IG L+NL  + ++ N I  +P E++SC+ L+   +  NHL      +LT L  +  + ++ N+ T     G  + + T+T+  + N++         K   +  L+L +N +V +P ++G  T +  LN   N++  LPE I  L  LE + +  NQL+K+P  + +   L+EL++E N +E +P+ I    Q + K  +  NK + LP+   +    ++      NN++ I   + +  SLK L L  N+ S L +L  +  +C  L  +++  + LS +P +I+
Sbjct:  234 HSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGF-LQHLTKLWVQSNKILTLPRSIGN-LCSLQDLRLGENNLTAIPEEIGHLDSLKSLYL--NDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEIT 534          

HSP 3 Score: 80.8777 bits (198), Expect = 1.433e-15
Identity = 85/342 (24.85%), Postives = 162/342 (47.37%), Query Frame = 3
Query:  789 SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNA------EYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            S+   + +L  +  L L KN++  +P E+G+   LK+L    N +  LP+++ +L+ LE + +++N+L ++P  +   G L+ L +  N I  +   I     ++   ++  NK   LP         I K  +       YN+++R+   + +  SL  L+L +N+LSEL    I  LV L+ + + +N +  +P ++     LE   + +N L  LP                      P+    L K+  +N+S N+L  FP+    +  +   +N+  N  +++P  I ++  RLT L LK+N L+ +LP+ +    ++  L+L+   L  +P +  K
Sbjct:   87 SIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIG-NLSKLKMLDVRENKIRELPS-------AIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSEL-PYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLP----------------------PNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELV-SLPLDMGSWTSITELNLSTNQLKVLPEDIEK 396          
BLAST of SMED30008716 vs. Ensembl Celegans
Match: soc-2 (Leucine-rich repeat protein soc-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22875])

HSP 1 Score: 212.616 bits (540), Expect = 2.172e-59
Identity = 170/452 (37.61%), Postives = 252/452 (55.75%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD-GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            LTEL++Y NK++ LP EIG L+NLK+L + EN + SLP  + S + L+ LD+RHN LT+   ++        + L  +N+   +D  IG L KL+ L V+ NK+   L  ++GKL  +V   +S N +  +P E+G+C  L +L+ ++N + ELP +IG L  L  IGI+YN++  IP  L  C  L+E  +ESN ++ +P  ++    ++   N+S N+    P     + +     N E+N IS+I  G    A  L  LNL  N L  L  LD+ +   + +LNL+ N L  LP+DI +L +LE L L+NN L  LP +IG L  L+ L+LE N L  +P E   L+ L  L + SN++ T P  I  L +L+ L + EN    +P+ I  LD L  L+L DN  L+ LP  LA  ++L  +S+   PL  IP E     P  VI YLK
Sbjct:  170 LTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLR-YNRIVAVDEQIGNLSKLKMLDVRENKIR-ELPSAIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSL-PLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGFLQHLTKLWVQSNKILTLPRSIGNLCSLQDLRLGENNLTAIPEEIGHLDSLKSLYLNDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEITAGGPSLVIQYLK 618          

HSP 2 Score: 82.0333 bits (201), Expect = 6.713e-16
Identity = 86/305 (28.20%), Postives = 158/305 (51.80%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTV--KGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVC--LIDLNLAFNHLSDLPKDIS 1370
             +LT+L +  N +S+LP  IG L+NL  + ++ N I  +P E++SC+ L+   +  NHL      +LT L  +  + ++ N+ T     G  + + T+T+  + N++         K   +  L+L +N +V +P ++G  T +  LN   N++  LPE I  L  LE + +  NQL+K+P  + +   L+EL++E N +E +P+ I    Q + K  +  NK + LP+   +    ++      NN++ I   + +  SLK L L  N+ S L +L  +  +C  L  +++  + LS +P +I+
Sbjct:  306 HSLTQLDLQHNDLSELPYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLPPNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELVSLPLDMGSWTSITELNLSTNQLKVLPEDIEKLVNLEILVLSNNQLKKLPNQIGNLNKLRELDLEENELETVPTEIGF-LQHLTKLWVQSNKILTLPRSIGN-LCSLQDLRLGENNLTAIPEEIGHLDSLKSLYL--NDNSSLHNLPFELALCQSLEIMSIENSPLSQIPPEIT 606          

HSP 3 Score: 81.6481 bits (200), Expect = 9.413e-16
Identity = 85/342 (24.85%), Postives = 162/342 (47.37%), Query Frame = 3
Query:  789 SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNA------EYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            S+   + +L  +  L L KN++  +P E+G+   LK+L    N +  LP+++ +L+ LE + +++N+L ++P  +   G L+ L +  N I  +   I     ++   ++  NK   LP         I K  +       YN+++R+   + +  SL  L+L +N+LSEL    I  LV L+ + + +N +  +P ++     LE   + +N L  LP                      P+    L K+  +N+S N+L  FP+    +  +   +N+  N  +++P  I ++  RLT L LK+N L+ +LP+ +    ++  L+L+   L  +P +  K
Sbjct:  159 SIPSPIKELTQLTELFLYKNKLTCLPTEIGQLVNLKKLGLSENALTSLPDSLASLESLETLDLRHNKLTEVPSVIYKIGSLETLWLRYNRIVAVDEQIG-NLSKLKMLDVRENKIRELPS-------AIGKLTSLVVCLVSYNHLTRVPEEIGDCHSLTQLDLQHNDLSEL-PYSIGKLVNLVRIGIRYNKIRCIPSELESCQQLEEFIVESNHLQLLP----------------------PNLLTMLPKIHTVNLSRNELTAFPAGGPQQFVSTVTINMEHNQISKIPIGIFSKATRLTKLNLKENELV-SLPLDMGSWTSITELNLSTNQLKVLPEDIEK 468          
BLAST of SMED30008716 vs. Ensembl Fly
Match: Sur-8 (gene:FBgn0038504 transcript:FBtr0339532)

HSP 1 Score: 219.164 bits (557), Expect = 1.474e-61
Identity = 161/451 (35.70%), Postives = 258/451 (57.21%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            LTELY+Y NKI +LP EIG L++L+ L + EN + SLP  +++C  L+ LD+RHN L +   ++        + L  +      D + +L  L  L+++ NK+   L  ++G L  + TLD+S N +  +P ++G C  L  L+ ++N+++++P++IGNLK L  +G++YN+L  +P +L +C  + E N+E N I ++P  ++     +    +S N+F + P    ++   +   N E+N I +I  G    A+ L  LN+  N L+ L  LDI   V +++LNLA N L  LP DI  L +LE L L+NN+L  +P  IG L+ L+ L+LE N +  +P E   L +L+ L + +NQ+   P  I  L NL  L+VSEN    LP+ I  L+ L +L++  N  L  LP  LA  +NL +L+++ CPL  IP E +   P  V+ +LK
Sbjct:  185 LTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIR-ELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTAL-PLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLK 633          

HSP 2 Score: 83.5741 bits (205), Expect = 2.809e-16
Identity = 99/329 (30.09%), Postives = 159/329 (48.33%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI---------VLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE 1781
            LDLSK+ I +IP+ + EC  L  L    NKI +LP  IG L  L  + +  N L  +PESL +C  LK L++  N + EIP  I          L+F ++        + +NL      E+ KI +  +         G++VN   L  L++ +N+L  L   DI N V L  L+L  N L D+P  I  L  L  L +  N L+++P  +   K++   N+E N + ++PD     L  L  + +S NQ  ++P+    +  N+  +N+  N   ++P  I +    LT L +K+N +L  LP+ +    N+  L+L    L  +P +
Sbjct:  165 LDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLREN-KIRELGSAI-------GALVN---LTTLDVSHNHLEHLPE-DIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKEN-MLTALPLDIGTWVNMVELNLATNALQKLPDD 480          
BLAST of SMED30008716 vs. Ensembl Fly
Match: Sur-8 (gene:FBgn0038504 transcript:FBtr0083448)

HSP 1 Score: 219.164 bits (557), Expect = 1.474e-61
Identity = 161/451 (35.70%), Postives = 258/451 (57.21%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            LTELY+Y NKI +LP EIG L++L+ L + EN + SLP  +++C  L+ LD+RHN L +   ++        + L  +      D + +L  L  L+++ NK+   L  ++G L  + TLD+S N +  +P ++G C  L  L+ ++N+++++P++IGNLK L  +G++YN+L  +P +L +C  + E N+E N I ++P  ++     +    +S N+F + P    ++   +   N E+N I +I  G    A+ L  LN+  N L+ L  LDI   V +++LNLA N L  LP DI  L +LE L L+NN+L  +P  IG L+ L+ L+LE N +  +P E   L +L+ L + +NQ+   P  I  L NL  L+VSEN    LP+ I  L+ L +L++  N  L  LP  LA  +NL +L+++ CPL  IP E +   P  V+ +LK
Sbjct:  185 LTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIR-ELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTAL-PLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLK 633          

HSP 2 Score: 83.5741 bits (205), Expect = 2.809e-16
Identity = 99/329 (30.09%), Postives = 159/329 (48.33%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI---------VLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE 1781
            LDLSK+ I +IP+ + EC  L  L    NKI +LP  IG L  L  + +  N L  +PESL +C  LK L++  N + EIP  I          L+F ++        + +NL      E+ KI +  +         G++VN   L  L++ +N+L  L   DI N V L  L+L  N L D+P  I  L  L  L +  N L+++P  +   K++   N+E N + ++PD     L  L  + +S NQ  ++P+    +  N+  +N+  N   ++P  I +    LT L +K+N +L  LP+ +    N+  L+L    L  +P +
Sbjct:  165 LDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLREN-KIRELGSAI-------GALVN---LTTLDVSHNHLEHLPE-DIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKEN-MLTALPLDIGTWVNMVELNLATNALQKLPDD 480          
BLAST of SMED30008716 vs. Ensembl Fly
Match: Sur-8 (gene:FBgn0038504 transcript:FBtr0083447)

HSP 1 Score: 219.164 bits (557), Expect = 1.474e-61
Identity = 161/451 (35.70%), Postives = 258/451 (57.21%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            LTELY+Y NKI +LP EIG L++L+ L + EN + SLP  +++C  L+ LD+RHN L +   ++        + L  +      D + +L  L  L+++ NK+   L  ++G L  + TLD+S N +  +P ++G C  L  L+ ++N+++++P++IGNLK L  +G++YN+L  +P +L +C  + E N+E N I ++P  ++     +    +S N+F + P    ++   +   N E+N I +I  G    A+ L  LN+  N L+ L  LDI   V +++LNLA N L  LP DI  L +LE L L+NN+L  +P  IG L+ L+ L+LE N +  +P E   L +L+ L + +NQ+   P  I  L NL  L+VSEN    LP+ I  L+ L +L++  N  L  LP  LA  +NL +L+++ CPL  IP E +   P  V+ +LK
Sbjct:  185 LTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIR-ELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTAL-PLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLK 633          

HSP 2 Score: 83.5741 bits (205), Expect = 2.809e-16
Identity = 99/329 (30.09%), Postives = 159/329 (48.33%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI---------VLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE 1781
            LDLSK+ I +IP+ + EC  L  L    NKI +LP  IG L  L  + +  N L  +PESL +C  LK L++  N + EIP  I          L+F ++        + +NL      E+ KI +  +         G++VN   L  L++ +N+L  L   DI N V L  L+L  N L D+P  I  L  L  L +  N L+++P  +   K++   N+E N + ++PD     L  L  + +S NQ  ++P+    +  N+  +N+  N   ++P  I +    LT L +K+N +L  LP+ +    N+  L+L    L  +P +
Sbjct:  165 LDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLREN-KIRELGSAI-------GALVN---LTTLDVSHNHLEHLPE-DIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKEN-MLTALPLDIGTWVNMVELNLATNALQKLPDD 480          
BLAST of SMED30008716 vs. Ensembl Fly
Match: Sur-8 (gene:FBgn0038504 transcript:FBtr0339531)

HSP 1 Score: 219.55 bits (558), Expect = 2.841e-61
Identity = 161/452 (35.62%), Postives = 259/452 (57.30%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            +LTELY+Y NKI +LP EIG L++L+ L + EN + SLP  +++C  L+ LD+RHN L +   ++        + L  +      D + +L  L  L+++ NK+   L  ++G L  + TLD+S N +  +P ++G C  L  L+ ++N+++++P++IGNLK L  +G++YN+L  +P +L +C  + E N+E N I ++P  ++     +    +S N+F + P    ++   +   N E+N I +I  G    A+ L  LN+  N L+ L  LDI   V +++LNLA N L  LP DI  L +LE L L+NN+L  +P  IG L+ L+ L+LE N +  +P E   L +L+ L + +NQ+   P  I  L NL  L+VSEN    LP+ I  L+ L +L++  N  L  LP  LA  +NL +L+++ CPL  IP E +   P  V+ +LK
Sbjct:  184 HLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIR-ELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTAL-PLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLK 633          

HSP 2 Score: 84.3445 bits (207), Expect = 1.916e-16
Identity = 91/320 (28.44%), Postives = 157/320 (49.06%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE 1781
            LDLSK+ I +IP+ + EC  L  L    NKI +LP  IG L  L  + +  N L  +PESL +C  LK L++  N + EIP  ++ + + +    +  N+   +      + + +   +   N I  +  ++    +L  L++ +N+L  L   DI N V L  L+L  N L D+P  I  L  L  L +  N L+++P  +   K++   N+E N + ++PD     L  L  + +S NQ  ++P+    +  N+  +N+  N   ++P  I +    LT L +K+N +L  LP+ +    N+  L+L    L  +P +
Sbjct:  165 LDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNKLAEIP-PVIYRLRSLTTLYLRFNRITAVAD-DLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPE-DIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVPATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKEN-MLTALPLDIGTWVNMVELNLATNALQKLPDD 480          
BLAST of SMED30008716 vs. Ensembl Fly
Match: Lap1 (gene:FBgn0033984 transcript:FBtr0087407)

HSP 1 Score: 125.176 bits (313), Expect = 3.585e-29
Identity = 118/407 (28.99%), Postives = 191/407 (46.93%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL-DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDN 1685
            Q L  L++  N +  +P+ IG+L  L+ L +  N+I ++P E+KSCK L HLD+                        + N   RL D I  L  L+ L +    LE  L  + G+L  +  L+L  N ++ +P  +     L+RL+   N+  ELPE +G LK L  + I +NQ+ ++    ++ G L++L                                             + F A  N +  +   + N ++++VL++C N+L E     +  L  L+      N L++LP  IS L  LE L L++N L  LP  IGML++L+FL  + N L ++PDE C  ++L  L++++NQL   P  I  L  +++LNV  N+   LP S+  L  LT ++L DN
Sbjct:   63 QGLRVLHVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDL------------------------SCNSLQRLPDAITSLISLQELLLNETYLEF-LPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGELKSLRELWIDFNQIRRVS---ANIGKLRDL---------------------------------------------QHFEANGNLLDTLPSELSNWRNVEVLSICSNSL-EAFPFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSMWLSDN 395          

HSP 2 Score: 83.1889 bits (204), Expect = 4.312e-16
Identity = 92/319 (28.84%), Postives = 158/319 (49.53%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI--VLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE 1781
            L LS  R+  +P +L  C  L+ L+   N +  +P+ IG+L++L+ + +  N +  +PE +  C  L  L++  NS++ +P AI  ++  Q+++  N ++ +F  LP              A +       G +VN   L++L L  NNL  L    ++ L+ L  L++  N  ++LP+ +  L  L  L +  N +  +   IG L++L+      NLL  +P E      ++ L+I SN L+ FP  +  LK+L       N   ELP SI+ L++L  L L  N L+  LP T+  +++L FL  +   L  +P E
Sbjct:   45 LYLSTTRLQALPPQLFYCQGLRVLHVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISLQELL-LNETYLEF--LP--------------ANF-------GRLVN---LRILELRLNNLMTLPKSMVR-LINLQRLDIGGNEFTELPEVVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIR-LPSTIGMLRSLRFLFADDNQLRQLPDE 334          
BLAST of SMED30008716 vs. Ensembl Zebrafish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 211.075 bits (536), Expect = 3.865e-59
Identity = 167/451 (37.03%), Postives = 257/451 (56.98%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LTELY+Y NK+  LP E+G L  L  L + EN + SLP  + + K L+ LD+RHN L +   +V        + L  +   T    I  L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N +++LPETIGNL  +  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P  ++     +    ++ N F + P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+DI  L  LE L L+NNLL  LP  IG L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  104 LTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIK-QLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 552          

HSP 2 Score: 63.929 bits (154), Expect = 4.634e-10
Identity = 88/318 (27.67%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFP-SCIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            LDLSK  I ++P+ + E T+L  L    NK+  LP  +G L  L  + +  N L  +P+SL +   L+ L++  N + EIP A+V +   +    +  N+   + K   + S K+   +   N I ++   +    +L  L++ +N L  L   +I N   + +L+L  N L DLP+ I  L+ +  L L  N L+ +P+ +   + L+ LNLE+N +  +P+     L  L +L ++ N  +++P     +   +  LN+  N   ++P  I +    L+ L +KDN  L +LP+      ++  L+L    L  IP
Sbjct:   84 LDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIP-AVVYRVSSLTTLYLRFNRITTVEKDIKNLS-KLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPK-EIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-QLTSLPLDFGTWTSMVELNLATNQLTKIP 397          

HSP 3 Score: 62.3882 bits (150), Expect = 1.365e-9
Identity = 97/389 (24.94%), Postives = 169/389 (43.44%), Query Frame = 3
Query:  792 LTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKE-----IGMXXXXXXXXXXXXXXXXIPDEFCEL---------------------EKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALDIGLKLHEYLKMSNNKST 1880
            L  S+ +L  +  L L  N++  +P E+G  + L  L    N +  LP+++ NLK+L  + +++N+L +IP  +     L  L +  N I  +   I     ++   +I  NK   LP     E   +   +  +N +  +   + N   +  L+L +N+L +L    I NL  +  L L +N LS +P+ +++   LE L+L NN ++ LP+      + +       N   +  +  P +F  +                     + L  LN+  NQL + P       ++  LN++ N   ++P+ I  L  L  L L +N LL  LP  +  ++ L  L L    L  +P E        IAYLK L       + L ++NN+ T
Sbjct:   94 LPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIK-NLSKLTMLSIRENKIKQLPA-EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPE-TIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNN-LLKKLPYGIGNLRKLRELDLEENKLESLPNE--------IAYLKDL-------QKLVLTNNQLT 463          
BLAST of SMED30008716 vs. Ensembl Zebrafish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 211.075 bits (536), Expect = 3.865e-59
Identity = 167/451 (37.03%), Postives = 257/451 (56.98%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LTELY+Y NK+  LP E+G L  L  L + EN + SLP  + + K L+ LD+RHN L +   +V        + L  +   T    I  L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N +++LPETIGNL  +  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P  ++     +    ++ N F + P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+DI  L  LE L L+NNLL  LP  IG L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  104 LTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIK-QLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 552          

HSP 2 Score: 63.929 bits (154), Expect = 4.634e-10
Identity = 88/318 (27.67%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFP-SCIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            LDLSK  I ++P+ + E T+L  L    NK+  LP  +G L  L  + +  N L  +P+SL +   L+ L++  N + EIP A+V +   +    +  N+   + K   + S K+   +   N I ++   +    +L  L++ +N L  L   +I N   + +L+L  N L DLP+ I  L+ +  L L  N L+ +P+ +   + L+ LNLE+N +  +P+     L  L +L ++ N  +++P     +   +  LN+  N   ++P  I +    L+ L +KDN  L +LP+      ++  L+L    L  IP
Sbjct:   84 LDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIP-AVVYRVSSLTTLYLRFNRITTVEKDIKNLS-KLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPK-EIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-QLTSLPLDFGTWTSMVELNLATNQLTKIP 397          

HSP 3 Score: 62.3882 bits (150), Expect = 1.365e-9
Identity = 97/389 (24.94%), Postives = 169/389 (43.44%), Query Frame = 3
Query:  792 LTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKE-----IGMXXXXXXXXXXXXXXXXIPDEFCEL---------------------EKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALDIGLKLHEYLKMSNNKST 1880
            L  S+ +L  +  L L  N++  +P E+G  + L  L    N +  LP+++ NLK+L  + +++N+L +IP  +     L  L +  N I  +   I     ++   +I  NK   LP     E   +   +  +N +  +   + N   +  L+L +N+L +L    I NL  +  L L +N LS +P+ +++   LE L+L NN ++ LP+      + +       N   +  +  P +F  +                     + L  LN+  NQL + P       ++  LN++ N   ++P+ I  L  L  L L +N LL  LP  +  ++ L  L L    L  +P E        IAYLK L       + L ++NN+ T
Sbjct:   94 LPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIK-NLSKLTMLSIRENKIKQLPA-EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPE-TIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNN-LLKKLPYGIGNLRKLRELDLEENKLESLPNE--------IAYLKDL-------QKLVLTNNQLT 463          
BLAST of SMED30008716 vs. Ensembl Zebrafish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 211.075 bits (536), Expect = 3.865e-59
Identity = 167/451 (37.03%), Postives = 257/451 (56.98%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LTELY+Y NK+  LP E+G L  L  L + EN + SLP  + + K L+ LD+RHN L +   +V        + L  +   T    I  L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N +++LPETIGNL  +  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P  ++     +    ++ N F + P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+DI  L  LE L L+NNLL  LP  IG L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  104 LTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIKNLSKLTMLSIRENKIK-QLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNNLLKKLPYGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTYLGLGENLLQHLPEEIGTLENLEDLYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 552          

HSP 2 Score: 63.929 bits (154), Expect = 4.634e-10
Identity = 88/318 (27.67%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFP-SCIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            LDLSK  I ++P+ + E T+L  L    NK+  LP  +G L  L  + +  N L  +P+SL +   L+ L++  N + EIP A+V +   +    +  N+   + K   + S K+   +   N I ++   +    +L  L++ +N L  L   +I N   + +L+L  N L DLP+ I  L+ +  L L  N L+ +P+ +   + L+ LNLE+N +  +P+     L  L +L ++ N  +++P     +   +  LN+  N   ++P  I +    L+ L +KDN  L +LP+      ++  L+L    L  IP
Sbjct:   84 LDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIP-AVVYRVSSLTTLYLRFNRITTVEKDIKNLS-KLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPK-EIGNCTQITNLDLQHNDLLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-QLTSLPLDFGTWTSMVELNLATNQLTKIP 397          

HSP 3 Score: 62.3882 bits (150), Expect = 1.365e-9
Identity = 97/389 (24.94%), Postives = 169/389 (43.44%), Query Frame = 3
Query:  792 LTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKE-----IGMXXXXXXXXXXXXXXXXIPDEFCEL---------------------EKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALDIGLKLHEYLKMSNNKST 1880
            L  S+ +L  +  L L  N++  +P E+G  + L  L    N +  LP+++ NLK+L  + +++N+L +IP  +     L  L +  N I  +   I     ++   +I  NK   LP     E   +   +  +N +  +   + N   +  L+L +N+L +L    I NL  +  L L +N LS +P+ +++   LE L+L NN ++ LP+      + +       N   +  +  P +F  +                     + L  LN+  NQL + P       ++  LN++ N   ++P+ I  L  L  L L +N LL  LP  +  ++ L  L L    L  +P E        IAYLK L       + L ++NN+ T
Sbjct:   94 LPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVSSLTTLYLRFNRITTVEKDIK-NLSKLTMLSIRENKIKQLPA-EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPE-TIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLVSLEMLTLSNN-LLKKLPYGIGNLRKLRELDLEENKLESLPNE--------IAYLKDL-------QKLVLTNNQLT 463          
BLAST of SMED30008716 vs. Ensembl Zebrafish
Match: erbin (erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GENE-061103-403])

HSP 1 Score: 102.834 bits (255), Expect = 7.773e-22
Identity = 117/411 (28.47%), Postives = 186/411 (45.26%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL--DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILL 1694
            Q L  L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK+L  ++   N      L    + +     L  ++ F        GRL KL+ L ++ N+L+  L KS+ KL  +  LDL  N    +P  L + T ++ L  + NK+  +P  IG LK+L ++ +  N +E + E +S C  L++L                         +S+N    LP                        GS+ + + L  L +  N L  L    I  L  L +L+ +FN +  LP  I +  +L +    +NLL  +P E+G LKN+  L L SN L  +P+E  +++KLK +N+S N+L+  P    KL  +  + +SEN    L     E D  TH  +  N + 
Sbjct:   69 QLLYRLSLPDNDLTVLPPGIANLINLRELDVSKNGIQEFPENIKNCKVLAIVEASVN--PISKLPEGFTQLLSLSQLYLNDAFLEFLPASFGRLTKLQILELRENQLK-MLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIRELWMDGNKLTFVPGMIGALKQLSYLDVSKNNVEMVEEQISGCENLQDLL------------------------LSNNALTQLP------------------------GSIGSLKKLSTLKVDDNQLMYLPDT-IGGLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLKNVTVLFLHSNKLENLPEEMGDMQKLKVINLSDNKLRNLPYSFTKLNQMTAMWLSENQSKPLIPLQKEEDPETHKIVLTNYMF 427          

HSP 2 Score: 89.7373 bits (221), Expect = 8.524e-18
Identity = 79/260 (30.38%), Postives = 137/260 (52.69%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNK---FINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQS 1241
            L  L +  N+ +++P+ +  L  ++ELWM  N +  +P  + + K L +LD+  N+  +     ++   NL+ LL+++N  T+L G IG LKKL TL V  N+L   L  ++G L  +  LD S N I  +P+ +G+C  L+    ++N + ++P  +G+LK +  + +  N+LE +PE + D   LK +N+  N +  +P +   K  QM    +S N+    I L K  + E+ KI   N  +   +R    V N+ S
Sbjct:  186 LERLDLGSNEFTEVPEVLEQLTGIRELWMDGNKLTFVPGMIGALKQLSYLDVSKNN-VEMVEEQISGCENLQDLLLSNNALTQLPGSIGSLKKLSTLKVDDNQLM-YLPDTIGGLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLKNVTVLFLHSNKLENLPEEMGDMQKLKVINLSDNKLRNLPYSFT-KLNQMTAMWLSENQSKPLIPLQKEEDPETHKIVLTNYMFPQQTRTEEYVPNSDS 442          

HSP 3 Score: 79.7221 bits (195), Expect = 9.116e-15
Identity = 93/371 (25.07%), Postives = 155/371 (41.78%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI----------------------VLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            K LE L +  N++E  L K L     +  L L  N + ++P  +     L+ L+   N I E PE I N K L  +    N + K+PE  +    L +L +    +E +P++                       + K  Q+ + ++  N+F  +P+    +   I +   + N ++ + G +   + L  L++  NN+ E+    I     L DL L+ N L+ LP  I  L  L +L + +N L  LP  IG                        L  L  L+ S N+++  PS I +  NL       N  A++P  +  L  +T LFL  N L N LP  +  M+ L  ++L+   L ++P  + K
Sbjct:   46 KTLEELYLDANQIE-ELPKQLFNCQLLYRLSLPDNDLTVLPPGIANLINLRELDVSKNGIQEFPENIKNCKVLAIVEASVNPISKLPEGFTQLLSLSQLYLNDAFLEFLPASFGRLTKLQILELRENQLKMLPKSMHKLTQLERLDLGSNEFTEVPEV-LEQLTGIRELWMDGNKLTFVPGMIGALKQLSYLDVSKNNV-EMVEEQISGCENLQDLLLSNNALTQLPGSIGSLKKLSTLKVDDNQLMYLPDTIG-----------------------GLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLKNVTVLFLHSNKLEN-LPEEMGDMQKLKVINLSDNKLRNLPYSFTK 389          

HSP 4 Score: 61.6178 bits (148), Expect = 3.513e-9
Identity = 61/214 (28.50%), Postives = 107/214 (50.00%), Query Frame = 3
Query: 1110 FNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
             + SH     +PK   S    +E+   + N I  +   + N Q L  L+L  N+L+ L    I NL+ L +L+++ N + + P++I     L  ++ + N ++ LP+    L +L  L L    L  +P  F  L KL+ L +  NQLK  P  + KL  LE L++  N F E+P+ + +L  +  L++  N  L  +P  +  +K L++L ++
Sbjct:   27 LDYSHCSLEQVPKEIFSFEKTLEELYLDANQIEELPKQLFNCQLLYRLSLPDNDLTVLPP-GIANLINLRELDVSKNGIQEFPENIKNCKVLAIVEASVNPISKLPEGFTQLLSLSQLYLNDAFLEFLPASFGRLTKLQILELRENQLKMLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIRELWMDGNK-LTFVPGMIGALKQLSYLDVS 238          
BLAST of SMED30008716 vs. Ensembl Zebrafish
Match: erbin (erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GENE-061103-403])

HSP 1 Score: 102.449 bits (254), Expect = 9.150e-22
Identity = 117/411 (28.47%), Postives = 186/411 (45.26%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL--DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILL 1694
            Q L  L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK+L  ++   N      L    + +     L  ++ F        GRL KL+ L ++ N+L+  L KS+ KL  +  LDL  N    +P  L + T ++ L  + NK+  +P  IG LK+L ++ +  N +E + E +S C  L++L                         +S+N    LP                        GS+ + + L  L +  N L  L    I  L  L +L+ +FN +  LP  I +  +L +    +NLL  +P E+G LKN+  L L SN L  +P+E  +++KLK +N+S N+L+  P    KL  +  + +SEN    L     E D  TH  +  N + 
Sbjct:   69 QLLYRLSLPDNDLTVLPPGIANLINLRELDVSKNGIQEFPENIKNCKVLAIVEASVN--PISKLPEGFTQLLSLSQLYLNDAFLEFLPASFGRLTKLQILELRENQLK-MLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIRELWMDGNKLTFVPGMIGALKQLSYLDVSKNNVEMVEEQISGCENLQDLL------------------------LSNNALTQLP------------------------GSIGSLKKLSTLKVDDNQLMYLPDT-IGGLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLKNVTVLFLHSNKLENLPEEMGDMQKLKVINLSDNKLRNLPYSFTKLNQMTAMWLSENQSKPLIPLQKEEDPETHKIVLTNYMF 427          

HSP 2 Score: 89.3521 bits (220), Expect = 8.770e-18
Identity = 79/260 (30.38%), Postives = 137/260 (52.69%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNK---FINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQS 1241
            L  L +  N+ +++P+ +  L  ++ELWM  N +  +P  + + K L +LD+  N+  +     ++   NL+ LL+++N  T+L G IG LKKL TL V  N+L   L  ++G L  +  LD S N I  +P+ +G+C  L+    ++N + ++P  +G+LK +  + +  N+LE +PE + D   LK +N+  N +  +P +   K  QM    +S N+    I L K  + E+ KI   N  +   +R    V N+ S
Sbjct:  186 LERLDLGSNEFTEVPEVLEQLTGIRELWMDGNKLTFVPGMIGALKQLSYLDVSKNN-VEMVEEQISGCENLQDLLLSNNALTQLPGSIGSLKKLSTLKVDDNQL-MYLPDTIGGLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLKNVTVLFLHSNKLENLPEEMGDMQKLKVINLSDNKLRNLPYSFT-KLNQMTAMWLSENQSKPLIPLQKEEDPETHKIVLTNYMFPQQTRTEEYVPNSDS 442          

HSP 3 Score: 79.7221 bits (195), Expect = 9.398e-15
Identity = 93/371 (25.07%), Postives = 155/371 (41.78%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI----------------------VLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            K LE L +  N++E  L K L     +  L L  N + ++P  +     L+ L+   N I E PE I N K L  +    N + K+PE  +    L +L +    +E +P++                       + K  Q+ + ++  N+F  +P+    +   I +   + N ++ + G +   + L  L++  NN+ E+    I     L DL L+ N L+ LP  I  L  L +L + +N L  LP  IG                        L  L  L+ S N+++  PS I +  NL       N  A++P  +  L  +T LFL  N L N LP  +  M+ L  ++L+   L ++P  + K
Sbjct:   46 KTLEELYLDANQIE-ELPKQLFNCQLLYRLSLPDNDLTVLPPGIANLINLRELDVSKNGIQEFPENIKNCKVLAIVEASVNPISKLPEGFTQLLSLSQLYLNDAFLEFLPASFGRLTKLQILELRENQLKMLPKSMHKLTQLERLDLGSNEFTEVPEV-LEQLTGIRELWMDGNKLTFVPGMIGALKQLSYLDVSKNNV-EMVEEQISGCENLQDLLLSNNALTQLPGSIGSLKKLSTLKVDDNQLMYLPDTIG-----------------------GLSHLDELDCSFNEIEALPSSIGQCVNLRTFAADHNLLAQMPPEMGSLKNVTVLFLHSNKLEN-LPEEMGDMQKLKVINLSDNKLRNLPYSFTK 389          

HSP 4 Score: 61.6178 bits (148), Expect = 3.454e-9
Identity = 61/214 (28.50%), Postives = 107/214 (50.00%), Query Frame = 3
Query: 1110 FNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
             + SH     +PK   S    +E+   + N I  +   + N Q L  L+L  N+L+ L    I NL+ L +L+++ N + + P++I     L  ++ + N ++ LP+    L +L  L L    L  +P  F  L KL+ L +  NQLK  P  + KL  LE L++  N F E+P+ + +L  +  L++  N  L  +P  +  +K L++L ++
Sbjct:   27 LDYSHCSLEQVPKEIFSFEKTLEELYLDANQIEELPKQLFNCQLLYRLSLPDNDLTVLPP-GIANLINLRELDVSKNGIQEFPENIKNCKVLAIVEASVNPISKLPEGFTQLLSLSQLYLNDAFLEFLPASFGRLTKLQILELRENQLKMLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIRELWMDGN-KLTFVPGMIGALKQLSYLDVS 238          
BLAST of SMED30008716 vs. Ensembl Xenopus
Match: shoc2 (SHOC2 leucine-rich repeat scaffold protein [Source:NCBI gene;Acc:100495610])

HSP 1 Score: 218.394 bits (555), Expect = 1.227e-61
Identity = 166/455 (36.48%), Postives = 265/455 (58.24%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGR----LKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            +TELY+YGNK+  LP E+G L+NL +L + EN + SLP  + + K L  LD+RHN L +   +V        + L    +F R+  + +    L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N++++LP+TIGNL  L  +G++YN+L  +P SL+ C  L ELN+E+N+I  +P  ++    ++    ++ N F + P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+S L  +E L L+NNLL  LP  IG L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  105 ITELYLYGNKLQSLPAEVGCLVNLVKLALSENSLTSLPDSLDNLKKLCMLDLRHNKLREIPAVVYRLSSLTTLFL----RFNRITAVEKDIKTLSKLTMLSIRENKIK-HLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLCSLSRLGLRYNRLSAVPRSLAKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDVSGLVSIEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 553          

HSP 2 Score: 62.003 bits (149), Expect = 2.897e-9
Identity = 79/308 (25.65%), Postives = 134/308 (43.51%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTK-LKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLE 1388
            NL  L +  N++  LPKEIGN   +  L +Q N +  LP  + +   L  L +R+N L+     +        + L  +N  T  +G +  L K+ +LT+  N  +        +   + +L++  NRI  IP  +    K L +LN + N++  LP   G    +  + +  NQL KIPE +S                      ++  + +I   +S+N    LP    +   K+ + + E N +  +   +   + L+ L L  N L+ L    I +L  L  L L  N L+ LP++I  L +LE
Sbjct:  219 NLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLCSLSRLGLRYNRLSAVPRSLAKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSG---------------------LVSIEVLI---LSNNLLKKLPHGIGNLR-KLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPR-GIGHLTNLTHLGLGENLLTHLPEEIGTLENLE 500          

HSP 3 Score: 59.6918 bits (143), Expect = 1.236e-8
Identity = 71/269 (26.39%), Postives = 120/269 (44.61%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIV-KLKNLEMLNVSENFFAELP 1634
            LDL+K  I ++P  + + T++  L    NK+  LP  +G L  L  + +  N L  +P+SL +                         +++   ++ HNK   +P      S     F   +N I+ +   +     L +L++  N +  L + +I  L  LI L++A N L  LPK+I   + + +LDL +N L  LP  IG L +L  L L  N L  +P    +  +L  LN+ +N + T P  ++  L  +  L ++ N F   P
Sbjct:   85 LDLAKKSIHMLPVSIKDLTQITELYLYGNKLQSLPAEVGCLVNLVKLALSENSLTSLPDSLDN------------------------LKKLCMLDLRHNKLREIPAVVYRLSSLTTLF-LRFNRITAVEKDIKTLSKLTMLSIRENKIKHLPA-EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLCSLSRLGLRYNRLSAVPRSLAKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYP 327          
BLAST of SMED30008716 vs. Ensembl Xenopus
Match: shoc2 (SHOC2 leucine-rich repeat scaffold protein [Source:NCBI gene;Acc:100495610])

HSP 1 Score: 218.779 bits (556), Expect = 1.463e-61
Identity = 166/455 (36.48%), Postives = 265/455 (58.24%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGR----LKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            +TELY+YGNK+  LP E+G L+NL +L + EN + SLP  + + K L  LD+RHN L +   +V        + L    +F R+  + +    L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N++++LP+TIGNL  L  +G++YN+L  +P SL+ C  L ELN+E+N+I  +P  ++    ++    ++ N F + P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+S L  +E L L+NNLL  LP  IG L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  125 ITELYLYGNKLQSLPAEVGCLVNLVKLALSENSLTSLPDSLDNLKKLCMLDLRHNKLREIPAVVYRLSSLTTLFL----RFNRITAVEKDIKTLSKLTMLSIRENKIK-HLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLCSLSRLGLRYNRLSAVPRSLAKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDVSGLVSIEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 573          

HSP 2 Score: 62.003 bits (149), Expect = 3.026e-9
Identity = 79/308 (25.65%), Postives = 134/308 (43.51%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTK-LKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLE 1388
            NL  L +  N++  LPKEIGN   +  L +Q N +  LP  + +   L  L +R+N L+     +        + L  +N  T  +G +  L K+ +LT+  N  +        +   + +L++  NRI  IP  +    K L +LN + N++  LP   G    +  + +  NQL KIPE +S                      ++  + +I   +S+N    LP    +   K+ + + E N +  +   +   + L+ L L  N L+ L    I +L  L  L L  N L+ LP++I  L +LE
Sbjct:  239 NLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLCSLSRLGLRYNRLSAVPRSLAKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSG---------------------LVSIEVLI---LSNNLLKKLPHGIGNLR-KLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPR-GIGHLTNLTHLGLGENLLTHLPEEIGTLENLE 520          

HSP 3 Score: 59.6918 bits (143), Expect = 1.223e-8
Identity = 71/269 (26.39%), Postives = 120/269 (44.61%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIV-KLKNLEMLNVSENFFAELP 1634
            LDL+K  I ++P  + + T++  L    NK+  LP  +G L  L  + +  N L  +P+SL +                         +++   ++ HNK   +P      S     F   +N I+ +   +     L +L++  N +  L + +I  L  LI L++A N L  LPK+I   + + +LDL +N L  LP  IG L +L  L L  N L  +P    +  +L  LN+ +N + T P  ++  L  +  L ++ N F   P
Sbjct:  105 LDLAKKSIHMLPVSIKDLTQITELYLYGNKLQSLPAEVGCLVNLVKLALSENSLTSLPDSLDN------------------------LKKLCMLDLRHNKLREIPAVVYRLSSLTTLF-LRFNRITAVEKDIKTLSKLTMLSIRENKIKHLPA-EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLCSLSRLGLRYNRLSAVPRSLAKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYP 347          
BLAST of SMED30008716 vs. Ensembl Xenopus
Match: LRRD1 (leucine-rich repeats and death domain containing 1 [Source:NCBI gene;Acc:100490254])

HSP 1 Score: 105.531 bits (262), Expect = 8.668e-23
Identity = 131/485 (27.01%), Postives = 225/485 (46.39%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL-DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNS--ESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQS----------------------LDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKE---IGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEY----RKSPITVIAYLKALDI 1832
            L +L + GN+I  LPKEIG+L NL+EL +  N +  LP+++ +   L+ L +                          NK T + D +  LK+L+ L++  N L   +T+ +     +  L L+ N++  +P ++     LK L+ E N +  LP+ + +L  L  I    N L  IP  L +C  + +L++  N + E+P A+      ++  N++ N+   + +  NS   + K+E      N ++  S       +L  L+L  N ++ + S                      +++  L  L  ++L+ N +  +P  IS L  L  ++L+NN     P+E   +  L+ LK    +   L+ +PDE  +L+ LK L IS N +KT P  I ++KNL  L  + N    LP SI+ L  L  L LK N  L +LP  ++G++ L  ++L+  P+   P       R  PI    YL++ D+
Sbjct:  202 LVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTL------------------------DDNKLTAISDKLQNLKQLKVLSI-ANNLLTDITEKVCWCPAIECLKLNGNQMYRLPTKIHNLRNLKELHIERNALEMLPDQLAHLNNLSVIVCANNNLLWIPIELKNCNQITKLDLSGNKLSEVPQALS-SMTSLLYLNLNQNE---IHEIANSIIHNRKLEHLELSGNKLTVFSVHFCGLHNLAYLDLSRNEINSVPSAISNLESLSELLLHSNKFRRFPIELCALKSLQKIDLSGNQIETVPSGISLLEGLRYVNLSNNSFKVFPRELFSVSSLETLKISQKDGRKLISLPDELSKLKNLKELEISDNNIKTLPGSIGEMKNLVQLTATSNQLYHLPASISSLAALQQLSLKGN-QLTSLPSDISGLQKLREINLDSNPMLRPPSLLCDGKRLYPIG--RYLQSADL 654          

HSP 2 Score: 95.9005 bits (237), Expect = 9.962e-20
Identity = 126/461 (27.33%), Postives = 217/461 (47.07%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLP---KFPNSESI-------------------KIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFL--KDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPG 1778
            +N+ +L+   NK+S+LP  +G+L  L+ L +  N + +LP    S K L  L++  N ++                            + RL +L  L + GN+++ SL K +G L  +  L LS N++  +P +L   T L+ L  + NK+  + + + NLK+L+ + I  N L  I E +  C  ++ L +  N +  +P+ I    + + + +I  N    LP      N+ S+                   +I K +   N +S +  ++ +  SL  LNL  N + E+ +  I N   L  L L+ N L+        L +L  LDL+ N + ++P  I  L++L  L L SN   + P E C L+ L+ +++S NQ++T PS I  L+ L  +N+S N F   P+ +  +  L  L +  KD   L +LP  L+ +KNL  L ++   +  +PG
Sbjct:  131 KNIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLDGNQISALP-----------------------KAVFRLSQLVKLCLSGNQIK-SLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTLDDNKLTAISDKLQNLKQLKVLSIANNLLTDITEKVCWCPAIECLKLNGNQMYRLPTKIH-NLRNLKELHIERNALEMLPDQLAHLNNLSVIVCANNNLLWIPIELKNCNQITKLDLSGNKLSEVPQALSSMTSLLYLNLNQNEIHEIANSIIHNRK-LEHLELSGNKLTVFSVHFCGLHNLAYLDLSRNEINSVPSAISNLESLSELLLHSNKFRRFPIELCALKSLQKIDLSGNQIETVPSGISLLEGLRYVNLSNNSFKVFPRELFSVSSLETLKISQKDGRKLISLPDELSKLKNLKELEISDNNIKTLPG 565          

HSP 3 Score: 91.6633 bits (226), Expect = 1.955e-18
Identity = 124/445 (27.87%), Postives = 207/445 (46.52%), Query Frame = 3
Query:  741 LKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPK----FPNSESI------------------KIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLID----LNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPG----------------EYRKSPITVIAY--LKALDI----------GLKLHE---YLKMSNN--KSTEKSLFS 1898
            L KLE L+++GN L  SL   +  L  +  L+++ N+I ++P+E+     +K+L    NK+ +LP  +G+L  L+ + I  N ++ +P+S +    L  LN++ N I  +P A V +  Q++K  +S N+  +LPK      N   +                   +E+   + N ++ IS  + N + LKVL++  N L+     DI   VC       L L  N +  LP  I  L +L+ L +  N L  LP ++  L NL  +   +N LL IP E     ++  L++S N+L   P  +  + +L  LN+++N   E+  SI    +L HL L  N  L    V   G+ NL +L L+   +  +P                 ++R+ PI + A   L+ +D+          G+ L E   Y+ +SNN  K   + LFS
Sbjct:   84 LSKLEILSLEGNALV-SLPPEICSLSQLTALNVNHNQIAVLPHEISGLKNIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNSMKTLPDSTASLKNLHVLNLDGNQISALPKA-VFRLSQLVKLCLSGNQIKSLPKEIGDLKNLRELSLSSNQLTFLPVQLYNLTSLEELTLDDNKLTAISDKLQNLKQLKVLSIANNLLT-----DITEKVCWCPAIECLKLNGNQMYRLPTKIHNLRNLKELHIERNALEMLPDQLAHLNNLSVIVCANNNLLWIPIELKNCNQITKLDLSGNKLSEVPQALSSMTSLLYLNLNQNEIHEIANSIIHNRKLEHLELSGNK-LTVFSVHFCGLHNLAYLDLSRNEINSVPSAISNLESLSELLLHSNKFRRFPIELCALKSLQKIDLSGNQIETVPSGISLLEGLRYVNLSNNSFKVFPRELFS 520          

HSP 4 Score: 72.7886 bits (177), Expect = 1.305e-12
Identity = 94/314 (29.94%), Postives = 146/314 (46.50%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISH---NKFINLP----KFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLE 1388
            +NL EL+I  N +  LP ++ +L NL  +    N +  +PIE+K+C  +  LD+  N L++    + +    L + L  +      + I   +KLE L + GNKL        G LH +  LDLS+N I  +P+ +     L  L    NK    P  +  LK L+ I +  NQ+E +P  +S    L+ +N+ +NS +  P  +      +    IS     K I+LP    K  N + ++I       NNI  + GS+   ++L  L    N L  L +  I +L  L  L+L  N L+ LP DIS L  L 
Sbjct:  315 RNLKELHIERNALEMLPDQLAHLNNLSVIVCANNNLLWIPIELKNCNQITKLDLSGNKLSEVPQALSSMTSLLYLNLNQNEIHEIANSIIHNRKLEHLELSGNKLTVFSVHFCG-LHNLAYLDLSRNEINSVPSAISNLESLSELLLHSNKFRRFPIELCALKSLQKIDLSGNQIETVPSGISLLEGLRYVNLSNNSFKVFPREL-FSVSSLETLKISQKDGRKLISLPDELSKLKNLKELEISD-----NNIKTLPGSIGEMKNLVQLTATSNQLYHLPA-SISSLAALQQLSLKGNQLTSLPSDISGLQKLR 620          

HSP 5 Score: 59.6918 bits (143), Expect = 1.666e-8
Identity = 54/151 (35.76%), Postives = 89/151 (58.94%), Query Frame = 3
Query: 1323 LNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            +NL    L+++P D+ R ++L+ L L+NN +T LP  +  L  L+ L+LE N L+ +P E C L +L  LN++ NQ+   P  I  LKN++ L  + N  ++LP  + +L  L  L +  N  + TLP + A +KNL+ L+L+G  +  +P
Sbjct:   44 INLNSKELTEIPPDVFRCTNLQCLLLSNNFMTHLPTSLCHLSKLEILSLEGNALVSLPPEICSLSQLTALNVNHNQIAVLPHEISGLKNIKQLFANNNKLSQLPPCLGDLTTLQVLCISGNS-MKTLPDSTASLKNLHVLNLDGNQISALP 193          
BLAST of SMED30008716 vs. Ensembl Xenopus
Match: prrc2a (proline rich coiled-coil 2A [Source:Xenbase;Acc:XB-GENE-482976])

HSP 1 Score: 105.916 bits (263), Expect = 1.148e-22
Identity = 114/419 (27.21%), Postives = 193/419 (46.06%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD----GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVT 1712
            Q+L +L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK+L  ++   N      L    S +     L  ++ F  LD      GRL KL+ L ++ N+L+  L K++ +L  +  LDL  N    +P  L + + LK    + NK+  +P  +GNLK+L ++ +  N +E + + +S C  L++L + SN+I+++P +I    +++    +  N+ + LP                                                  I  L  + DL+ +FN +  LP  I  L  + +    +N LT LP EIG  K+   L L SN L  +P+E  +++KLK +N+S N+L+  P    +L+ L  + +S+N    L     E D+ T   +  N +    P T
Sbjct:  106 QSLHKLSLPDNDLTILPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVN--PISKLPDGFSQLLNLTQLYLNDAF--LDFLPANFGRLTKLQILELRENQLK-MLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNKLTYIPGFLGNLKQLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLPESIG-ALKKLTTLKVDENQLMYLPD------------------------------------------------SIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADHNFLTQLPPEIGTWKSATVLFLHSNKLESLPEEMGDMQKLKVINLSDNRLRNLPFSFTRLQQLTAMWLSDNQSKPLIPLQKETDQDTQKVVLTNYMFPQQPRT 470          

HSP 2 Score: 83.9593 bits (206), Expect = 6.034e-16
Identity = 95/352 (26.99%), Postives = 163/352 (46.31%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNI---SHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            K LE L +  N++E  L K L     +  L L  N + I+P  +     L+ L+   N I E PE I N K L  +    N + K+P+  S    L +L +    ++ +P+     F ++ K  I     N+   LPK  N  + ++E+ +   N  + +   +     LK   +  N L+ +    + NL  L  L+++ N++  +   IS    L+ L L++N +  LP+ IG LK L  L ++ N L+ +PD    L  +++L+ S N+++  PS I  L  +       NF  +LP  I      T LFL  N  L +LP  +  M+ L  ++L+   L ++P  + +
Sbjct:   83 KTLEELYLDANQIE-ELPKQLFNCQSLHKLSLPDNDLTILPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPA----NFGRLTKLQILELRENQLKMLPKTMNRLT-QLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNKLTYIPGF-LGNLKQLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLPESIGALKKLTTLKVDENQLMYLPDSIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADHNFLTQLPPEIGTWKSATVLFLHSN-KLESLPEEMGDMQKLKVINLSDNRLRNLPFSFTR 426          

HSP 3 Score: 62.003 bits (149), Expect = 3.535e-9
Identity = 62/219 (28.31%), Postives = 108/219 (49.32%), Query Frame = 3
Query: 1095 QQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            + +   + SH     +PK   +    +E+   + N I  +   + N QSL  L+L  N+L+ L +  I NL+ L +L+++ N + + P++I     L  ++ + N ++ LP     L NL  L L    L  +P  F  L KL+ L +  NQLK  P  + +L  LE L++  N F E+P+ + +L  L   ++  N  L  +P  L  +K L +L ++
Sbjct:   59 ETVTSLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEELPKQLFNCQSLHKLSLPDNDLTILPA-SIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPANFGRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGN-KLTYIPGFLGNLKQLTYLDVS 275          
BLAST of SMED30008716 vs. Ensembl Xenopus
Match: prrc2a (proline rich coiled-coil 2A [Source:Xenbase;Acc:XB-GENE-482976])

HSP 1 Score: 105.916 bits (263), Expect = 1.207e-22
Identity = 114/419 (27.21%), Postives = 193/419 (46.06%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD----GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVT 1712
            Q+L +L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK+L  ++   N      L    S +     L  ++ F  LD      GRL KL+ L ++ N+L+  L K++ +L  +  LDL  N    +P  L + + LK    + NK+  +P  +GNLK+L ++ +  N +E + + +S C  L++L + SN+I+++P +I    +++    +  N+ + LP                                                  I  L  + DL+ +FN +  LP  I  L  + +    +N LT LP EIG  K+   L L SN L  +P+E  +++KLK +N+S N+L+  P    +L+ L  + +S+N    L     E D+ T   +  N +    P T
Sbjct:   69 QSLHKLSLPDNDLTILPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVN--PISKLPDGFSQLLNLTQLYLNDAF--LDFLPANFGRLTKLQILELRENQLK-MLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNKLTYIPGFLGNLKQLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLPESIG-ALKKLTTLKVDENQLMYLPD------------------------------------------------SIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADHNFLTQLPPEIGTWKSATVLFLHSNKLESLPEEMGDMQKLKVINLSDNRLRNLPFSFTRLQQLTAMWLSDNQSKPLIPLQKETDQDTQKVVLTNYMFPQQPRT 433          

HSP 2 Score: 83.5741 bits (205), Expect = 8.543e-16
Identity = 95/352 (26.99%), Postives = 163/352 (46.31%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNI---SHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            K LE L +  N++E  L K L     +  L L  N + I+P  +     L+ L+   N I E PE I N K L  +    N + K+P+  S    L +L +    ++ +P+     F ++ K  I     N+   LPK  N  + ++E+ +   N  + +   +     LK   +  N L+ +    + NL  L  L+++ N++  +   IS    L+ L L++N +  LP+ IG LK L  L ++ N L+ +PD    L  +++L+ S N+++  PS I  L  +       NF  +LP  I      T LFL  N  L +LP  +  M+ L  ++L+   L ++P  + +
Sbjct:   46 KTLEELYLDANQIE-ELPKQLFNCQSLHKLSLPDNDLTILPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPA----NFGRLTKLQILELRENQLKMLPKTMNRLT-QLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNKLTYIPGF-LGNLKQLTYLDVSKNNIEMVEDGISGCESLQDLLLSSNAIQQLPESIGALKKLTTLKVDENQLMYLPDSIGGLTAIEDLDCSFNEIEALPSSIGHLIQIRTFAADHNFLTQLPPEIGTWKSATVLFLHSN-KLESLPEEMGDMQKLKVINLSDNRLRNLPFSFTR 389          

HSP 3 Score: 61.6178 bits (148), Expect = 5.340e-9
Identity = 62/218 (28.44%), Postives = 107/218 (49.08%), Query Frame = 3
Query: 1095 QQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSL 1748
            + +   + SH     +PK   +    +E+   + N I  +   + N QSL  L+L  N+L+ L +  I NL+ L +L+++ N + + P++I     L  ++ + N ++ LP     L NL  L L    L  +P  F  L KL+ L +  NQLK  P  + +L  LE L++  N F E+P+ + +L  L   ++  N  L  +P  L  +K L +L +
Sbjct:   22 ETVTSLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEELPKQLFNCQSLHKLSLPDNDLTILPA-SIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLDFLPANFGRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGN-KLTYIPGFLGNLKQLTYLDV 237          
BLAST of SMED30008716 vs. Ensembl Mouse
Match: Shoc2 (Shoc2, leucine rich repeat scaffold protein [Source:MGI Symbol;Acc:MGI:1927197])

HSP 1 Score: 214.157 bits (544), Expect = 4.914e-60
Identity = 167/451 (37.03%), Postives = 261/451 (57.87%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LTELY+Y NK+  LP E+G L+NL  L + EN + SLP  + + K L+ LD+RHN L +   +V        + L  +   T    I  L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N +++LP+TIGNL  L  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P +++    ++    ++ N F   P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+S L  LE L L+NNLL  LP  +G L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  125 LTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLPKLSMLSIRENKIK-QLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPDTIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLSTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 573          

HSP 2 Score: 65.855 bits (159), Expect = 1.435e-10
Identity = 92/324 (28.40%), Postives = 153/324 (47.22%), Query Frame = 3
Query:  825 VTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPK----FPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFP-SCIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            + LDLSK  I I+P  + E T+L  L    NK+  LP  +G L  L  + +  N L  +P+SL +   L+ L++  N + EIPS +V +   +    +  N+   + K     P     K+   +   N I ++   +    +L  L++ +N L  L   +I N   + +L+L  N L DLP  I  LS L  L L  N L+ +P+ +     L+ LNLE+N +  +P+     L KL +L ++ N  + +P     +   +  LN+  N   ++P  I +    L+ L +KDN  L +LP+      ++  L+L    L  IP
Sbjct:  103 MRLDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPS-VVYRLDSLTTLYLRFNRITTVEKDIKNLP-----KLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPK-EIGNCTQITNLDLQHNDLLDLPDTIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-QLTSLPLDFGTWTSMVELNLATNQLTKIP 418          

HSP 3 Score: 63.1586 bits (152), Expect = 9.587e-10
Identity = 96/371 (25.88%), Postives = 162/371 (43.67%), Query Frame = 3
Query:  792 LTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKE-----IGMXXXXXXXXXXXXXXXXIPDEFCEL---------------------EKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKAL 1826
            L  S+ +L  +  L L  N++  +P E+G    L  L    N +  LP+++ NLK+L  + +++N+L +IP  +     L  L +  N I  +   I     ++   +I  NK   LP     E   +   +  +N +  +   + N   +  L+L +N+L +L    I NL  L  L L +N LS +P+ +++ S LE L+L NN ++TLP+      + +       N      +  P +F  +                     + L  LN+  NQL + P       ++  LN++ N   ++P+ ++ L  L  L L +N LL  LP  L  ++ L  L L    L  +P E        IAYLK L
Sbjct:  115 LPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIK-NLPKLSMLSIRENKIKQLPA-EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPD-TIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNN-LLKKLPHGLGNLRKLRELDLEENKLESLPNE--------IAYLKDL 473          
BLAST of SMED30008716 vs. Ensembl Mouse
Match: Shoc2 (Shoc2, leucine rich repeat scaffold protein [Source:MGI Symbol;Acc:MGI:1927197])

HSP 1 Score: 214.157 bits (544), Expect = 4.914e-60
Identity = 167/451 (37.03%), Postives = 261/451 (57.87%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LTELY+Y NK+  LP E+G L+NL  L + EN + SLP  + + K L+ LD+RHN L +   +V        + L  +   T    I  L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N +++LP+TIGNL  L  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P +++    ++    ++ N F   P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+S L  LE L L+NNLL  LP  +G L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  125 LTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLPKLSMLSIRENKIK-QLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPDTIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLSTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 573          

HSP 2 Score: 65.855 bits (159), Expect = 1.435e-10
Identity = 92/324 (28.40%), Postives = 153/324 (47.22%), Query Frame = 3
Query:  825 VTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPK----FPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFP-SCIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            + LDLSK  I I+P  + E T+L  L    NK+  LP  +G L  L  + +  N L  +P+SL +   L+ L++  N + EIPS +V +   +    +  N+   + K     P     K+   +   N I ++   +    +L  L++ +N L  L   +I N   + +L+L  N L DLP  I  LS L  L L  N L+ +P+ +     L+ LNLE+N +  +P+     L KL +L ++ N  + +P     +   +  LN+  N   ++P  I +    L+ L +KDN  L +LP+      ++  L+L    L  IP
Sbjct:  103 MRLDLSKRSIHILPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPS-VVYRLDSLTTLYLRFNRITTVEKDIKNLP-----KLSMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPK-EIGNCTQITNLDLQHNDLLDLPDTIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-QLTSLPLDFGTWTSMVELNLATNQLTKIP 418          

HSP 3 Score: 63.1586 bits (152), Expect = 9.587e-10
Identity = 96/371 (25.88%), Postives = 162/371 (43.67%), Query Frame = 3
Query:  792 LTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKE-----IGMXXXXXXXXXXXXXXXXIPDEFCEL---------------------EKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKAL 1826
            L  S+ +L  +  L L  N++  +P E+G    L  L    N +  LP+++ NLK+L  + +++N+L +IP  +     L  L +  N I  +   I     ++   +I  NK   LP     E   +   +  +N +  +   + N   +  L+L +N+L +L    I NL  L  L L +N LS +P+ +++ S LE L+L NN ++TLP+      + +       N      +  P +F  +                     + L  LN+  NQL + P       ++  LN++ N   ++P+ ++ L  L  L L +N LL  LP  L  ++ L  L L    L  +P E        IAYLK L
Sbjct:  115 LPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIK-NLPKLSMLSIRENKIKQLPA-EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNDLLDLPD-TIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNN-LLKKLPHGLGNLRKLRELDLEENKLESLPNE--------IAYLKDL 473          
BLAST of SMED30008716 vs. Ensembl Mouse
Match: Shoc2 (Shoc2, leucine rich repeat scaffold protein [Source:MGI Symbol;Acc:MGI:1927197])

HSP 1 Score: 151.754 bits (382), Expect = 1.212e-39
Identity = 134/362 (37.02%), Postives = 201/362 (55.52%), Query Frame = 3
Query:  741 LKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LKKL  L ++ NKL   +   + +L  + TL L  NRI  +  ++    KL  L+   NKI +LP  IGNL  L  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P +++    ++    ++ N F   P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+S L  LE L L+NNLL  LP  +G L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:    4 LKKLRMLDLRHNKLR-EIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLPKLSMLSIRENKIKQLPAEIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLSTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 363          

HSP 2 Score: 60.8474 bits (146), Expect = 2.681e-9
Identity = 83/308 (26.95%), Postives = 135/308 (43.83%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTK-LKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLE 1388
            +LT LY+  N+I+ + K+I NL  L  L ++EN I  LP E+ +   L  L +R+N L+     +        + L  +N  T  +  +  L KL +LT+  N  +        +   + +L++  NRI  IP  +    K L +LN + N++  LP   G    +  + +  NQL KIPE +S    L+ L                         +S+N    LP    +   K+ + + E N +  +   +   + L+ L L  N LS L    I +L  L  L L  N L+ LP++I  L +LE
Sbjct:   29 SLTTLYLRFNRITTVEKDIKNLPKLSMLSIRENKIKQLPAEIGNLSSLNRLGLRYNRLSAIPRSLAKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSLEVLI------------------------LSNNLLKKLPHGLGNLR-KLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLSTLPR-GIGHLTNLTHLGLGENLLTHLPEEIGTLENLE 310          
BLAST of SMED30008716 vs. Ensembl Mouse
Match: Lrrd1 (leucine rich repeats and death domain containing 1 [Source:MGI Symbol;Acc:MGI:3045299])

HSP 1 Score: 112.464 bits (280), Expect = 5.106e-25
Identity = 144/469 (30.70%), Postives = 239/469 (50.96%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD-GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLP-KFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNN-------LSELQSLDI----QNLVCLIDLNLAF-----------NHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNI--LLNTLPVTLAGMKNLNFLSLNGCPLGDIP---GEYR 1787
             NL  L    N+IS++PKE+  L N+++L +  N ID+LP  ++  + L+ L +  N +       L+SL NLRIL + +N+ T     +  L KL +L + GN + GSL K + +L  + +L +  N++  +  E+ +  K+K L+   NK+  +   I N KEL  + +  N L+ IP+ +S C  L+ L++  N+IEE+P  I  K + + + +++ NK I +  +  +  +I I +F+   N I+ +   + N + +  + L YNN       L  LQSLD      N +  I ++++F           N L+   K +  L++LE LDL  N + T+P  I  + +L  L L  N     P E C L+ L+ L+IS N+L+  P  I KLK ++ LN+S N F   P  + +L  L  L +       L  LP  ++ M  L  L+++   + DIP   GE R
Sbjct:  205 HNLKILNASYNEISQIPKELLQLENMRQLLLNSNHIDTLPSGLEHLRYLETLSLGKN-MLTYIPDSLSSLKNLRILNLEYNQLTIFSKSLCFLPKLNSLNLTGNMI-GSLPKEVRELKNLESLLMDHNKLTFLAVEIFQLPKIKELHLADNKLEAISPKIENFKELRLLNLDKNLLQSIPKKISHCVNLESLSLSDNNIEELPKKIR-KLKNLRQLHVNRNKMITMTEEISHLSNIHILEFSG--NQITHVPIEIKNCRKITRVELNYNNIMYFPVGLCALQSLDYLSFNGNYISEIPVDMSFSKQLLHLELNRNKLTVFSKHLCSLTNLEYLDLAKNQIMTIPSCISAMVSLHVLILSDNKFESFPKELCSLKNLRVLDISENKLQKIPLEISKLKRIQKLNLSNNIFTNFPVELCQLQTLEELNISQTSGKKLTRLPEEVSHMTQLKILNISNNAIKDIPKNIGELR 668          

HSP 2 Score: 80.4925 bits (197), Expect = 4.361e-15
Identity = 103/358 (28.77%), Postives = 171/358 (47.77%), Query Frame = 3
Query:  708 NKFTRLDGI--GRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            N+     GI  G L  LE L+++ N L  S+   +   H +  L+ S N I  IP EL +   +++L    N I  LP  + +L+ LE + +  N L  IP+SLS    L+ LN+E N +     ++     ++   N++ N   +LPK    E   +E    ++N ++ ++  +     +K L+L  N L E  S  I+N   L  LNL  N L  +PK IS   +LESL L++N +  LPK+I                        +L+ L+ L+++ N++ T    I  L N+ +L  S N    +P  I    ++T + L  N ++   PV L  +++L++LS NG  + +IP
Sbjct:  168 NQIKNFQGIDPGDLLGLEILSLQENGL-SSIPLEIQLFHNLKILNASYNEISQIPKELLQLENMRQLLLNSNHIDTLPSGLEHLRYLETLSLGKNMLTYIPDSLSSLKNLRILNLEYNQLTIFSKSLCF-LPKLNSLNLTGNMIGSLPK-EVRELKNLESLLMDHNKLTFLAVEIFQLPKIKELHLADNKL-EAISPKIENFKELRLLNLDKNLLQSIPKKISHCVNLESLSLSDNNIEELPKKIR-----------------------KLKNLRQLHVNRNKMITMTEEISHLSNIHILEFSGNQITHVPIEIKNCRKITRVELNYNNIM-YFPVGLCALQSLDYLSFNGNYISEIP 497          

HSP 3 Score: 77.411 bits (189), Expect = 4.625e-14
Identity = 104/409 (25.43%), Postives = 188/409 (45.97%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSN---QLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDN 1685
            +NL  L +  NK++ L  EI  L  +KEL + +N ++++  ++++ K L+ L++  N L      +   +    + L  +N       I +LK L  L V  NK+  ++T+ +  L  +  L+ S N+I  +P E+  C K+ R+   YN I+  P  +  L+ L+++    N + +IP  +S                          +Q++   ++ NK                        ++  S  + +  +L+ L+L  N +  + S  I  +V L  L L+ N     PK++  L +L  LD++ N L  +P EI  LK ++ LNL +N+    P E C+L+ L+ LNIS     +L   P  +  +  L++LN+S N   ++PK+I EL  L   +  +N
Sbjct:  320 KNLESLLMDHNKLTFLAVEIFQLPKIKELHLADNKLEAISPKIENFKELRLLNLDKNLLQSIPKKISHCVNLESLSLSDNNIEELPKKIRKLKNLRQLHVNRNKM-ITMTEEISHLSNIHILEFSGNQITHVPIEIKNCRKITRVELNYNNIMYFPVGLCALQSLDYLSFNGNYISEIPVDMSFS------------------------KQLLHLELNRNK------------------------LTVFSKHLCSLTNLEYLDLAKNQIMTIPSC-ISAMVSLHVLILSDNKFESFPKELCSLKNLRVLDISENKLQKIPLEISKLKRIQKLNLSNNIFTNFPVELCQLQTLEELNISQTSGKKLTRLPEEVSHMTQLKILNISNNAIKDIPKNIGELRSLVSFYASNN 678          

HSP 4 Score: 56.6102 bits (135), Expect = 1.255e-7
Identity = 72/233 (30.90%), Postives = 117/233 (50.21%), Query Frame = 3
Query: 1083 VLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSEL--QSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            ++K + +    +  N+  N       + + +E  + + N +S I   +    +LK+LN  YN +S++  + L ++N+  L+   L  NH+  LP  +  L +LE+L L  N+LT +P  +  LKNL+ LNLE N L       C L KL +LN++ N + + P  + +LKNLE L +  N    L   I +L ++  L L DN L    P  +   K L  L+L+   L  IP
Sbjct:  154 IVKVKYVKYLYLDKNQIKNFQGIDPGDLLGLEILSLQENGLSSIPLEIQLFHNLKILNASYNEISQIPKELLQLENMRQLL---LNSNHIDTLPSGLEHLRYLETLSLGKNMLTYIPDSLSSLKNLRILNLEYNQLTIFSKSLCFLPKLNSLNLTGNMIGSLPKEVRELKNLESLLMDHNKLTFLAVEIFQLPKIKELHLADNKLEAISP-KIENFKELRLLNLDKNLLQSIP 382          
BLAST of SMED30008716 vs. Ensembl Mouse
Match: Erbin (Erbb2 interacting protein [Source:MGI Symbol;Acc:MGI:1890169])

HSP 1 Score: 101.679 bits (252), Expect = 1.947e-21
Identity = 119/430 (27.67%), Postives = 198/430 (46.05%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL--DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            Q+L +L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK+L  ++   N      L    S +     L  ++ F        GRL KL+ L ++ N+L+  L K++ +L  +  LDL  N    +P  L + + L+    + N++  +P  IG+L++L ++ +  N +E + E +S C  L++                        F +S N    LP     E+I                GS+ N  +LK+     N L  L    I  L  + +L+ +FN +  LP  I +L+++ +    +N L  LP EIG  KN+  L L  N L  +P+E  +++KLK +N+S N+LK  P    KL+ L  + +S+N    L     E D  T   +  N +    P T    +++ F+S N
Sbjct:   69 QSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVN--PISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLK-MLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLREFWMDGNRLTFIPGFIGSLRQLTYLDVSKNNIEMVEEGISTCENLQD------------------------FLLSSNSLQQLP-----ETI----------------GSLKNVTTLKI---DENQLMYLPD-SIGGLRSIEELDCSFNEIEALPSSIGQLTNMRTFAADHNYLQQLPPEIGNWKNITVLFLHCNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDTETQKMVLTNYMFPQQPRT----EDVMFISDN 442          

HSP 2 Score: 83.5741 bits (205), Expect = 6.719e-16
Identity = 96/352 (27.27%), Postives = 166/352 (47.16%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNI---SHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            K LE L +  N++E  L K L     +  L L  N +  +P  +     L+ L+   N I E PE I N K L  +    N + K+P+  S    L +L +    +E +P+     F ++ K  I     N+   LPK  N  + ++E+ +   N  + +   +     L+   +  N L+ +    I +L  L  L+++ N++  + + IS   +L+   L++N L  LP+ IG LKN+  L ++ N L+ +PD    L  ++ L+ S N+++  PS I +L N+       N+  +LP  I     +T LFL  N  L TLP  +  M+ L  ++L+   L ++P  + K
Sbjct:   46 KTLEELYLDANQIE-ELPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPA----NFGRLTKLQILELRENQLKMLPKTMNRLT-QLERLDLGSNEFTEVPEVLEQLSGLREFWMDGNRLTFIPGF-IGSLRQLTYLDVSKNNIEMVEEGISTCENLQDFLLSSNSLQQLPETIGSLKNVTTLKIDENQLMYLPDSIGGLRSIEELDCSFNEIEALPSSIGQLTNMRTFAADHNYLQQLPPEIGNWKNITVLFLHCN-KLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTK 389          

HSP 3 Score: 61.6178 bits (148), Expect = 3.712e-9
Identity = 60/214 (28.04%), Postives = 106/214 (49.53%), Query Frame = 3
Query: 1110 FNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
             + SH     +PK   +    +E+   + N I  +   + N QSL  L+L  N+L+ L +  I NL+ L +L+++ N + + P++I     L  ++ + N ++ LP     L NL  L L    L  +P  F  L KL+ L +  NQLK  P  + +L  LE L++  N F E+P+ + +L  L   ++  N  L  +P  +  ++ L +L ++
Sbjct:   27 LDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEELPKQLFNCQSLHKLSLPDNDLTTLPA-SIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLREFWMDGN-RLTFIPGFIGSLRQLTYLDVS 238          
BLAST of SMED30008716 vs. UniProt/SwissProt
Match: sp|B4LXW1|SUR8_DROVI (Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis OX=7244 GN=Sur-8 PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 3.090e-63
Identity = 164/451 (36.36%), Postives = 260/451 (57.65%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            LTELY+Y NKI +LP EIG L+NL+ L + EN + SLP  +K C  L+ LD+RHN L +   ++        + L  +      D + +L  L  L+++ NK++  L  ++G L  + TLD+S N +  +P+++G C  L  L+ ++N+++++P++IGNLK L  +G++YN+L  +P SL +C  + E N+E N I ++P  ++     +    +S N+F + P    ++   +   N E+N I +I  G    A+ L  LN+  N L+ L  LD+   V +++LNLA N L  LP DI  L +LE L L+NN+L  +P  IG L+ L+ L+LE N +  +P E   L +L+ L + +NQ+   P  I  L NL  L+VSEN    LP+ I  L+ L +L++  N  L  LP  LA  +NL +L+++ CPLG IP E +   P  V+ +LK
Sbjct:  158 LTELYLYSNKIGQLPTEIGCLVNLRNLALNENSLTSLPESLKHCTQLKVLDLRHNKLAEIPSVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIK-ELGSAIGALVNLTTLDVSHNHLEHLPDDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGLRYNRLNSVPISLKNCKSMDEFNVEGNGITQLPDGMLASLSALTTITLSRNQFTSYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTAL-PLDVGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLSNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLGTIPPEIQAGGPSLVLQWLK 606          

HSP 2 Score: 83.9593 bits (206), Expect = 2.060e-15
Identity = 101/329 (30.70%), Postives = 159/329 (48.33%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI---------VLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE 1781
            LDLSK+ I ++PN + EC  L  L    NKI +LP  IG L  L  + +  N L  +PESL  C  LK L++  N + EIPS I          L+F ++        + +NL      E+ KI++  +         G++VN   L  L++ +N+L  L   DI N V L  L+L  N L D+P  I  L  L  L L  N L ++P  +   K++   N+E N + ++PD     L  L  + +S NQ  ++P+    +  N+  +N+  N   ++P  I +    LT L +K+N +L  LP+ +    N+  L+L    L  +P +
Sbjct:  138 LDLSKSSITVLPNTVRECVHLTELYLYSNKIGQLPTEIGCLVNLRNLALNENSLTSLPESLKHCTQLKVLDLRHNKLAEIPSVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLREN-KIKELGSAI-------GALVN---LTTLDVSHNHLEHLPD-DIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGLRYNRLNSVPISLKNCKSMDEFNVEGNGITQLPDGMLASLSALTTITLSRNQFTSYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKEN-MLTALPLDVGTWVNMVELNLATNALQKLPDD 453          
BLAST of SMED30008716 vs. UniProt/SwissProt
Match: sp|B4JTV9|SUR8_DROGR (Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi OX=7222 GN=Sur-8 PE=3 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 4.929e-63
Identity = 164/451 (36.36%), Postives = 260/451 (57.65%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            LTELY+Y NKI +LP EIG L+NL+ L + EN + SLP  +K C  L+ LD+RHN L +   ++        + L  +   T  D + +L  L  L+++ NK++  L  ++G L  + TLD+S N +  +P ++G C  L  L+ ++N+++++P++IGNLK L  +G++YN+L  +P SL +C  + E N+E N I ++P  ++     +    +S N+F + P    ++   +   N E+N I +I  G    A+ L  LN+  N L+ L  LD+   V +++LNLA N L  LP DI  L +LE L L+NN+L  +P  IG L+ L+ L+LE N +  +P E   L +L+ L + +NQ+   P  +  L NL  L+VSEN    LP+ I  L+ L +L++  N  L  LP  LA  +NL +L+++ CPLG IP E +   P  V+ +LK
Sbjct:  166 LTELYLYSNKIGQLPTEIGCLVNLRNLALNENSLTSLPESLKHCTQLKVLDLRHNKLAEIPSVIYRLRSLTTLYLRFNRITTVADDLRQLVNLTMLSLRENKIK-ELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGLRYNRLNCVPVSLKNCKSMDEFNVEGNGITQLPDGMLASLSALTSITLSRNQFTSYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTAL-PLDVGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSVGHLSNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLGTIPPEIQAGGPSLVLQWLK 614          

HSP 2 Score: 83.9593 bits (206), Expect = 2.324e-15
Identity = 93/320 (29.06%), Postives = 156/320 (48.75%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE 1781
            LDLSK+ I ++PN + EC  L  L    NKI +LP  IG L  L  + +  N L  +PESL  C  LK L++  N + EIPS ++ + + +    +  N+   +      + + +   +   N I  +  ++    +L  L++ +N+L  L   DI N V L  L+L  N L D+P  I  L  L  L L  N L  +P  +   K++   N+E N + ++PD     L  L ++ +S NQ  ++P+    +  N+  +N+  N   ++P  I +    LT L +K+N +L  LP+ +    N+  L+L    L  +P +
Sbjct:  146 LDLSKSSITVLPNTVRECVHLTELYLYSNKIGQLPTEIGCLVNLRNLALNENSLTSLPESLKHCTQLKVLDLRHNKLAEIPS-VIYRLRSLTTLYLRFNRITTVADDL-RQLVNLTMLSLRENKIKELGSAIGALVNLTTLDVSHNHLEHLPE-DIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGLRYNRLNCVPVSLKNCKSMDEFNVEGNGITQLPDGMLASLSALTSITLSRNQFTSYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKEN-MLTALPLDVGTWVNMVELNLATNALQKLPDD 461          
BLAST of SMED30008716 vs. UniProt/SwissProt
Match: sp|Q8AVI4|SHOC2_XENLA (Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis OX=8355 GN=shoc2 PE=2 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.258e-62
Identity = 168/455 (36.92%), Postives = 266/455 (58.46%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGR----LKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            +TELY+YGNK+  LP E+GNL+NL +L + EN + SLP  + + K L  LD+RHN L +   +V        + L    +F R+  + +    L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N++++LP+TIGNL  L  +G++YN+L  +P SLS C  L ELN+E+N+I  +P  ++    ++    ++ N F + P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+S L  +E L L+NNLL  LP  IG L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  120 ITELYLYGNKLQSLPAEVGNLVNLVKLALSENSLTSLPDSLDNLKKLCMLDLRHNKLREIPPVVYRLSSLTTLFL----RFNRITAVEKDLKMLPKLTMLSIRENKIK-HLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAVPRSLSKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSSIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDVSGLVSIEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 568          

HSP 2 Score: 62.7734 bits (151), Expect = 7.263e-9
Identity = 81/308 (26.30%), Postives = 140/308 (45.45%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTK-LKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLE 1388
            NL  L +  N++  LPKEIGN   +  L +Q N +  LP  + +   L  L +R+N L+     +        + L  +N  T  +G +  L K+ +LT+  N  +        +   + +L++  NRI  IP  +    K L +LN + N++  LP   G    +  + +  NQL KIPE +S    ++ L + +N ++++P  I    +++ + ++  NK  +LP                 N I+ +       + L+ L L  N L+ L    I +L  L  L L  N L+ LP++I  L +LE
Sbjct:  234 NLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAVPRSLSKCSELDELNLENNNISTLPEGLLSSLVKVNSLTLARNCFQSYPVGGPSQFSSIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDVSGLVSIEVLILSNNLLKKLPHGIG-NLRKLRELDLEENKLESLP-----------------NEIAYL-------KDLQKLVLTNNQLTTLPR-GIGHLTNLTHLGLGENLLTHLPEEIGTLENLE 515          

HSP 3 Score: 60.8474 bits (146), Expect = 3.403e-8
Identity = 72/271 (26.57%), Postives = 121/271 (44.65%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSI 1643
            LDL+K  I ++P  + + T++  L    NK+  LP  +GNL  L  + +  N L  +P+SL +                         +++   ++ HNK   +P                   + R+S       SL  L L +N ++ ++  D++ L  L  L++  N +  LP +I  L +L +LD+ +N L  LPKEIG    +  L+L+ N LL +PD    L  L  L +  N+L   P  + K   L+ LN+  N  + LP+ +
Sbjct:  100 LDLAKKSIHMLPVSIKDLTQITELYLYGNKLQSLPAEVGNLVNLVKLALSENSLTSLPDSLDN------------------------LKKLCMLDLRHNKLREIPPV-----------------VYRLS-------SLTTLFLRFNRITAVEK-DLKMLPKLTMLSIRENKIKHLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRYNRLSAVPRSLSKCSELDELNLENNNISTLPEGL 321          
BLAST of SMED30008716 vs. UniProt/SwissProt
Match: sp|B5DX45|SUR8_DROPS (Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Sur-8 PE=3 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 3.503e-62
Identity = 161/452 (35.62%), Postives = 260/452 (57.52%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            +LTELY+Y NKI +LP EIG L+NL+ L + EN + SLP  +++CK L+ LD+RHN L +   ++        + L  +      D + +L  L  L+++ NK+   L  ++G L  + TLD+S N +  +P ++G C  L  L+ ++N+++++P++IGNLK L  +G++YN+L  +P +L +C  + E N+E N + ++P  ++     +    +S N+F + P    ++   +   N E+N I +I  G    A+ L  LN+  N L+ L  LDI   V +++LNLA N L  LP DI  L +LE L L+NN+L  +P  IG ++ L+ L+LE N +  +P E   L +L+ L + +NQ+   P  I  L NL  L+VSEN    LP+ I  L+ L +L++  N  L  LP  LA  +NL +L+++ CPL  IP E +   P  V+ +LK
Sbjct:  172 HLTELYLYSNKIGQLPAEIGCLVNLRNLALNENSLTSLPESLQNCKQLKVLDLRHNKLAEIPPVIYRLRTLTTLYLRFNRITAVADNLRQLVNLTMLSLRENKIR-ELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGLRYNRLSSVPATLKNCKSMDEFNVEGNGMTQLPDGMLASLSGLTTITLSRNQFTSYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTAL-PLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNMRKLRILDLEENRIEVLPHEIGLLHELQRLILQTNQITMLPRSIGHLSNLTHLSVSENNLQFLPEEIGSLEGLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLK 621          

HSP 2 Score: 83.1889 bits (204), Expect = 3.864e-15
Identity = 95/324 (29.32%), Postives = 159/324 (49.07%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFI----NLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE 1781
            LDLSK+ I +IP+ + EC  L  L    NKI +LP  IG L  L  + +  N L  +PESL +C  LK L++  N + EIP  ++ + + +    +  N+      NL +  N   + + +     N I  +  ++    +L  L++ +N+L  L   DI N V L  L+L  N L D+P  I  L  L  L L  N L+++P  +   K++   N+E N + ++PD     L  L  + +S NQ  ++P+    +  N+  +N+  N   ++P  I +    LT L +K+N +L  LP+ +    N+  L+L    L  +P +
Sbjct:  153 LDLSKSSITVIPSTVKECVHLTELYLYSNKIGQLPAEIGCLVNLRNLALNENSLTSLPESLQNCKQLKVLDLRHNKLAEIP-PVIYRLRTLTTLYLRFNRITAVADNLRQLVNLTMLSLRE-----NKIRELGSAIGALVNLTTLDVSHNHLEHLPE-DIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGLRYNRLSSVPATLKNCKSMDEFNVEGNGMTQLPDGMLASLSGLTTITLSRNQFTSYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKEN-MLTALPLDIGTWVNMVELNLATNALQKLPDD 468          
BLAST of SMED30008716 vs. UniProt/SwissProt
Match: sp|B3LWU3|SUR8_DROAN (Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae OX=7217 GN=Sur-8 PE=3 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 5.229e-61
Identity = 161/451 (35.70%), Postives = 258/451 (57.21%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            +TELY+Y NKI +LP EIG L+NL+ L + EN + SLP  +++C  L+ LD+RHN L +   ++        + L  +      D + +L  L  L+++ NK+   L  ++G L  + TLD+S N +  +P ++G C  L  L+ ++N+++++P++IGNLK L  +G++YN+L  +P +L +C  + E N+E N I ++P  ++     +    +S N+F + P    ++   +   N E+N I +I  G    A+ L  LN+  N L+ L  LDI   V +++LNLA N L  LP DI  L +LE L L+NN+L  +P  IG L+ L+ L+LE N +  +P E   L +L+ L + +NQ+   P  I  L NL  L+VSEN    LP+ I  L+ L +L++  N  L  LP  LA  +NL +L+++ CPL  IP E +   P  V+ +LK
Sbjct:  185 ITELYLYSNKIGQLPPEIGCLVNLRNLALNENSLTSLPESLQNCNQLKVLDLRHNKLAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIR-ELGSAIGALVNLTTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLTSVPATLKNCKCMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFTSYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTAL-PLDIGTWVNMVELNLATNALQKLPDDIMNLQNLEILILSNNMLKKIPNTIGNLRRLRILDLEENRIETLPHEIGLLHELQRLILQTNQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALCQNLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLK 633          

HSP 2 Score: 81.2629 bits (199), Expect = 1.679e-14
Identity = 90/320 (28.12%), Postives = 157/320 (49.06%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFPS-CIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE 1781
            LDLSK+ I +IP+ + +C ++  L    NKI +LP  IG L  L  + +  N L  +PESL +C  LK L++  N + EIP  ++ + + +    +  N+   +      + + +   +   N I  +  ++    +L  L++ +N+L  L   DI N V L  L+L  N L D+P  I  L  L  L +  N LT++P  +   K +   N+E N + ++PD     L  L  + +S NQ  ++P+    +  N+  +N+  N   ++P  I +    LT L +K+N +L  LP+ +    N+  L+L    L  +P +
Sbjct:  165 LDLSKSSITVIPSTVKDCVQITELYLYSNKIGQLPPEIGCLVNLRNLALNENSLTSLPESLQNCNQLKVLDLRHNKLAEIP-PVIYRLRSLTTLYLRFNRITAVAD-DLRQLVNLTMLSLRENKIRELGSAIGALVNLTTLDVSHNHLEHLPE-DIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLTSVPATLKNCKCMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFTSYPTGGPAQFTNVYSINLEHNRIDKIPYGIFSRAKGLTKLNMKEN-MLTALPLDIGTWVNMVELNLATNALQKLPDD 480          
BLAST of SMED30008716 vs. TrEMBL
Match: A0A4S2LK30 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006678 PE=4 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 1.047e-77
Identity = 188/452 (41.59%), Postives = 269/452 (59.51%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPI-TVIAYLK 1820
            NL +L++Y NK+S LP +IGNL  L++LW+QEN + SLP EM+ C  L HLD+RHN L      V+  L  L+ LL+T+NK   + G+G LK L+ L VK N L+G L + L +L  +  LD SKNRI I+P+ +G CTKL RL  +YN I ELP +IG LKEL+ +GIKYN+L ++P  L+ C  L ELNIE N I  +P  ++ K   +    +S N F   P     + + +E  + +YN++  +S    ++A  L+ L L  NN+  L+ +       L+ L+L++N ++ LP+D   L++LE LDLT+N L  LP  IG L  L  LNLE N +  +P    E+E L+ LN+ +N+L   P  I  L NL  L + +N    LP  I +L +LT L LK+N  L+ LP  LA +  L+FLSL GC L  IP +  ++    VI YL+
Sbjct:  113 NLQDLFLYENKLSYLPPQIGNLRKLRKLWLQENSLYSLPSEMERCAYLTHLDLRHNRLDGALPSVILGLHCLQQLLLTYNKLNDISGVGHLKDLQILVVKSNNLQGPLPEELRQLTKLQILDCSKNRITILPDAIGSCTKLVRLLLDYNCIGELPSSIGCLKELQQLGIKYNRLTRLPTELAQCQQLTELNIEGNQIVRLPDDLLRKMPSVSSATLSRNAFTGFPTGATGQLMHLEHLSMDYNDLDSVSTNDFLDADHLRSLTLGNNNIVHLE-IAASQWRQLVQLDLSYNRITKLPEDFCELANLEDLDLTSNWLKELPVSIGKLTRLVKLNLEFNHITYLPKSIGEMENLRVLNLDANRLTRLPCAIGNLHNLTSLKLEDNMIQRLPTQIGDLKQLTRLCLKNNKPLDQLPAELAALPLLSFLSLEGCNLRQIPEDIVQAGAGAVIKYLR 563          

HSP 2 Score: 65.0846 bits (157), Expect = 4.433e-7
Identity = 62/218 (28.44%), Postives = 103/218 (47.25%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEI-------------------------GNLINLKELWMQENIIDSLPI-EMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL-DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKEL 1040
            Q LTEL I GN+I +LP ++                         G L++L+ L M  N +DS+   +      L+ L + +N+      +  +    L  L +++N+ T+L +    L  LE L +  N L+  L  S+GKL  +V L+L  N I  +P  +GE   L+ LN + N++  LP  IGNL  L  + ++ N ++++P  + D   L  L
Sbjct:  297 QQLTELNIEGNQIVRLPDDLLRKMPSVSSATLSRNAFTGFPTGATGQLMHLEHLSMDYNDLDSVSTNDFLDADHLRSLTLGNNN-IVHLEIAASQWRQLVQLDLSYNRITKLPEDFCELANLEDLDLTSNWLK-ELPVSIGKLTRLVKLNLEFNHITYLPKSIGEMENLRVLNLDANRLTRLPCAIGNLHNLTSLKLEDNMIQRLPTQIGDLKQLTRL 512          
BLAST of SMED30008716 vs. TrEMBL
Match: A0A3Q0KP10 (Putative shoc2 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 5.061e-73
Identity = 183/454 (40.31%), Postives = 265/454 (58.37%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQS-LKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLKAL 1826
            +L EL++Y NK++ LP +IG L NL+ LW+QEN +  LP E+  C  L HLDIRHN L     +VLT    ++ L +T+NK T +  IG L+ L+TL VK N+L+G +   +G L  + TLDLSKNR+  I   +G C  L R   +YN+I ELP++IG L EL  +GIKYN L ++P ++ +C  L ELNIE N I ++P  ++   +  +   +SHN F + P    ++   ++ F  +YN +       ++  + L  LNLC NN+  L    I+ L  L++L+L++N +  LP  I  L  LE LDLT+N L  LP  IG L  L  L LESN +  IP    +L +L+ LN+  N+L   PS I  L NL+ L V EN    LP  I +L+ LTHL+L +N  L+ LP+ L  + +L FL ++GC L  +P +  K    +VI YL+ L
Sbjct:  123 HLIELFLYDNKLTCLPLQIGLLKNLQRLWLQENSLTFLPDELGYCSKLTHLDIRHNRLEGCIPVVLTKFALMKQLYLTYNKLTDISAIGNLRFLQTLVVKSNQLQGPIPDCIGNLTQLKTLDLSKNRLTKITENIGNCKLLSRFLVDYNQIDELPKSIGQLSELTVLGIKYNCLSELPVTICNCEKLTELNIEGNHITQLPENLLCHLKDSLSVVLSHNDFNSFPIGDKTQYKNVKHFRLDYNRLELFEAVQLSENTQLTTLNLCNNNIITLDFTGIETLKHLVELDLSYNQIGQLPDSIGELVSLEVLDLTSNRLEGLPNRIGELVRLVQLELESNQITSIPLNIGQLCQLQTLNLDVNKLSRLPSTIGNLNNLKKLRVKENLLQRLPPEIGKLENLTHLYLSNNKPLDLLPIELGMLSSLRFLGIDGCSLRQMPVDITKNGSASVIKYLRDL 576          

HSP 2 Score: 79.7221 bits (195), Expect = 1.193e-11
Identity = 73/231 (31.60%), Postives = 128/231 (55.41%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKE---LWMQENIIDSLPIEMKS-CKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD--GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINL 1142
            + LTEL I GN I++LP+ +  L +LK+   + +  N  +S PI  K+  K ++H  + +N L     + L+    L  L + +N    LD  GI  LK L  L +  N++ G L  S+G+L  +  LDL+ NR+  +PN +GE  +L +L  E N+I  +P  IG L +L+ + +  N+L ++P ++ +   LK+L ++ N ++ +P  I  K + +    +S+NK ++L
Sbjct:  307 EKLTELNIEGNHITQLPENL--LCHLKDSLSVVLSHNDFNSFPIGDKTQYKNVKHFRLDYNRLELFEAVQLSENTQLTTLNLCNNNIITLDFTGIETLKHLVELDLSYNQI-GQLPDSIGELVSLEVLDLTSNRLEGLPNRIGELVRLVQLELESNQITSIPLNIGQLCQLQTLNLDVNKLSRLPSTIGNLNNLKKLRVKENLLQRLPPEIG-KLENLTHLYLSNNKPLDL 533          
BLAST of SMED30008716 vs. TrEMBL
Match: A0A5J4NYI9 (Leucine-rich repeat protein SHOC2 (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0011134 PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 7.262e-72
Identity = 185/469 (39.45%), Postives = 268/469 (57.14%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSV-VNAQSLKVLNL---CYNNLSELQSLDIQNLVC-------------LIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPI-TVIAYLKAL 1826
            L EL++Y NK+  LP +I  L  L++LW+QEN + SLP E++ C  L HLD+RHN L       +T L +L  L +T+NK T + GIGRL  L+TL VK N L+G ++  +G+L  + TLDLSKNR+  IP+E+  C  L R   +YN+I+++P +IG L EL+ +GIKYN+L  +P  L+ C  L ELNIE N I+ +P  ++     +    +S N F  +P     +   ++    +YN I  +   V   A  L  LNL   C ++L  L  L I N++C             L+ L+L++N +  LP ++  + +LE LDLT+N L  LP  IG + +L  L+LE N L  +P E CEL  LK LN+ +N+L   PS I +L NLE L +++N    +P  I +L  LTHL LK+N  L+ LP+ L  M  L FLSL GC L  +P     S    +I Y ++L
Sbjct:   53 LVELFLYENKLISLPTQICKLQKLQKLWLQENCLLSLPAELELCTKLIHLDLRHNRLDGPLPAAITHLFSLTQLFLTYNKLTDISGIGRLTNLQTLVVKSNNLQGRISDCIGQLIDLKTLDLSKNRLTEIPDEISGCKHLVRFLVDYNQILQIPSSIGELTELQILGIKYNKLSGLPCELAHCQQLTELNIEGNRIQRLPDGLLQSMPMLSSAVLSRNSFTTIPDENADQFFHLKNLCLDYNAIESLPDDVFFKASQLSTLNLGNNCIHSLDSLGKLSI-NIICLMITPFSETKCNSLVGLDLSYNLIEKLPDNLFEMMNLELLDLTSNRLQQLPSTIGKMSHLVQLHLEFNQLTSLPSEICELTHLKVLNLDANRLTRLPSSIGRLPNLEQLRLADNLLQRIPSQIADLKMLTHLHLKNNKCLDLLPLELCTMPKLTFLSLEGCNLRRLPPAVVLSGSGGIIKYFRSL 520          

HSP 2 Score: 61.2326 bits (147), Expect = 7.911e-6
Identity = 65/234 (27.78%), Postives = 107/234 (45.73%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEI-------------------------GNLINLKELWMQENIIDSLP--IEMKSCKLLQHLDIRHN--HXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIG--------------RLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKEL 1040
            Q LTEL I GN+I +LP  +                             +LK L +  N I+SLP  +  K+ + L  L++ +N  H  D    +  +++ L I   +  K   L G+                +  LE L +  N+L+  L  ++GK+  +V L L  N++  +P+E+ E T LK LN + N++  LP +IG L  LE + +  N L++IP  ++D  +L  L
Sbjct:  236 QQLTELNIEGNRIQRLPDGLLQSMPMLSSAVLSRNSFTTIPDENADQFFHLKNLCLDYNAIESLPDDVFFKASQ-LSTLNLGNNCIHSLDSLGKLSINIICLMITPFSETKCNSLVGLDLSYNLIEKLPDNLFEMMNLELLDLTSNRLQ-QLPSTIGKMSHLVQLHLEFNQLTSLPSEICELTHLKVLNLDANRLTRLPSSIGRLPNLEQLRLADNLLQRIPSQIADLKMLTHL 467          
BLAST of SMED30008716 vs. TrEMBL
Match: A0A4Z2DNU0 (Leucine-rich repeat protein soc-2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010556 PE=4 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.284e-70
Identity = 181/454 (39.87%), Postives = 262/454 (57.71%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQS-LKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLKAL 1826
            +L EL++Y NK++ LP EIG L NL+ LW+QEN +  LP E+ SC  L HLDIRHN L     +++T L  ++ L +T+NK T +  IG L  LETL VK N+L+G +   +G L  + TLDLSKNR+  I   +G C  L R   +YN+I +LP++IG L EL  +GIKYN L ++P+ + +C  L ELNIE N I ++P  ++   +      +SHN F   P     +   ++ F  +YN +      +++  + L  LNLC NN+  L    I+ L  L++L+L++N +S LP  I  L  LE LDLT+N L  LP  IG L  L  L +ESN +  +P    +L +L+ LN+  N+L   PS I  L NL+ L V EN    LP  I  L  LTHL+L +N  L+ LP+ L  +  L +L ++GC L  +P +  K    ++I YL+ L
Sbjct:  123 HLIELFLYDNKLTSLPSEIGLLKNLQRLWLQENSLTFLPDELGSCSKLTHLDIRHNRLEGSIPIMITKLTFVKQLYLTYNKLTDIATIGNLCLLETLVVKSNQLQGPIPDCIGNLTQLKTLDLSKNRLTKITENIGNCKLLSRFLVDYNQIDKLPKSIGQLTELTVLGIKYNCLTELPDEICNCEKLTELNIEGNRIAQLPENLLCHLKDSPSIVLSHNDFNAFPIGDRKQFKNVKHFRLDYNRLELFEAVLLSENTQLTTLNLCNNNIIILDFTGIEKLKHLVELHLSYNQISHLPDSIGELVSLEVLDLTSNRLEALPNGIGELVKLVQLEVESNQITSLPLTIGQLCQLQILNLDVNKLSRLPSTIGNLHNLKKLRVKENLLQRLPPEIGRLANLTHLYLSNNKPLDILPIELGAISGLRYLGIDGCNLRQMPIDVAKGGSASIIKYLRNL 576          

HSP 2 Score: 80.1073 bits (196), Expect = 9.371e-12
Identity = 72/231 (31.17%), Postives = 130/231 (56.28%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKE---LWMQENIIDSLPI-EMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD--GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINL 1142
            + LTEL I GN+I++LP+ +  L +LK+   + +  N  ++ PI + K  K ++H  + +N L     ++L+    L  L + +N    LD  GI +LK L  L +  N++   L  S+G+L  +  LDL+ NR+  +PN +GE  KL +L  E N+I  LP TIG L +L+ + +  N+L ++P ++ +   LK+L ++ N ++ +P  I  +   +    +S+NK +++
Sbjct:  307 EKLTELNIEGNRIAQLPENL--LCHLKDSPSIVLSHNDFNAFPIGDRKQFKNVKHFRLDYNRLELFEAVLLSENTQLTTLNLCNNNIIILDFTGIEKLKHLVELHLSYNQIS-HLPDSIGELVSLEVLDLTSNRLEALPNGIGELVKLVQLEVESNQITSLPLTIGQLCQLQILNLDVNKLSRLPSTIGNLHNLKKLRVKENLLQRLPPEIG-RLANLTHLYLSNNKPLDI 533          

HSP 3 Score: 67.0106 bits (162), Expect = 1.104e-7
Identity = 87/307 (28.34%), Postives = 143/307 (46.58%), Query Frame = 3
Query:  726 DGIGRLKKLETLTVKGNKLEGS--LTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLK-VLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFP-SCIVKLKNLEMLNVSENFFAELP 1634
            D  G++  L T + K N L+GS  +  S G+L     LDLS   +V +  ++G  + L  L    NK+  LP  IG LK L+ + ++ N L  +P+ L  C  L  L+I  N +E     ++ K   + +  +++NK  ++               A   N+  +   VV +  L+  +  C  NL++L++LD           L+ N L+ + ++I     L    +  N +  LPK IG L  L  L ++ N L ++PDE C  EKL  LNI  N++   P + +  LK+   + +S N F   P
Sbjct:   72 DDSGKIISL-TKSRKSNHLDGSKLILNSKGRL----ILDLSSLGLVNLSPDIGSLSHLIELFLYDNKLTSLPSEIGLLKNLQRLWLQENSLTFLPDELGSCSKLTHLDIRHNRLEGSIPIMITKLTFVKQLYLTYNKLTDI---------------ATIGNLCLLETLVVKSNQLQGPIPDCIGNLTQLKTLD-----------LSKNRLTKITENIGNCKLLSRFLVDYNQIDKLPKSIGQLTELTVLGIKYNCLTELPDEICNCEKLTELNIEGNRIAQLPENLLCHLKDSPSIVLSHNDFNAFP 347          
BLAST of SMED30008716 vs. TrEMBL
Match: A0A1V9XVE2 (Leucine-rich repeat protein soc-2-like OS=Tropilaelaps mercedesae OX=418985 GN=BIW11_07072 PE=4 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.284e-68
Identity = 181/456 (39.69%), Postives = 263/456 (57.68%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL----DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVN-AQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            +L ELY+YGNK+S LP EIG L+NL  L + EN + SLP  + + K L+ LD+RHN  T+   ++        + L    +F R+    + I  L  L  L+++ NK+  SL   +G+L  +VT D S N +  +P  LG C  L  L+ ++N++V++PE+IGNLK L  +G++YNQL  IPE LS+C L++E N+ESN+I  +P  ++  F Q+    +S N+F + P     +   +   N E+N+I++I  S+ + A++L  LN+  N LS L  LDI     +++LNL  N L+ +P DI  L  LE L L+NNLL  LP  IG L  L+ L+LE N L ++P+E   L  L+ L + SNQL+  P  +  L +L  LNV EN    LP+ I  L+ L  L+L DN  L+ LP  LA   NL  +S+  CPL  IP E     P  VI YLK
Sbjct:   89 HLAELYLYGNKLSTLPNEIGGLVNLSTLALSENSLTSLPESLANLKQLKVLDLRHNKFTEIPSVIYALRSLTTLFL----RFNRIREVSESISALTNLTMLSLRENKIR-SLPSGIGQLQQLVTFDASNNHLSQLPEALGNCVNLSALDVQHNELVDIPESIGNLKNLTRLGLRYNQLTSIPERLSECTLMQEFNVESNNISVLPEGLLSSFTQLTSLTLSRNQFASYPTGGPGQFTSVTSINLEHNHITKIPFSIFSRAKNLSKLNMKDNLLSSL-PLDIGTWTNMVELNLGTNQLTKIPDDIQYLHSLEVLVLSNNLLRRLPGSIGGLTKLRVLDLEENKLEQLPNEIGFLHDLQKLMVQSNQLQNLPRAVGHLTSLSYLNVGENNLQHLPEEIGTLESLESLYLNDNP-LHALPFELALCSNLQIMSIENCPLSQIPAEIVNGGPSLVIQYLK 537          

HSP 2 Score: 68.9366 bits (167), Expect = 2.437e-8
Identity = 86/327 (26.30%), Postives = 152/327 (46.48%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTK-LKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESI--KIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEI 1436
            Q L       N +S+LP+ +GN +NL  L +Q N +  +P  + + K L  L +R+N LT     +    +     + ++N     +G +    +L +LT+  N+     T   G+   + +++L  N I  IP  +    K L +LN + N +  LP  IG    +  + +  NQL KIP+ +     L+ L + +N +  +P +I     ++   ++  NK   L + PN       ++K   + N +  +  +V +  SL  LN+  NNL  L   +I  L  L  L L  N L  LP +++  S+L+ + + N  L+ +P EI
Sbjct:  203 QQLVTFDASNNHLSQLPEALGNCVNLSALDVQHNELVDIPESIGNLKNLTRLGLRYNQLTSIPERLSECTLMQEFNVESNNISVLPEGLLSSFTQLTSLTLSRNQFASYPTGGPGQFTSVTSINLEHNHITKIPFSIFSRAKNLSKLNMKDNLLSSLPLDIGTWTNMVELNLGTNQLTKIPDDIQYLHSLEVLVLSNNLLRRLPGSIG-GLTKLRVLDLEENK---LEQLPNEIGFLHDLQKLMVQSNQLQNLPRAVGHLTSLSYLNVGENNLQHLPE-EIGTLESLESLYLNDNPLHALPFELALCSNLQIMSIENCPLSQIPAEI 524          
BLAST of SMED30008716 vs. Ensembl Cavefish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 211.846 bits (538), Expect = 9.793e-60
Identity = 167/451 (37.03%), Postives = 259/451 (57.43%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LTELY+Y NK+  LP E+G L  L  L + EN + SLP  + + K L+ LD+RHN L +   +V        + L  +   T    I  L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N++++LPETIGNL  +  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P  ++     +    ++ N F + P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+DI  L+ LE L L+NNLL  LP  IG L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:   77 LTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVTSLTTLYLRFNRITTVEKDIRNLAKLTMLSIRENKIK-QLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLSSINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDICGLASLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 525          

HSP 2 Score: 63.5438 bits (153), Expect = 4.359e-10
Identity = 88/318 (27.67%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFP-SCIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            LDLSK  I ++P+ + E T+L  L    NK+  LP  +G L  L  + +  N L  +P+SL +   L+ L++  N + EIP A+V +   +    +  N+   + K   + + K+   +   N I ++   +    +L  L++ +N L  L   +I N   + +L+L  N L DLP+ I  LS +  L L  N L+ +P+ +   + L+ LNLE+N +  +P+     L  L +L ++ N  +++P     +   +  LN+  N   ++P  I +    L+ L +KDN  L +LP+      ++  L+L    L  IP
Sbjct:   57 LDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIP-AVVYRVTSLTTLYLRFNRITTVEKDIRNLA-KLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPK-EIGNCTQITNLDLQHNELLDLPETIGNLSSINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-QLTSLPLDFGTWTSMVELNLATNQLTKIP 370          

HSP 3 Score: 60.077 bits (144), Expect = 6.158e-9
Identity = 97/389 (24.94%), Postives = 168/389 (43.19%), Query Frame = 3
Query:  792 LTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKE-----IGMXXXXXXXXXXXXXXXXIPDEFCEL---------------------EKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALDIGLKLHEYLKMSNNKST 1880
            L  S+ +L  +  L L  N++  +P E+G  + L  L    N +  LP+++ NLK+L  + +++N+L +IP  +     L  L +  N I  +   I     ++   +I  NK   LP     E   +   +  +N +  +   + N   +  L+L +N L +L    I NL  +  L L +N LS +P+ +++   LE L+L NN ++ LP+      + +       N   +  +  P +F  +                     + L  LN+  NQL + P       ++  LN++ N   ++P+ I  L  L  L L +N LL  LP  +  ++ L  L L    L  +P E        IAYLK L       + L ++NN+ T
Sbjct:   67 LPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVTSLTTLYLRFNRITTVEKDIR-NLAKLTMLSIRENKIKQLPA-EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPE-TIGNLSSINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLASLEVLILSNN-LLKKLPHGIGNLRKLRELDLEENKLESLPNE--------IAYLKDL-------QKLVLTNNQLT 436          
BLAST of SMED30008716 vs. Ensembl Cavefish
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:555476])

HSP 1 Score: 212.616 bits (540), Expect = 1.133e-59
Identity = 167/451 (37.03%), Postives = 259/451 (57.43%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            LTELY+Y NK+  LP E+G L  L  L + EN + SLP  + + K L+ LD+RHN L +   +V        + L  +   T    I  L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N++++LPETIGNL  +  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P  ++     +    ++ N F + P    S+   I   N E+N I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+DI  L+ LE L L+NNLL  LP  IG L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L+ +S+  CPL  +P +     P  +I +LK
Sbjct:  108 LTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVTSLTTLYLRFNRITTVEKDIRNLAKLTMLSIRENKIK-QLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLSSINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLTKIPEDICGLASLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVAGGPSFIIQFLK 556          

HSP 2 Score: 64.3142 bits (155), Expect = 3.182e-10
Identity = 88/318 (27.67%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFP-SCIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            LDLSK  I ++P+ + E T+L  L    NK+  LP  +G L  L  + +  N L  +P+SL +   L+ L++  N + EIP A+V +   +    +  N+   + K   + + K+   +   N I ++   +    +L  L++ +N L  L   +I N   + +L+L  N L DLP+ I  LS +  L L  N L+ +P+ +   + L+ LNLE+N +  +P+     L  L +L ++ N  +++P     +   +  LN+  N   ++P  I +    L+ L +KDN  L +LP+      ++  L+L    L  IP
Sbjct:   88 LDLSKRSIHLLPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIP-AVVYRVTSLTTLYLRFNRITTVEKDIRNLA-KLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPK-EIGNCTQITNLDLQHNELLDLPETIGNLSSINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDN-QLTSLPLDFGTWTSMVELNLATNQLTKIP 401          

HSP 3 Score: 60.8474 bits (146), Expect = 4.032e-9
Identity = 97/389 (24.94%), Postives = 168/389 (43.19%), Query Frame = 3
Query:  792 LTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKE-----IGMXXXXXXXXXXXXXXXXIPDEFCEL---------------------EKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALDIGLKLHEYLKMSNNKST 1880
            L  S+ +L  +  L L  N++  +P E+G  + L  L    N +  LP+++ NLK+L  + +++N+L +IP  +     L  L +  N I  +   I     ++   +I  NK   LP     E   +   +  +N +  +   + N   +  L+L +N L +L    I NL  +  L L +N LS +P+ +++   LE L+L NN ++ LP+      + +       N   +  +  P +F  +                     + L  LN+  NQL + P       ++  LN++ N   ++P+ I  L  L  L L +N LL  LP  +  ++ L  L L    L  +P E        IAYLK L       + L ++NN+ T
Sbjct:   98 LPSSIKELTQLTELYLYSNKLQSLPPEVGCLSGLVTLALSENSLTSLPDSLDNLKKLRMLDLRHNKLREIPAVVYRVTSLTTLYLRFNRITTVEKDIR-NLAKLTMLSIRENKIKQLPA-EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPE-TIGNLSSINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLTKIPEDICGLASLEVLILSNN-LLKKLPHGIGNLRKLRELDLEENKLESLPNE--------IAYLKDL-------QKLVLTNNQLT 467          
BLAST of SMED30008716 vs. Ensembl Cavefish
Match: erbin (erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GENE-061103-403])

HSP 1 Score: 100.523 bits (249), Expect = 1.357e-21
Identity = 115/402 (28.61%), Postives = 181/402 (45.02%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL--DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTH 1667
            Q L  L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK+L  ++   N      L    + +     L  ++ F        GRL KL+ L ++ N+L+  L KS+ KL  +  LDL  N    +P  L + T +K L  + NK+  +P  +G LK+L ++ +  N +E + E ++ C  L++L                         +S+N    LP                        GS+ + + L  L +  N L  L    I  L  L +L+ +FN +  LP  I +  +L +    +N L+ LP E+G  KN   L L SN L  +P+E  +++KLK +N+S N+LK  P    KL  +  + +SEN    L     E D  TH
Sbjct:   57 QLLHRLSLPDNDLTVLPPAIANLINLRELDVSKNSIQEFPENIKNCKVLTIVEASVN--PISKLPEGFTQLLSLTQLYLNDAFLEFLPASFGRLTKLQILELRENQLK-MLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIKELWMDGNKLTMVPGMVGMLKQLTYLDVSKNNVELVDEQINGCENLQDLL------------------------LSNNALTQLP------------------------GSIGSLKKLTALKVDENQLVCLPD-SIGGLSALDELDCSFNEIESLPAAIGQCVNLRTFAADHNFLSQLPPEMGCWKNATVLFLHSNKLESLPEEMGDMQKLKVVNLSDNKLKNLPYSFTKLNQMTAMWLSENQSKPLIPLQKEEDPETH 406          

HSP 2 Score: 81.2629 bits (199), Expect = 1.456e-15
Identity = 94/375 (25.07%), Postives = 156/375 (41.60%), Query Frame = 3
Query:  732 IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI----------------------VLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
             G  K LE L +  N++E  L K L     +  L L  N + ++P  +     L+ L+   N I E PE I N K L  +    N + K+PE  +    L +L +    +E +P++                       + K  Q+ + ++  N+F  +P+    +   I++   + N ++ + G V   + L  L++  NN+ EL    I     L DL L+ N L+ LP  I  L  L +L +  N L  LP  IG                        L  L  L+ S N++++ P+ I +  NL       NF ++LP  +      T LFL  N  L +LP  +  M+ L  ++L+   L ++P  + K
Sbjct:   30 FGFEKTLEELYLDANQIE-ELPKQLFNCQLLHRLSLPDNDLTVLPPAIANLINLRELDVSKNSIQEFPENIKNCKVLTIVEASVNPISKLPEGFTQLLSLTQLYLNDAFLEFLPASFGRLTKLQILELRENQLKMLPKSMHKLTQLERLDLGSNEFTEVPEV-LEQLTGIKELWMDGNKLTMVPGMVGMLKQLTYLDVSKNNV-ELVDEQINGCENLQDLLLSNNALTQLPGSIGSLKKLTALKVDENQLVCLPDSIGG-----------------------LSALDELDCSFNEIESLPAAIGQCVNLRTFAADHNFLSQLPPEMGCWKNATVLFLHSNK-LESLPEEMGDMQKLKVVNLSDNKLKNLPYSFTK 377          

HSP 3 Score: 60.4622 bits (145), Expect = 5.057e-9
Identity = 60/219 (27.40%), Postives = 108/219 (49.32%), Query Frame = 3
Query: 1095 QQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            + + + + SH     +PK        +E+   + N I  +   + N Q L  L+L  N+L+ L    I NL+ L +L+++ N + + P++I     L  ++ + N ++ LP+    L +L  L L    L  +P  F  L KL+ L +  NQLK  P  + KL  LE L++  N F E+P+ + +L  +  L++  N  L  +P  +  +K L +L ++
Sbjct:   10 ETVTQLDYSHCSLEQVPKEIFGFEKTLEELYLDANQIEELPKQLFNCQLLHRLSLPDNDLTVLPPA-IANLINLRELDVSKNSIQEFPENIKNCKVLTIVEASVNPISKLPEGFTQLLSLTQLYLNDAFLEFLPASFGRLTKLQILELRENQLKMLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIKELWMDGNK-LTMVPGMVGMLKQLTYLDVS 226          
BLAST of SMED30008716 vs. Ensembl Cavefish
Match: erbin (erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GENE-061103-403])

HSP 1 Score: 100.908 bits (250), Expect = 2.472e-21
Identity = 115/402 (28.61%), Postives = 181/402 (45.02%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL--DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTH 1667
            Q L  L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK+L  ++   N      L    + +     L  ++ F        GRL KL+ L ++ N+L+  L KS+ KL  +  LDL  N    +P  L + T +K L  + NK+  +P  +G LK+L ++ +  N +E + E ++ C  L++L                         +S+N    LP                        GS+ + + L  L +  N L  L    I  L  L +L+ +FN +  LP  I +  +L +    +N L+ LP E+G  KN   L L SN L  +P+E  +++KLK +N+S N+LK  P    KL  +  + +SEN    L     E D  TH
Sbjct:   59 QLLHRLSLPDNDLTVLPPAIANLINLRELDVSKNSIQEFPENIKNCKVLTIVEASVN--PISKLPEGFTQLLSLTQLYLNDAFLEFLPASFGRLTKLQILELRENQLK-MLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIKELWMDGNKLTMVPGMVGMLKQLTYLDVSKNNVELVDEQINGCENLQDLL------------------------LSNNALTQLP------------------------GSIGSLKKLTALKVDENQLVCLPD-SIGGLSALDELDCSFNEIESLPAAIGQCVNLRTFAADHNFLSQLPPEMGCWKNATVLFLHSNKLESLPEEMGDMQKLKVVNLSDNKLKNLPYSFTKLNQMTAMWLSENQSKPLIPLQKEEDPETH 408          

HSP 2 Score: 80.8777 bits (198), Expect = 3.087e-15
Identity = 94/375 (25.07%), Postives = 156/375 (41.60%), Query Frame = 3
Query:  732 IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI----------------------VLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
             G  K LE L +  N++E  L K L     +  L L  N + ++P  +     L+ L+   N I E PE I N K L  +    N + K+PE  +    L +L +    +E +P++                       + K  Q+ + ++  N+F  +P+    +   I++   + N ++ + G V   + L  L++  NN+ EL    I     L DL L+ N L+ LP  I  L  L +L +  N L  LP  IG                        L  L  L+ S N++++ P+ I +  NL       NF ++LP  +      T LFL  N  L +LP  +  M+ L  ++L+   L ++P  + K
Sbjct:   32 FGFEKTLEELYLDANQIE-ELPKQLFNCQLLHRLSLPDNDLTVLPPAIANLINLRELDVSKNSIQEFPENIKNCKVLTIVEASVNPISKLPEGFTQLLSLTQLYLNDAFLEFLPASFGRLTKLQILELRENQLKMLPKSMHKLTQLERLDLGSNEFTEVPEV-LEQLTGIKELWMDGNKLTMVPGMVGMLKQLTYLDVSKNNV-ELVDEQINGCENLQDLLLSNNALTQLPGSIGSLKKLTALKVDENQLVCLPDSIGG-----------------------LSALDELDCSFNEIESLPAAIGQCVNLRTFAADHNFLSQLPPEMGCWKNATVLFLHSNK-LESLPEEMGDMQKLKVVNLSDNKLKNLPYSFTK 379          

HSP 3 Score: 62.3882 bits (150), Expect = 1.697e-9
Identity = 60/225 (26.67%), Postives = 112/225 (49.78%), Query Frame = 3
Query: 1077 AIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            ++ ++ + + + + SH     +PK        +E+   + N I  +   + N Q L  L+L  N+L+ L    I NL+ L +L+++ N + + P++I     L  ++ + N ++ LP+    L +L  L L    L  +P  F  L KL+ L +  NQLK  P  + KL  LE L++  N F E+P+ + +L  +  L++  N  L  +P  +  +K L +L ++
Sbjct:    6 SLFVRLETVTQLDYSHCSLEQVPKEIFGFEKTLEELYLDANQIEELPKQLFNCQLLHRLSLPDNDLTVLPPA-IANLINLRELDVSKNSIQEFPENIKNCKVLTIVEASVNPISKLPEGFTQLLSLTQLYLNDAFLEFLPASFGRLTKLQILELRENQLKMLPKSMHKLTQLERLDLGSNEFTEVPEVLEQLTGIKELWMDGNK-LTMVPGMVGMLKQLTYLDVS 228          
BLAST of SMED30008716 vs. Ensembl Cavefish
Match: lrrc1 (leucine rich repeat containing 1 [Source:NCBI gene;Acc:103023999])

HSP 1 Score: 95.9005 bits (237), Expect = 5.085e-20
Identity = 111/410 (27.07%), Postives = 181/410 (44.15%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL-DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFN---AEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDN 1685
            ++L EL +  N++  LPK+   L+ L++L + +N I  LP E+ +   L  LD+  N    +    ++    L++   + N  TRL D    L+ L  L++    L+ +L  ++G L  +V+L+L +N +  +P  L +  +L+ L+   N++  LPETIG L  L+ + +  NQL +IP  L                           + ++  ++S NK   LP+    ES  +          N I  +   +   + L +L    N L +L    I +   L +L L  NHL  LP+ I +L  L + +   N LT+LPKEIG                           L  L +  N+L   PS + +   L + +VS N  A LP S+  L RL  L+L DN
Sbjct:   36 RSLEELLLDANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRND-IIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQ-ALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELG------------------------SMKNLLCLDLSENKLERLPE----ESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPE-SIGSCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNRLTSLPKEIG-----------------------GCSSLNVLCVRDNRLSRIPSELSQATELHVFDVSGNRLAFLPMSLTTL-RLKALWLSDN 390          

HSP 2 Score: 82.4185 bits (202), Expect = 7.458e-16
Identity = 102/350 (29.14%), Postives = 169/350 (48.29%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESI----KIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSEL--QSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            + LE L +  N+L   L K   +L  +  L LS N I  +P E+    +L  L+   N I+E+P++I   K L+      N L ++P+S  +   L  L+I   S++ +P  I      ++   +  N    LP     ES+    ++E+ +   N +  +  ++    SLK L L  N L+E+  +   ++NL+C   L+L+ N L  LP++ + L+ L  L ++ NL+  LP+ IG LK L  L  + N L+++P+     E L  L ++ N L + P  I KLK L   N   N    LPK I     L  L ++DN  L+ +P  L+    L+   ++G  L  +P
Sbjct:   36 RSLEELLLDANQLR-DLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKALQVADFSGNPLTRLPDSFPELRNLTCLSINDISLQALPDNIG-NLCNLVSLELRENMLTYLP-----ESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLC---LDLSENKLERLPEESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNRLTSLPKEIGGCSSLNVLCVRDN-RLSRIPSELSQATELHVFDVSGNRLAFLP 374          

HSP 3 Score: 78.9518 bits (193), Expect = 8.775e-15
Identity = 109/391 (27.88%), Postives = 167/391 (42.71%), Query Frame = 3
Query:  837 LSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPK-FPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDI-QNLVCLI-----------DLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNIL----------------------LNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALDIGLKLHEYLKMSNNKSTEKSLFSSD 1904
            L  N++  +P +  +  KL++L    N+I  LP  I N  +L  + +  N + +IP+S+S C  L                      Q+  F  S N    LP  FP            E  N++ +S   +N  SL+ L     NL  L SL++ +N++  +           +L+L  N L +LP+ I  L  L+ L L  N L  +P E+G +KNL  L+L  N L ++P+E   L  L +L +S N +   P  I KLK L +L   +N   +LP+SI   + LT L L +N L                      L +LP  + G  +LN L +    L  IP E  ++       L   D+      +L MS      K+L+ SD
Sbjct:   43 LDANQLRDLPKQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNDIIEIPDSISFCKAL----------------------QVADF--SGNPLTRLPDSFP------------ELRNLTCLS---INDISLQALPDNIGNLCNLVSLELRENMLTYLPESLCQLNRLEELDLGNNELYNLPETIGCLVSLKDLWLDGNQLAEIPPELGSMKNLLCLDLSENKLERLPEESAGLNSLTDLLVSQNLIDALPEGIGKLKRLSILKADQNRLVQLPESIGSCESLTELVLTENHLMSLPRSIGKLKKLSNFNCDRNRLTSLPKEIGGCSSLNVLCVRDNRLSRIPSELSQA-----TELHVFDVSGNRLAFLPMSLTTLRLKALWLSD 389          
BLAST of SMED30008716 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004940.1 (pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-1 gene:ENSPMAG00000004448.1 transcript:ENSPMAT00000004940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.46 bits (537), Expect = 3.113e-60
Identity = 166/452 (36.73%), Postives = 263/452 (58.19%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD-GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKS-PITVIAYLK 1820
            LTELY+YGN++  LP EIG L+NL  L + EN +  LP  +     L+ LD+RHN L     +V        + L   N+ T+++  IG L KL  L+V+ NK++  L   +G+L  ++TLD++ N++  +P E+G C ++  L+ ++N++++LP++IGNL  L  +G++YN+L  +P +L++C  L++LN+E+N+I  +P  ++     +    ++ N F   P    S+   +   N E+N+I +I  G    A++L  LN+  N L+ L  LDI     +++LNLA N L+ +P DIS L+ LE L L+NNLL  LP  +G L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL + P  I  L +L  L V EN    +P+ I  L+ L  L+L DN  L+ LP  LA    L  +S+  CPL  +PG    S P  +I YLK
Sbjct:   74 LTELYLYGNRLPCLPTEIGCLVNLVTLALNENSLTGLPDTLTGLTSLRMLDLRHNKLRSIPPVVYRLTSLTVLYLR-FNRITQVEKDIGNLSKLTMLSVRENKIK-LLPAEIGELRSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLENNNISTLPEGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTTVYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQLTSL-PLDIGTWKSMVELNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHLCSLTHLMVGENQLTHVPEEIGTLENLEELYLNDNPNLHNLPFELALCSKLLIMSIENCPLSQLPGPIVSSGPSFIIQYLK 522          

HSP 2 Score: 51.6026 bits (122), Expect = 4.765e-7
Identity = 71/309 (22.98%), Postives = 128/309 (41.42%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKG-NKLEGSLTKSLGKLHCMVTLDLSKNRIVIIP-NELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLE 1388
            ++L  L +  N++  LP+EIGN + +  L +Q N +  LP  + +   L  L +R+N L+     +        + L  +N  T  +G+       +      N  +        +   + +L++  N I  IP         L +LN + N++  LP  IG  K +  + +  NQL KIP+ +S+   L+ L                         +S+N    LP    +   K+ + + E N +  +   +   + L+ L L  N L+ L    I +L  L  L +  N L+ +P++I  L +LE
Sbjct:  187 RSLLTLDVAHNQLEHLPEEIGNCVQVTNLDLQHNELLDLPDSIGNLASLNRLGLRYNRLSAVPTTLANCTELEDLNLENNNISTLPEGLLSSLVNLSSLTLARNCFQAYPVGGPSQFTTVYSLNMEHNHIGKIPFGIFSRAKALSKLNMKDNQLTSLPLDIGTWKSMVELNLATNQLTKIPDDISELTSLEILV------------------------LSNNLLRKLPHGLGNLR-KLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPR-GIGHLCSLTHLMVGENQLTHVPEEIGTLENLE 469          
BLAST of SMED30008716 vs. Ensembl Sea Lamprey
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 97.0561 bits (240), Expect = 6.037e-21
Identity = 97/357 (27.17%), Postives = 164/357 (45.94%), Query Frame = 3
Query:  738 RLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSA--IVLKFQQMIKFNISHNKFINLP----KFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            RL  L  L +  N+L+  L   +     +V LD+S+N I  IP+ +  CT L+ ++F  N +  LPE    LK L ++ +    L+ +P+ + +   L  L +  N ++ +P++  +++K +Q+   ++ +N+   LP      PN     + +   + N +  +   +   + L  L++  N L  L    I  L  L D   + NHL +LP+++ +L HL  L    N LT LP+ IG                       + E L  L ++ NQL T P+ I KL  L  LN+ +N    +P  I     L  L L+DN  L  +P  ++G   ++ L L G  L ++P E  K
Sbjct:    4 RLHNLRKLGLSDNELQ-RLPPDIANFMHLVDLDMSRNDIAEIPDSIKLCTCLEVVDFSGNPLTRLPEGFTQLKSLIYLSLNDVSLQGLPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQL---DLGNNELETLPGSLGSLPN-----VRELWLDGNQLEALPSEIGELRRLVCLDISQNRLERLPDA-IGGLAALTDFLASQNHLEELPEELGKLKHLSILKADQNRLTHLPEAIG-----------------------DCENLTELILTENQLVTLPASIGKLTKLTNLNLDKNRLNSIPPEIGGCGALNVLSLRDN-RLTQVPGEISGASQIHVLDLAGNRLENLPIELAK 326          

HSP 2 Score: 96.2857 bits (238), Expect = 1.012e-20
Identity = 75/271 (27.68%), Postives = 133/271 (49.08%), Query Frame = 3
Query:  483 LYIYGNKIS--KLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINL-PKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSEL 1283
            +Y+  N +S   LP +IGNL NL  L ++EN++ +LP  +     L+ LD+                         +N+   L G +G L  +  L + GN+LE +L   +G+L  +V LD+S+NR+  +P+ +G    L       N + ELPE +G LK L  +    N+L  +PE++ DC  L EL +  N +  +P++I  K  ++   N+  N+  ++ P+     ++ +   +   N ++++ G +  A  + VL+L  N L  L
Sbjct:   78 IYLSLNDVSLQGLPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDL------------------------GNNELETLPGSLGSLPNVRELWLDGNQLE-ALPSEIGELRRLVCLDISQNRLERLPDAIGGLAALTDFLASQNHLEELPEELGKLKHLSILKADQNRLTHLPEAIGDCENLTELILTENQLVTLPASIG-KLTKLTNLNLDKNRLNSIPPEIGGCGALNV--LSLRDNRLTQVPGEISGASQIHVLDLAGNRLENL 320          

HSP 3 Score: 92.0485 bits (227), Expect = 2.043e-19
Identity = 104/386 (26.94%), Postives = 179/386 (46.37%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL-DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSL--DIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSEN 1616
             NL +L +  N++ +LP +I N ++L +L M  N I  +P  +K C  L+ +D                         + N  TRL +G  +LK L  L++    L+G L   +G L  +VTL+L +N +  +P  L    KL++L+   N++  LP ++G+L  +  + +  NQLE +P  + +                         ++++  +IS N+   LP      +  +  F A  N++  +   +   + L +L    N L+ L     D +NL  LI   L  N L  LP  I +L+ L +L+L  N L ++P EIG    L  L+L  N L ++P E     ++  L+++ N+L+  P  + KL +L+ L +SEN
Sbjct:    6 HNLRKLGLSDNELQRLPPDIANFMHLVDLDMSRNDIAEIPDSIKLCTCLEVVDF------------------------SGNPLTRLPEGFTQLKSLIYLSLNDVSLQG-LPDDIGNLSNLVTLELRENLLKTLPTSLHLLVKLEQLDLGNNELETLPGSLGSLPNVRELWLDGNQLEALPSEIGE------------------------LRRLVCLDISQNRLERLPDAIGGLA-ALTDFLASQNHLEELPEELGKLKHLSILKADQNRLTHLPEAIGDCENLTELI---LTENQLVTLPASIGKLTKLTNLNLDKNRLNSIPPEIGGCGALNVLSLRDNRLTQVPGEISGASQIHVLDLAGNRLENLPIELAKL-SLKALWLSEN 337          
BLAST of SMED30008716 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008894.1 (pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 gene:ENSPMAG00000008055.1 transcript:ENSPMAT00000008894.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 4.529e-16
Identity = 98/381 (25.72%), Postives = 170/381 (44.62%), Query Frame = 3
Query:  501 KISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL-DGIGRLKKLETLTVKGNKLEG-SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIG-NLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISH--NKFINLPKFPNS-ESI-KIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLES--XXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSEN 1616
            K    P+ IG + +L+ L +    +  LP E+   + L+HL +                        +HN+ T L   I  L  L  +  + N+L    +   +  L  +  LDLS N++  +PNEL     +  LN  +N I  +P  +  NL ++ ++ +  N+L+ +P  +     L+ L + +N +     A + +   M      H  N    L   P   E++  +   +  +N ++R+   +    +L+ LNL  N+++EL SL +     L  LNL+ N L+ LP  IS+L+ L    ++        +P  +  L NL+      N L  IP+  C   KLK L ++ N+L T P  +  L +LE+L+V EN
Sbjct:   21 KGGNFPERIGAMSSLRWLKLNHTGLSYLPEELAVLQKLEHLSV------------------------SHNQLTTLHSDITALPCLRAIVARANQLTNPGVPPDIFNLEDLSVLDLSHNQLTEVPNELENAKNMLVLNLSHNSIETIPTQLFINLTDVLYLDLSNNRLDSLPPQMRRLVHLQTLMLNNNPLL---HAQLRQLTAMTALETLHMRNTQRTLSNLPTQLEALTHLADVDLSHNELARVPECLYTLSALRRLNLSDNHITEL-SLCMDQWTQLQTLNLSRNQLTSLPSSISKLAKLRKLFVNSNRLDFEGIPSSVWKLGNLEQFVAADNNLELIPESLCRCAKLKKLVLNKNRLITLPELVHYLTDLEVLDVREN 373          

HSP 2 Score: 74.3294 bits (181), Expect = 5.089e-14
Identity = 83/340 (24.41%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  801 SLGKLHCMVTLDLSKNRIVI--IPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLES--------------------------XXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNIL-LNTLPVTLAGMKNL 1733
            S G L  +  +DLS N       P  +G  + L+ L   +  +  LPE +  L++LE + + +NQL  +   ++    L+              AIV +  Q+    +        P   N E + +   +  +N ++ +   + NA+++ VLNL +N++  + +    NL  ++ L+L+ N L  LP  + RL HL++                          +  T   L+ LP ++  L +L  ++L  N L ++P+    L  L+ LN+S N +     C+ +   L+ LN+S N    LP SI++L +L  LF+  N L    +P ++  + NL
Sbjct:    3 STGVLPFVRGIDLSGNDFKGGNFPERIGAMSSLRWLKLNHTGLSYLPEELAVLQKLEHLSVSHNQLTTLHSDITALPCLR--------------AIVARANQLTNPGVP-------PDIFNLEDLSV--LDLSHNQLTEVPNELENAKNMLVLNLSHNSIETIPTQLFINLTDVLYLDLSNNRLDSLPPQMRRLVHLQTLMLNNNPLLHAQLRQLTAMTALETLHMRNTQRTLSNLPTQLEALTHLADVDLSHNELARVPECLYTLSALRRLNLSDNHITELSLCMDQWTQLQTLNLSRNQLTSLPSSISKLAKLRKLFVNSNRLDFEGIPSSVWKLGNL 319          

HSP 3 Score: 50.447 bits (119), Expect = 1.178e-6
Identity = 51/193 (26.42%), Postives = 87/193 (45.08%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIG-NLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGS-LTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKEL 1040
            +N+  L +  N I  +P ++  NL ++  L +  N +DSLP +M+    LQ L + +N                    + H +  +L     +  LETL ++  +   S L   L  L  +  +DLS N +  +P  L   + L+RLN   N I EL   +    +L+ + +  NQL  +P S+S    L++L
Sbjct:  127 KNMLVLNLSHNSIETIPTQLFINLTDVLYLDLSNNRLDSLPPQMRRLVHLQTLMLNNN-------------------PLLHAQLRQLTA---MTALETLHMRNTQRTLSNLPTQLEALTHLADVDLSHNELARVPECLYTLSALRRLNLSDNHITELSLCMDQWTQLQTLNLSRNQLTSLPSSISKLAKLRKL 297          
BLAST of SMED30008716 vs. Ensembl Sea Lamprey
Match: lrrc40 (leucine rich repeat containing 40 [Source:NCBI gene;Acc:334130])

HSP 1 Score: 77.7962 bits (190), Expect = 3.994e-15
Identity = 122/466 (26.18%), Postives = 209/466 (44.85%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCG------LLKELXXXXXXXXXXP---SAIVLKFQQMI-KFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSEL--QSLDIQNLVCLIDLNLAFNHLSDLPKD---ISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKS-INELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPL-GDIPGEYRKSPITVIAYLK 1820
            L EL +  N+++ LP  +G L  + +L + EN +  LP E+KS K L  L+  HN L +     L  + +L+ L + HN+   L  +     L+ L V  N++     + L  L  +  LDL  N++  +P+E+     L+RL+   N I  LP  +GNL +L+ + ++ N L  I   + + G       L+    E    E+ P   +A+ L  Q  I  F IS  K ++      +  I  E F A       I GS V A     ++   N LS +  + ++++++V   D+N+ FN +S L  +   +  L+HL+                          L +N L  +P+E   L +L+++ IS N+ +  P  + ++  LE L  S+N    +  + +  L+RL  L L++N  +  +P  L    +L  L L G       P    K   T++ YL+
Sbjct:  178 LEELDLSSNRLTALPGTLGKLTRVTKLNVAENKLRELPTEIKSMKGLCQLEATHN-LLESVPAALGGMASLQQLYLRHNRLKSLPELHNCAALKELHVGNNQISELGPEHLRPLGAISVLDLRDNKLKELPDEVTLLHGLERLDLTNNDISSLPNALGNLGKLKSLALEGNPLRAIRRDIINRGTQEILKFLRSRIEEPTGSEDSPDTVTAMTLPSQGGINAFTISAQKALHY-SGKKAADIPDEVFEA-------IRGSTVTA-----VDFSKNQLSTIPPRIVELKDMVT--DVNVGFNKISVLSLELCMLGNLTHLD--------------------------LRNNALSSLPNEMEALSRLQSIIISCNRFREIPPVLYRVGTLETLLASDNQIGVVDATGLRSLERLGTLDLQNND-ITVVPPQLGLCVSLRSLLLGGNRFRSPRPALLSKGTATLLEYLR 600          

HSP 2 Score: 77.0258 bits (188), Expect = 6.778e-15
Identity = 113/455 (24.84%), Postives = 191/455 (41.98%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL-DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEY----RKSPITVIAYLK 1820
            +LT+L +  N++  L  ++  L  L  L + +N +  LP  +     LQ L++                        +HNK   L + +  +  L +L V+ N+LEG ++ ++G L  +  LDLS NR+  +P  LG+ T++ +LN   NK+ ELP  I ++K L  +   +N LE +P +L     L++L                         + HN+  +LP+                           N  +LK L++  N +SEL    ++ L  +  L+L  N L +LP +++ L  LE LDLTNN +++LP  +G                        L KLK+L +  N L+     I+     E+L    +   E   S +  D +T + L     +N    T++  K L++   +G    DIP E     R S +T + + K
Sbjct:   85 DLTKLILASNRLRALSDDLQLLPALTVLDVHDNQLTELPQVLGELVNLQKLNV------------------------SHNKLQTLPESLWAISSLLSLHVEHNELEG-ISNNIGNLARLEELDLSSNRLTALPGTLGKLTRVTKLNVAENKLRELPTEIKSMKGLCQLEATHNLLESVPAALGGMASLQQLY------------------------LRHNRLKSLPELH-------------------------NCAALKELHVGNNQISELGPEHLRPLGAISVLDLRDNKLKELPDEVTLLHGLERLDLTNNDISSLPNALG-----------------------NLGKLKSLALEGNPLRAIRRDIINRGTQEILKFLRSRIEEPTGSEDSPDTVTAMTLPSQGGINAF--TISAQKALHY---SGKKAADIPDEVFEAIRGSTVTAVDFSK 437          
BLAST of SMED30008716 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011392.1 (pep scaffold:Pmarinus_7.0:GL489956:7319:8005:-1 gene:ENSPMAG00000010365.1 transcript:ENSPMAT00000011392.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 1.775e-12
Identity = 60/177 (33.90%), Postives = 94/177 (53.11%), Query Frame = 3
Query: 1251 LNLCYNNLSELQSLD--IQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            L L  N L+ + S    ++NLV L    L  N+L   P +I  L  L++L    N L  +P+E+   ++L+ L+L SN L  +PD+   L KL+ LN+S+N L   P C++ +K L  L+VS N    LP S+ EL RL  L  + N  L  LP ++  +  L  L+++   +  +P
Sbjct:    4 LGLWRNRLTTMPSATGRLENLVVL---GLDGNNLIAFPAEIGMLRKLKALFANRNRLVEVPRELAKCQSLEVLSLSSNSLRSLPDDLVALRKLRKLNLSANALGRVPRCVMYMKALTFLDVSYNDIVGLPDSVRELQRLETLIAERN-RLEALPASICEITRLETLNVDYNQIRTVP 176          

HSP 2 Score: 55.8398 bits (133), Expect = 6.693e-9
Identity = 49/176 (27.84%), Postives = 90/176 (51.14%), Query Frame = 3
Query:  789 SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCL 1316
            ++  + G+L  +V L L  N ++  P E+G   KLK L    N++VE+P  +   + LE + +  N L  +P+ L     L++LN+ +N++  +P   V+  + +   ++S+N  + LP     E  ++E   AE N +  +  S+     L+ LN+ YN +  +  LD+  LV L
Sbjct:   13 TMPSATGRLENLVVLGLDGNNLIAFPAEIGMLRKLKALFANRNRLVEVPRELAKCQSLEVLSLSSNSLRSLPDDLVALRKLRKLNLSANALGRVPRC-VMYMKALTFLDVSYNDIVGLPD-SVRELQRLETLIAERNRLEALPASICEITRLETLNVDYNQIRTV-PLDLDQLVRL 185          
BLAST of SMED30008716 vs. Ensembl Yeast
Match: CYR1 (Adenylate cyclase; required for cAMP production and cAMP-dependent protein kinase signaling; the cAMP pathway controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000003542])

HSP 1 Score: 62.003 bits (149), Expect = 2.904e-10
Identity = 86/308 (27.92%), Postives = 143/308 (46.43%), Query Frame = 3
Query:  726 DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQM--IKFNIS--HNKFINLPKFPNSESI--KIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEM--LNVSENFFA 1625
            + I +L  L  L ++ N+LE SL     +L  +  LDLS N+ +  P  +  CT L +++  YNKI  LP++   L +L  + + +N+L  I + LS+   L+ LN              L++ ++  IK N S   N F+   +  N E    K+     + N I+ IS      +++  L L    LS +    +  L  L  L L  N+L+ LP++IS+L+ L                        FL++  N L  IP E  +L+ L+ L++ SN ++ F   +  ++NLE+  LN+S N F 
Sbjct:  880 NSIMKLSNLTILNLQCNELE-SLPAGFVELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQSTKYLVKLAKMNLSHNKLNFIGD-LSEMTDLRTLN--------------LRYNRISSIKTNASNLQNLFLTDNRISNFEDTLPKLRALEIQENPITSISFKDFYPKNMTSLTLNKAQLSSIPGELLTKLSFLEKLELNQNNLTRLPQEISKLTKL-----------------------VFLSVARNKLEYIPPELSQLKSLRTLDLHSNNIRDF---VDGMENLELTSLNISSNAFG 1145          

HSP 2 Score: 53.9138 bits (128), Expect = 9.491e-8
Identity = 78/309 (25.24%), Postives = 142/309 (45.95%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNEL-GECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLP---------KFPNSESIKIEKFNAEYNNISRISGSVVNA-QSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKD 1364
            NL ++ +  NKI  LP+    L+ L ++ +  N ++ +  ++     L+ L++R+N ++                  T N+ +  +    L KL  L ++ N +     K     + M +L L+K ++  IP EL  + + L++L    N +  LP+ I  L +L F+ +  N+LE IP  LS    L+ L++ SN+I +      ++  ++   NIS N F N            + +  S  +  F A  N        + N   +LKVLNL YNN S++  + ++++    +L L+ N L+ L  D
Sbjct:  933 NLLQIDLSYNKIQSLPQSTKYLVKLAKMNLSHNKLNFIG-DLSEMTDLRTLNLRYNRISSIKTNASNLQNLFL----TDNRISNFEDT--LPKLRALEIQENPITSISFKDFYPKN-MTSLTLNKAQLSSIPGELLTKLSFLEKLELNQNNLTRLPQEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDLHSNNIRDFVDG--MENLELTSLNISSNAFGNSSLENSFYHNMSYGSKLSKSLMFFIAADNQFDDAMWPLFNCFVNLKVLNLSYNNFSDVSHMKLESIT---ELYLSGNKLTTLSGD 1228          
BLAST of SMED30008716 vs. Ensembl Yeast
Match: CCR4 (Component of the CCR4-NOT transcriptional complex; CCR4-NOT is involved in regulation of gene expression; component of the major cytoplasmic deadenylase, which is involved in mRNA poly(A) tail shortening [Source:SGD;Acc:S000000019])

HSP 1 Score: 58.151 bits (139), Expect = 3.893e-9
Identity = 34/83 (40.96%), Postives = 45/83 (54.22%), Query Frame = 3
Query:  750 LETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEK 998
            L  L + GN L   L   +  L  +  LDLS NR+  +P ELG C +LK   F  N +  LP   GNL  L+F+G++ N LEK
Sbjct:  359 LTRLYLNGNSLT-ELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEK 440          
BLAST of SMED30008716 vs. Ensembl Nematostella
Match: EDO37499 (Leucine-rich repeat protein soc-2 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7SFP1])

HSP 1 Score: 214.927 bits (546), Expect = 6.023e-61
Identity = 165/456 (36.18%), Postives = 259/456 (56.80%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD----GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVN-AQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            +L ELY+YGN+I+ LP E+G L NL+ L + EN + +LP  +     L+ LD+RHN + +   ++             + +F R+     GIG LK LE L+++ NK++  L + +G+L  +VTLD+S N I  +P E+G C  +  L+ ++N I  LP++IG L  +  +G++YNQL  +P+SL++C  + E NIE N+I E+P  ++   + +    +S NKF   P  P  +  ++  F  E+N + +I   V N A+ L  LN+  N L+ L  LD  + + L++LN+A N +S LP+DI  L +LE L L+NNLL  LP+ IG L+ L+ L++E N L  IP E   L  L+ L + SN L + P  I  L ++  L+V EN    +P+ I  ++ L  L+L DN  L +LP  L    +L  +S+  CPL  +P +     P  VI YL+
Sbjct:  110 SLRELYLYGNRIAVLPPEVGLLPNLETLALSENNLTTLPDNLVKLTKLKVLDLRHNKIKEIPDVIYKLTTLTT----LYLRFNRISVVESGIGNLKLLERLSLRENKIK-ILPRVIGQLVHLVTLDISHNHIENLPAEIGNCVHMTSLDLQHNDIPSLPDSIGRLTAMTRLGLRYNQLSSLPDSLANCSGIDEFNIEGNNIAELPEKLLSSLKNLTSLTLSRNKFEVFPAGPPKQFCQVNTFIMEHNRMQKIPFGVFNKAKYLSKLNVKDNQLTSL-PLDFGSWISLVELNVATNQISKLPEDIQWLVNLEVLILSNNLLKKLPRGIGALRKLRVLDIEENKLESIPTEIEYLRSLERLVLQSNCLGSLPRSIGYLSSVTYLSVGENELVSVPQEIGNMESLEQLYLNDNENLQSLPYELVLCGSLQIMSIENCPLSALPSQIVAGGPSLVIQYLR 559          

HSP 2 Score: 79.7221 bits (195), Expect = 1.863e-15
Identity = 78/269 (29.00%), Postives = 123/269 (45.72%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIV-KLKNLEMLNVSENFFAELP 1634
            LDLSK  + ++P EL E T L+ L    N+I  LP  +G L  LE + +  N L  +P++L                        +K  ++   ++ HNK   +P     +   +      +N IS +   + N + L+ L+L  N +  L  + I  LV L+ L+++ NH+ +LP +I    H+ SLDL +N + +LP  IG L  +  L L  N L  +PD       +   NI  N +   P  ++  LKNL  L +S N F   P
Sbjct:   91 LDLSKAAVTVLPKELKELTSLRELYLYGNRIAVLPPEVGLLPNLETLALSENNLTTLPDNL------------------------VKLTKLKVLDLRHNKIKEIPDV-IYKLTTLTTLYLRFNRISVVESGIGNLKLLERLSLRENKIKILPRV-IGQLVHLVTLDISHNHIENLPAEIGNCVHMTSLDLQHNDIPSLPDSIGRLTAMTRLGLRYNQLSSLPDSLANCSGIDEFNIEGNNIAELPEKLLSSLKNLTSLTLSRNKFEVFP 333          

HSP 3 Score: 78.9518 bits (193), Expect = 3.086e-15
Identity = 103/372 (27.69%), Postives = 175/372 (47.04%), Query Frame = 3
Query:  792 LTKSLGKLHCMVTLDLSKNRIVIIPNELG-----------------------ECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLP-KDISRLSHLESXXXXXXXXXXXPK-EIGMXXXXXXXXXXXXXXXXIP-DEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALD 1829
            L K L +L  +  L L  NRI ++P E+G                       + TKLK L+  +NKI E+P+ I  L  L  + +++N++  +   + +  LL+ L++  N I+ +P  ++ +   ++  +ISHN   NLP    +  + +   + ++N+I  +  S+    ++  L L YN LS L    + N   + + N+  N++++LP K +S L +L SL L+ N     P         +    +E N + KIP   F + + L  LN+  NQL + P       +L  LNV+ N  ++LP+ I  L  L  L L +N LL  LP  +  ++ L  L +    L  IP E        I YL++L+
Sbjct:  101 LPKELKELTSLRELYLYGNRIAVLPPEVGLLPNLETLALSENNLTTLPDNLVKLTKLKVLDLRHNKIKEIPDVIYKLTTLTTLYLRFNRISVVESGIGNLKLLERLSLRENKIKILPR-VIGQLVHLVTLDISHNHIENLPAEIGN-CVHMTSLDLQHNDIPSLPDSIGRLTAMTRLGLRYNQLSSLPD-SLANCSGIDEFNIEGNNIAELPEKLLSSLKNLTSLTLSRNKFEVFPAGPPKQFCQVNTFIMEHNRMQKIPFGVFNKAKYLSKLNVKDNQLTSLPLDFGSWISLVELNVATNQISKLPEDIQWLVNLEVLILSNN-LLKKLPRGIGALRKLRVLDIEENKLESIPTE--------IEYLRSLE 460          
BLAST of SMED30008716 vs. Ensembl Nematostella
Match: EDO46974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNR2])

HSP 1 Score: 97.0561 bits (240), Expect = 2.135e-21
Identity = 114/380 (30.00%), Postives = 191/380 (50.26%), Query Frame = 3
Query:  702 THNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESI-----KIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKAL 1826
            +H+ F   +G    K LE + +  N+L   L + L  L  +  L LS N + I+P+ L     L+ L+F  N I+++PETI + K L+ I    N + KIPE+      L  L +    ++ +P      F ++I   I   +  +L   P S S      +++  N E+  +  + G ++N   L  L +  N + EL+  +I  L  L+ L+++ N L  LP +I  L  L  L L+NNLL  +P++IG L  L+ L LE N L ++P+   +L +L+ L ++ N+L + P  +  L+ L +LN+ ENF   +P  +     +T L L+DN L++ LP ++  M  L  ++L    L  +P  + K     +  LKAL
Sbjct:   15 SHDLFKSKEG----KALEEVYLDANQLR-DLPRGLFNLQNLQVLGLSDNELTILPSVLSNLVNLRILDFSKNGIIDIPETIKHCKNLQEIDASVNPIGKIPETFCHLANLTHLYLNDAFLDFLPG----NFGRLISLRILELRENHLRVLPKSMSQLKNLERLDIGNNEFTELPMVVGCLLN---LTELWMDSNAIKELRP-EIGLLRRLMFLDVSKNRLEWLPPEIESLQSLTDLYLSNNLLIEIPEQIGALGKLQTLKLEENHLGELPNSIGKLVELEELILTCNELVSLPPSLGYLRKLRVLNIDENFLESIPSELGSCTAMTILSLRDNRLVH-LPDSIGRMPKLQVINLASNRLEYLPYSFHK-----LVSLKAL 375          

HSP 2 Score: 80.8777 bits (198), Expect = 3.379e-16
Identity = 66/213 (30.99%), Postives = 101/213 (47.42%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEG----------------------SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKEL 1040
            +NL  L I  N+ ++LP  +G L+NL ELWM  N I  L  E+   + L  LD+  N L      + +      + L  +      + IG L KL+TL ++ N L                        SL  SLG L  +  L++ +N +  IP+ELG CT +  L+   N++V LP++IG + +L+ I +  N+LE +P S      LK L
Sbjct:  163 KNLERLDIGNNEFTELPMVVGCLLNLTELWMDSNAIKELRPEIGLLRRLMFLDVSKNRLEWLPPEIESLQSLTDLYLSNNLLIEIPEQIGALGKLQTLKLEENHLGELPNSIGKLVELEELILTCNELVSLPPSLGYLRKLRVLNIDENFLESIPSELGSCTAMTILSLRDNRLVHLPDSIGRMPKLQVINLASNRLEYLPYSFHKLVSLKAL 375          

HSP 3 Score: 78.9518 bits (193), Expect = 1.481e-15
Identity = 87/270 (32.22%), Postives = 133/270 (49.26%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLP----KFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYN 1268
            NLT LY+    +  LP   G LI+L+ L ++EN +  LP  M   K L+ LDI +N  T+  ++V   L    + + ++        IG L++L  L V  N+LE  L   +  L  +  L LS N ++ IP ++G   KL+ L  E N + ELP +IG L ELE + +  N+L  +P SL     L+ LNI+ N +E IPS +      M   ++  N+ ++LP    + P     K++  N   N +  +  S     SLK L L  N
Sbjct:  118 NLTHLYLNDAFLDFLPGNFGRLISLRILELRENHLRVLPKSMSQLKNLERLDIGNNEFTELPMVVGCLLNLTELWMDSNAIKELRPEIGLLRRLMFLDVSKNRLEW-LPPEIESLQSLTDLYLSNNLLIEIPEQIGALGKLQTLKLEENHLGELPNSIGKLVELEELILTCNELVSLPPSLGYLRKLRVLNIDENFLESIPSELG-SCTAMTILSLRDNRLVHLPDSIGRMP-----KLQVINLASNRLEYLPYSFHKLVSLKALWLSEN 380          

HSP 4 Score: 78.1814 bits (191), Expect = 2.975e-15
Identity = 109/385 (28.31%), Postives = 169/385 (43.90%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL--DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSEN 1616
            QNL  L +  N+++ LP  + NL+NL+ L   +N I  +P  +K CK LQ +D   N      +      +     L  ++ F        GRL  L  L ++ N L   L KS+ +L  +  LD+  N    +P  +G    L  L  + N I EL   IG L+ L F+ +  N+LE +P  +                           Q +    +S+N  I +P     E I                G++   Q+LK   L  N+L EL +  I  LV L +L L  N L  LP  +  L  L  L++  N L ++P E+G    +  L+L  N L+ +PD    + KL+ +N++SN+L+  P    KL +L+ L +SEN
Sbjct:   48 QNLQVLGLSDNELTILPSVLSNLVNLRILDFSKNGIIDIPETIKHCKNLQEIDASVN--PIGKIPETFCHLANLTHLYLNDAFLDFLPGNFGRLISLRILELRENHLR-VLPKSMSQLKNLERLDIGNNEFTELPMVVGCLLNLTELWMDSNAIKELRPEIGLLRRLMFLDVSKNRLEWLPPEIE------------------------SLQSLTDLYLSNNLLIEIP-----EQI----------------GALGKLQTLK---LEENHLGELPN-SIGKLVELEELILTCNELVSLPPSLGYLRKLRVLNIDENFLESIPSELGSCTAMTILSLRDNRLVHLPDSIGRMPKLQVINLASNRLEYLPYSFHKLVSLKALWLSEN 380          
BLAST of SMED30008716 vs. Ensembl Nematostella
Match: EDO38039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE32])

HSP 1 Score: 95.9005 bits (237), Expect = 5.228e-21
Identity = 128/432 (29.63%), Postives = 196/432 (45.37%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL-DGIGR-LKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFIN--LPKFPNSESIK-IEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNG 1754
            LTELY+ GN ++ LP     L NL EL + EN ++ LP  +     L+ L++                        T NK  +L D  G  L  L  L +  N L   L+ S   +  +  L+L  N I  +P + G   KL+ +N   N I +LPE+ G L  L+   I  N +E +PE       L+ L  ++N+I  +P         +I   +S N+  +  LP    S S K +   +   N I+++  S+   + LK L+L  + ++EL+    QN           N LS LP   S++++L  L L  N +  LP + G L NL++L++  N +  +PD FC L KL  L +S N L   P     L +L  L +  N  + LP S   L  +  L L  N  L+ +P  L  ++NL  L L+G
Sbjct:   24 LTELYLTGNLLTSLPDVFARLGNLTELHLNENSLEELPESLGKLSKLRVLNL------------------------TGNKLEKLRDDFGAGLASLTELRIDENDL-SELSVSFTLMKNLKVLELGDNHIERLPEDFGNLRKLEVVNLSQNNIEKLPESFGFLCCLKSFDITGNHIENLPERFESACFLEHLYADNNNITWLPDWFG-DLPNIINLCLSDNELSDSALPDHFGSISGKTLSSLDLSGNRITKLPDSMGELKELKTLHLG-STINELERRAFQN----------GNWLSHLPDSFSQMANLTKLHLDENQVVCLPDDFGDLVNLEWLDVGQNRIEMLPDSFCNLSKLWFLQLSKNHLTELPENFGNLTSLVELRLDSNQLSSLPASFANLTNVKTLDLYRNK-LSEIPRVLLKLENLMRLDLDG 417          

HSP 2 Score: 69.3218 bits (168), Expect = 2.204e-12
Identity = 79/311 (25.40%), Postives = 134/311 (43.09%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKL-EGSLTKSLGKLH--CMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLES 1391
            +NL  L +  N I +LP++ GNL  L+ + + +N I+ LP        L+  DI  NH+ +      ++     +    +N     D  G L  +  L +  N+L + +L    G +    + +LDLS NRI  +P+ +GE  +LK L+        L  TI  L+   F     N L  +P+S S                        +   + K ++  N+ + LP     + + +E  +   N I  +  S  N   L  L L  N+L+EL   +  NL  L++L L  N LS LP   + L+++++
Sbjct:  115 KNLKVLELGDNHIERLPEDFGNLRKLEVVNLSQNNIEKLPESFGFLCCLKSFDITGNHIENLPERFESACFLEHLYADNNNITWLPDWFGDLPNIINLCLSDNELSDSALPDHFGSISGKTLSSLDLSGNRITKLPDSMGELKELKTLH--------LGSTINELERRAF--QNGNWLSHLPDSFS------------------------QMANLTKLHLDENQVVCLPD-DFGDLVNLEWLDVGQNRIEMLPDSFCNLSKLWFLQLSKNHLTELPE-NFGNLTSLVELRLDSNQLSSLPASFANLTNVKT 389          

HSP 3 Score: 66.2402 bits (160), Expect = 2.020e-11
Identity = 89/361 (24.65%), Postives = 154/361 (42.66%), Query Frame = 3
Query:  756 TLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLP-KFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMX--XXXXXXXXXXXXXXXIPDEFCEL--EKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSE-------------NFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEY 1784
            TL +  N L+  L   LG L  +  L L+ N +  +P+       L  L+   N + ELPE++G L +L  + +  N+LEK+ +     GL                        + +  I  N    L   F   +++K+ +     N+I R+     N + L+V+NL  NN+ +L       L CL   ++  NH+ +LP+       LE L   NN +T LP   G L       L+        +PD F  +  + L +L++S N++   P  + +LK L+ L++               N+ + LP S +++  LT L L +N ++  LP     + NL +L +    +  +P  +
Sbjct:    3 TLKLDFNDLQ-RLPDDLGSLASLTELYLTGNLLTSLPDVFARLGNLTELHLNENSLEELPESLGKLSKLRVLNLTGNKLEKLRDDFG-AGL----------------------ASLTELRIDENDLSELSVSFTLMKNLKVLELGD--NHIERLPEDFGNLRKLEVVNLSQNNIEKLPE-SFGFLCCLKSFDITGNHIENLPERFESACFLEHLYADNNNITWLPDWFGDLPNIINLCLSDNELSDSALPDHFGSISGKTLSSLDLSGNRITKLPDSMGELKELKTLHLGSTINELERRAFQNGNWLSHLPDSFSQMANLTKLHLDENQVV-CLPDDFGDLVNLEWLDVGQNRIEMLPDSF 335          
BLAST of SMED30008716 vs. Ensembl Nematostella
Match: EDO48217 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKB1])

HSP 1 Score: 83.9593 bits (206), Expect = 9.459e-17
Identity = 124/475 (26.11%), Postives = 211/475 (44.42%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLD-GIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKI----EKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLI---------DLNLAFNH----LSDLPK----------DISRLSHLESXXXXXXXXXXXPKEI---GMXXXXXXXXXXXXXXXXIPDEFCEL-EKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSL--NGCPLGDIPGEYRKS 1793
            +LT+L +  N ++++  ++ NL  L  L + +N + +LP E+ S   LQ L++ HN ++   + +        + L  HN F  L+  +G L+ LE L V  N +  S   SL  L  + TL+LS N + ++P E      L  LN   NKI   P  + N+K L  +  + N L  +P S+  C  LKEL +  N I E+ S +   +  +   ++  N   ++P     E I I    E+ +   N+IS +   + N  +LK L L  N L EL+   +      I         D + A +     ++ LP           D+  L H ++L+ +     ++P E+    +   +K ++   N+L  +P+    L   + +LN+  N++ + PS I     LE L++  N  + LP     L  L  + +  N   + LP  L  M +L  L    N   + D+ G  R S
Sbjct:   78 DLTKLILASNSLTEISGDVFNLPALVLLDIHDNSLTTLPEEIGSLSCLQKLNLGHNKISSLPMSMAQLESLCSLKLE-HNSFKSLECWLGSLRNLEELDVSYNMV--SSLPSLAGLKHLRTLNLSNNALEMLPPEFDHLQALDDLNISSNKICNFPGKLYNMKSLRRLDCRQNHLTSVP-SVGQCPSLKELYLAYNKIAELDSKVFAGYSGLTVLDLHDNLLTSIP-----EDIIILRDLERLDLTNNDISGLPYKIGNMSNLKSLVLNGNPLRELRRDIVMRGTQAIMKHLKSRIPDDDGATDQPDASVAPLPSVSMGSSGAVVDMHTLGHTKTLNYSGKKSASIPVEVLEAAVTSEVKTVDFSKNMLTDLPERITALSSSVSDLNLGFNKITSLPSGICSFTQLEFLDLRNNQLSSLPDGFASLRSLREIIISYN-RFSCLPPVLYSMTSLRTLLACDNQIAVIDVDGLLRMS 542          

HSP 2 Score: 64.3142 bits (155), Expect = 1.169e-10
Identity = 104/448 (23.21%), Postives = 173/448 (38.62%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGL------LKELXXXXXXXXXXPSAIVLKFQQMI---------KFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKD--NILLNTLPVTLAGMKNLNFLSLNGCP 1760
            ++L  L +  N +  LP E  +L  L +L +  N I + P ++ + K L+ LD R NH                         T +  +G+   L+ L +  NK+    +K       +  LDL  N +  IP ++     L+RL+   N I  LP  IGN+  L+ + +  N L ++   +   G       LK    + +   + P A V     +             + H K +N      S SI +E   A   +             +K ++   N L++L          + DLNL FN ++ LP  I   + LE                       FL+L +N L  +PD F  L  L+ + IS N+    P  +  + +L  L   +N  A +   ++ L R++ L   D  N  ++ +P  L  ++ L  L L G P
Sbjct:  191 KHLRTLNLSNNALEMLPPEFDHLQALDDLNISSNKICNFPGKLYNMKSLRRLDCRQNH------------------------LTSVPSVGQCPSLKELYLAYNKIAELDSKVFAGYSGLTVLDLHDNLLTSIPEDIIILRDLERLDLTNNDISGLPYKIGNMSNLKSLVLNGNPLRELRRDIVMRGTQAIMKHLKSRIPDDDGATDQPDASVAPLPSVSMGSSGAVVDMHTLGHTKTLNY-SGKKSASIPVEVLEAAVTS------------EVKTVDFSKNMLTDLPERITALSSSVSDLNLGFNKITSLPSGICSFTQLE-----------------------FLDLRNNQLSSLPDGFASLRSLREIIISYNRFSCLPPVLYSMTSLRTLLACDNQIAVI--DVDGLLRMSVLETLDLQNNNISQVPPELGNVRGLKALQLGGNP 576          
BLAST of SMED30008716 vs. Ensembl Nematostella
Match: EDO33432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS78])

HSP 1 Score: 78.9518 bits (193), Expect = 5.180e-15
Identity = 57/178 (32.02%), Postives = 90/178 (50.56%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIP 1004
            +L E ++ GN +  LP EIGNL  L+   + EN I+ LP E+  C  L  L +  N L +    +        + +  +   T    IG    L+ L +  N L+  L  ++GKLH +  L++ +NR+ ++P ELG CTKL   +   N +  LP  IGN + L  + +  N+LE +P
Sbjct:  145 SLAEFWLDGNLLKTLPTEIGNLKKLQIFDVSENKIEYLPDEICFCGSLTDLHLSQNLLEELPDTIGKLKKLQLLKVDQNRLITLTPAIGGCIALQELILTENLLD-VLPSTMGKLHKLSLLNVDRNRLEVLPVELGSCTKLSVFSLRDNLLQRLPTEIGNCRNLHVLDVSGNRLECLP 321          

HSP 2 Score: 74.7146 bits (182), Expect = 9.424e-14
Identity = 75/269 (27.88%), Postives = 130/269 (48.33%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNL 1274
            Q+LT L +    + +LP +IG+L  L  L  +EN+I  LP+ +     L+ LD+  N L +                         D +G L  L    + GN L+ +L   +G L  +   D+S+N+I  +P+E+  C  L  L+   N + ELP+TIG LK+L+ + +  N+L  +  ++  C  L+EL +  N ++ +PS +  K  ++   N+  N+   LP    S   K+  F+   N + R+   + N ++L VL++  N L
Sbjct:   75 QHLTTLCLNDVSLIRLPPDIGSLTELTVLEARENLIKFLPVSLAFLSKLERLDLGCNELEELP-----------------------DVVGSLPSLAEFWLDGNLLK-TLPTEIGNLKKLQIFDVSENKIEYLPDEICFCGSLTDLHLSQNLLEELPDTIGKLKKLQLLKVDQNRLITLTPAIGGCIALQELILTENLLDVLPSTMG-KLHKLSLLNVDRNRLEVLPVELGS-CTKLSVFSLRDNLLQRLPTEIGNCRNLHVLDVSGNRL 317          

HSP 3 Score: 73.1738 bits (178), Expect = 2.477e-13
Identity = 109/386 (28.24%), Postives = 173/386 (44.82%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRL-DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPK---FPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSEN 1616
            N+  L +  N+I++LP E+GNL NL+E  +  N I  +P  +K CK L  LD+                        + N  ++L DG  +L+ L TL +    L   L   +G L  +  L+  +N I  +P  L   +KL+RL+   N++ ELP+ +G+L  L    +  N L+ +P   ++ G LK+L I                     F++S NK   LP    F  S    +   +   N +  +  ++   + L++L +  N L  L    I   + L +L L  N L  LP  + +L  L  L++  N L  LP E+G    L   +L  NLL ++P E      L  L++S N+L+  P  I  L  L+ L +SEN
Sbjct:    7 NIRRLGLSDNEIARLPPEVGNLANLQEFDISRNDICDIPENIKYCKSLVSLDL------------------------SGNPISKLPDGFSQLQHLTTLCLNDVSLI-RLPPDIGSLTELTVLEARENLIKFLPVSLAFLSKLERLDLGCNELEELPDVVGSLPSLAEFWLDGNLLKTLP---TEIGNLKKLQI---------------------FDVSENKIEYLPDEICFCGS----LTDLHLSQNLLEELPDTIGKLKKLQLLKVDQNRLITLTPA-IGGCIALQELILTENLLDVLPSTMGKLHKLSLLNVDRNRLEVLPVELGSCTKLSVFSLRDNLLQRLPTEIGNCRNLHVLDVSGNRLECLPLTIGTLP-LKALWLSEN 337          

HSP 4 Score: 68.1662 bits (165), Expect = 1.083e-11
Identity = 93/323 (28.79%), Postives = 149/323 (46.13%), Query Frame = 3
Query:  810 KLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI-------VLKFQQ-MIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNG 1754
            +L+ +  L LS N I  +P E+G    L+  +   N I ++PE I   K L  + +  N + K+P+  S    L  L +   S+  +P  I       VL+ ++ +IKF      F++          K+E+ +   N +  +   V +  SL    L  N L  L + +I NL  L   +++ N +  LP +I     L  L L+ NLL  LP  IG LK L+ L ++ N L+ +         L+ L ++ N L   PS + KL  L +LNV  N    LP  +    +L+   L+DN LL  LP  +   +NL+ L ++G
Sbjct:    4 RLYNIRRLGLSDNEIARLPPEVGNLANLQEFDISRNDICDIPENIKYCKSLVSLDLSGNPISKLPDGFSQLQHLTTLCLNDVSLIRLPPDIGSLTELTVLEARENLIKFLPVSLAFLS----------KLERLDLGCNELEELPDVVGSLPSLAEFWLDGNLLKTLPT-EIGNLKKLQIFDVSENKIEYLPDEICFCGSLTDLHLSQNLLEELPDTIGKLKKLQLLKVDQNRLITLTPAIGGCIALQELILTENLLDVLPSTMGKLHKLSLLNVDRNRLEVLPVELGSCTKLSVFSLRDN-LLQRLPTEIGNCRNLHVLDVSG 314          
BLAST of SMED30008716 vs. Ensembl Medaka
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:101159973])

HSP 1 Score: 211.075 bits (536), Expect = 5.650e-59
Identity = 166/451 (36.81%), Postives = 257/451 (56.98%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            L ELY+Y NK+  LP E+G L  L  L + EN + SLP  + S K L+ LD+RHN L +   +V        + L  +   T    I  L KL  L+++ NK++  L   +G+L  ++TLD++ N++  +P E+G CT++  L+ ++N++++LPETIGNL  +  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P  ++     +    ++ N F + P    S+   I   N E+N+I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+  L  LE L L+NNLL  LP  IG L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L  +S+  CPL  +P +     P  +I +LK
Sbjct:  125 LAELYLYSNKLQSLPAEVGCLSGLVTLALSENSLTSLPDSLDSLKKLRMLDLRHNKLREIPAVVYRLTSLTTLYLRFNRITTVEKDIRNLSKLTMLSIRENKIK-QLPAEIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNHINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLAKIPEDVCGLVSLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLECLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLAIMSIENCPLTHLPAQIVAGGPSFIIQFLK 573          

HSP 2 Score: 63.929 bits (154), Expect = 3.562e-10
Identity = 87/318 (27.36%), Postives = 153/318 (48.11%), Query Frame = 3
Query:  831 LDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDE-FCELEKLKNLNISSNQLKTFP-SCIVKLKNLEMLNVSENFFAELPKSI-NELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            LDLSK  I ++P  + E  +L  L    NK+  LP  +G L  L  + +  N L  +P+SL     L+ L++  N + EIP A+V +   +    +  N+   + K   + S K+   +   N I ++   +    +L  L++ +N L  L   +I N   + +L+L  N L DLP+ I  L+ +  L L  N L+ +P+ +   + L+ LNLE+N +  +P+     L  L +L ++ N  +++P     +   +  LN+  N   ++P  I +    L+ L +KDN  L +LP+      ++  L+L    L  IP
Sbjct:  105 LDLSKRSIHMLPTSIKELNQLAELYLYSNKLQSLPAEVGCLSGLVTLALSENSLTSLPDSLDSLKKLRMLDLRHNKLREIP-AVVYRLTSLTTLYLRFNRITTVEKDIRNLS-KLTMLSIRENKIKQLPAEIGELCNLITLDVAHNQLEHLPK-EIGNCTQITNLDLQHNELLDLPETIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNHINKIPFGIFSRAKVLSKLNMKDN-QLTSLPLDFGTWTSMVELNLATNQLAKIP 418          

HSP 3 Score: 60.077 bits (144), Expect = 6.464e-9
Identity = 96/389 (24.68%), Postives = 170/389 (43.70%), Query Frame = 3
Query:  792 LTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKE-----IGMXXXXXXXXXXXXXXXXIPDEFCEL---------------------EKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALDIGLKLHEYLKMSNNKST 1880
            L  S+ +L+ +  L L  N++  +P E+G  + L  L    N +  LP+++ +LK+L  + +++N+L +IP  +     L  L +  N I  +   I     ++   +I  NK   LP     E   +   +  +N +  +   + N   +  L+L +N L +L    I NL  +  L L +N LS +P+ +++   LE L+L NN ++ LP+      + +       N   +  +  P +F  +                     + L  LN+  NQL + P       ++  LN++ N  A++P+ +  L  L  L L +N LL  LP  +  ++ L  L L    L  +P E        IAYLK L       + L ++NN+ T
Sbjct:  115 LPTSIKELNQLAELYLYSNKLQSLPAEVGCLSGLVTLALSENSLTSLPDSLDSLKKLRMLDLRHNKLREIPAVVYRLTSLTTLYLRFNRITTVEKDIR-NLSKLTMLSIRENKIKQLPA-EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPE-TIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNHINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLAKIPEDVCGLVSLEVLILSNN-LLKKLPHGIGNLRKLRELDLEENKLECLPNE--------IAYLKDL-------QKLVLTNNQLT 484          
BLAST of SMED30008716 vs. Ensembl Medaka
Match: shoc2 (SHOC2 leucine rich repeat scaffold protein [Source:NCBI gene;Acc:101159973])

HSP 1 Score: 169.859 bits (429), Expect = 9.813e-45
Identity = 153/451 (33.92%), Postives = 226/451 (50.11%), Query Frame = 3
Query:  474 LTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGE-YRKSPITVIAYLK 1820
            L ELY+Y NK+  LP E+G L  L  L + EN + SLP                                              D +  LKKL  L ++ NKL   +   + +L  + TL L  NRI  +  ++   +KL  L+   NKI +LP  IGNL  +  +G++YN+L  IP SL+ C  L+ELN+E+N+I  +P  ++     +    ++ N F + P    S+   I   N E+N+I++I  G    A+ L  LN+  N L+ L  LD      +++LNLA N L+ +P+D+  L  LE L L+NNLL  LP  IG L+ L+ L+LE N L  +P+E   L+ L+ L +++NQL T P  I  L NL  L + EN    LP+ I  L+ L  L+L DN  L++LP  LA    L  +S+  CPL  +P +     P  +I +LK
Sbjct:  125 LAELYLYSNKLQSLPAEVGCLSGLVTLALSENSLTSLP----------------------------------------------DSLDSLKKLRMLDLRHNKLR-EIPAVVYRLTSLTTLYLRFNRITTVEKDIRNLSKLTMLSIRENKIKQLPAEIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNHINKIPFGIFSRAKVLSKLNMKDNQLTSL-PLDFGTWTSMVELNLATNQLAKIPEDVCGLVSLEVLILSNNLLKKLPHGIGNLRKLRELDLEENKLECLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLQHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLAIMSIENCPLTHLPAQIVAGGPSFIIQFLK 527          

HSP 2 Score: 58.5362 bits (140), Expect = 1.630e-8
Identity = 80/308 (25.97%), Postives = 135/308 (43.83%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTK-LKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLE 1388
            +LT LY+  N+I+ + K+I NL  L  L ++EN I  LP E+ +   +  L +R+N L+     +        + L  +N     +G +  L  L +LT+  N  +        +   + +L++  N I  IP  +    K L +LN + N++  LP   G    +  + +  NQL KIPE +  CGL                   +  + +I   +S+N    LP    +   K+ + + E N +  +   +   + L+ L L  N L+ L    I +L  L  L L  N L  LP++I  L +LE
Sbjct:  193 SLTTLYLRFNRITTVEKDIRNLSKLTMLSIRENKIKQLPAEIGNLASINRLGLRYNRLSAIPRSLAKCRELEELNLENNNISVLPEGLLSSLVNLTSLTLARNCFQSYPVGGPSQFSTIYSLNMEHNHINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQLAKIPEDV--CGL-------------------VSLEVLI---LSNNLLKKLPHGIGNLR-KLRELDLEENKLECLPNEIAYLKDLQKLVLTNNQLTTLPR-GIGHLTNLTHLGLGENLLQHLPEEIGTLENLE 474          
BLAST of SMED30008716 vs. Ensembl Medaka
Match: erbin (erbb2 interacting protein [Source:NCBI gene;Acc:101172095])

HSP 1 Score: 103.219 bits (256), Expect = 4.710e-22
Identity = 110/383 (28.72%), Postives = 173/383 (45.17%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSEN 1616
            Q L  L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK L  ++   N +          L   ++ L            GRL KL+ L ++ N+L+ +L KS+ KL  +  LDL  N    +P  L   + +K L  + NK+  LP  +G LK LE++ +  N LE + E +S C  L++L                         +S+N    LP                         S+ + + L  L +  N L  L    +  L  + +L+ +FN +  LP  I +   + +    +N LT LP E+G  KNL  L L SN L  +P+E  +++KLK +N+S+N+LK  P    KL  +  + +SEN
Sbjct:   68 QLLNRLSVPDNDLAVLPAAIANLINLRELDVSKNGIQEFPDSIKNCKGLTIVEASVNRMPKLPEGFTLLLNLTQLYLNDGYLEFLPASFGRLAKLQILELRENQLQ-NLPKSMQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLL------------------------LSNNALTQLP------------------------ASIGSLKKLTALKVDENQLMFLPD-SVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNKLESLPEEMGDMQKLKVINLSNNKLKNLPYSFTKLSEMTAMWLSEN 400          

HSP 2 Score: 80.8777 bits (198), Expect = 3.679e-15
Identity = 97/352 (27.56%), Postives = 170/352 (48.30%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNI---SHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            K L+ L +  N++E  L K L     +  L +  N + ++P  +     L+ L+   N I E P++I N K L  +    N++ K+PE  +    L +L +    +E +P++    F ++ K  I     N+  NLPK    +  ++E+ +   N  + +   + +   +K L +  N L+ L ++ +  L  L  L+++ N+L  + + IS   +L+ L L+NN LT LP  IG LK L  L ++ N L+ +PD    L  +  L+ S N+++  PS I +   +       NF  ELP  +     LT LFL  N  L +LP  +  M+ L  ++L+   L ++P  + K
Sbjct:   45 KTLQELYLDANQIE-ELPKQLFNCQLLNRLSVPDNDLAVLPAAIANLINLRELDVSKNGIQEFPDSIKNCKGLTIVEASVNRMPKLPEGFTLLLNLTQLYLNDGYLEFLPAS----FGRLAKLQILELRENQLQNLPKS-MQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAM-VGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNALTQLPASIGSLKKLTALKVDENQLMFLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNK-LESLPEEMGDMQKLKVINLSNNKLKNLPYSFTK 388          

HSP 3 Score: 64.6994 bits (156), Expect = 3.653e-10
Identity = 61/217 (28.11%), Postives = 106/217 (48.85%), Query Frame = 3
Query: 1101 MIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            +   + SH     +PK   S    +++   + N I  +   + N Q L  L++  N+L+ L +  I NL+ L +L+++ N + + P  I     L  ++ + N +  LP+   +L NL  L L    L  +P  F  L KL+ L +  NQL+  P  + KL  LE L++  N F E+P+ +  L  +  L++  N  L  LP  +  +KNL +L ++
Sbjct:   23 VTSLDYSHCSLETVPKEIFSFEKTLQELYLDANQIEELPKQLFNCQLLNRLSVPDNDLAVLPAA-IANLINLRELDVSKNGIQEFPDSIKNCKGLTIVEASVNRMPKLPEGFTLLLNLTQLYLNDGYLEFLPASFGRLAKLQILELRENQLQNLPKSMQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNK-LTVLPAMVGKLKNLEYLDMS 237          

HSP 4 Score: 60.077 bits (144), Expect = 7.584e-9
Identity = 75/321 (23.36%), Postives = 131/321 (40.81%), Query Frame = 3
Query:  789 SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            S  K+L +L+      L  N+I  +P +L  C  L RL+   N +  LP  I NL  L  + +  N +++ P+S+ +C  L                            I       +PK P             +  +  ++   +N   L+ L   +  L++LQ L+++            N L +LPK + +L+ LE L            ++G           SN   ++P+    L  +K L +  N+L   P+ + KLKNLE L++S+N    + + I+  + L  L L +N  L  LP ++  +K L  L ++
Sbjct:   42 SFEKTLQELY------LDANQIEELPKQLFNCQLLNRLSVPDNDLAVLPAAIANLINLRELDVSKNGIQEFPDSIKNCKGL---------------------------TIVEASVNRMPKLPEG-----------FTLLLNLTQLYLNDGYLEFLPASFGRLAKLQILELRE-----------NQLQNLPKSMQKLTQLERL------------DLG-----------SNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNA-LTQLPASIGSLKKLTALKVD 283          

HSP 5 Score: 53.9138 bits (128), Expect = 7.459e-7
Identity = 47/195 (24.10%), Postives = 86/195 (44.10%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEG----------------------SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQ 989
             + EL++ GNK++ LP  +G L NL+ L M +N ++ +  ++  C+ LQ L + +N LT     + +      + +  +      D +G L  ++ L    N++E                        L   +G    +  L L  N++  +P E+G+  KLK +N   NK+  LP +   L E+  + +  NQ
Sbjct:  207 GIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNALTQLPASIGSLKKLTALKVDENQLMFLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNKLESLPEEMGDMQKLKVINLSNNKLKNLPYSFTKLSEMTAMWLSENQ 401          
BLAST of SMED30008716 vs. Ensembl Medaka
Match: erbin (erbb2 interacting protein [Source:NCBI gene;Acc:101172095])

HSP 1 Score: 102.834 bits (255), Expect = 5.716e-22
Identity = 110/383 (28.72%), Postives = 173/383 (45.17%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSEN 1616
            Q L  L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK L  ++   N +          L   ++ L            GRL KL+ L ++ N+L+ +L KS+ KL  +  LDL  N    +P  L   + +K L  + NK+  LP  +G LK LE++ +  N LE + E +S C  L++L                         +S+N    LP                         S+ + + L  L +  N L  L    +  L  + +L+ +FN +  LP  I +   + +    +N LT LP E+G  KNL  L L SN L  +P+E  +++KLK +N+S+N+LK  P    KL  +  + +SEN
Sbjct:   68 QLLNRLSVPDNDLAVLPAAIANLINLRELDVSKNGIQEFPDSIKNCKGLTIVEASVNRMPKLPEGFTLLLNLTQLYLNDGYLEFLPASFGRLAKLQILELRENQLQ-NLPKSMQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLL------------------------LSNNALTQLP------------------------ASIGSLKKLTALKVDENQLMFLPD-SVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNKLESLPEEMGDMQKLKVINLSNNKLKNLPYSFTKLSEMTAMWLSEN 400          

HSP 2 Score: 80.4925 bits (197), Expect = 5.248e-15
Identity = 97/352 (27.56%), Postives = 170/352 (48.30%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNI---SHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            K L+ L +  N++E  L K L     +  L +  N + ++P  +     L+ L+   N I E P++I N K L  +    N++ K+PE  +    L +L +    +E +P++    F ++ K  I     N+  NLPK    +  ++E+ +   N  + +   + +   +K L +  N L+ L ++ +  L  L  L+++ N+L  + + IS   +L+ L L+NN LT LP  IG LK L  L ++ N L+ +PD    L  +  L+ S N+++  PS I +   +       NF  ELP  +     LT LFL  N  L +LP  +  M+ L  ++L+   L ++P  + K
Sbjct:   45 KTLQELYLDANQIE-ELPKQLFNCQLLNRLSVPDNDLAVLPAAIANLINLRELDVSKNGIQEFPDSIKNCKGLTIVEASVNRMPKLPEGFTLLLNLTQLYLNDGYLEFLPAS----FGRLAKLQILELRENQLQNLPKS-MQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAM-VGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNALTQLPASIGSLKKLTALKVDENQLMFLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNK-LESLPEEMGDMQKLKVINLSNNKLKNLPYSFTK 388          

HSP 3 Score: 64.3142 bits (155), Expect = 4.893e-10
Identity = 61/217 (28.11%), Postives = 106/217 (48.85%), Query Frame = 3
Query: 1101 MIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            +   + SH     +PK   S    +++   + N I  +   + N Q L  L++  N+L+ L +  I NL+ L +L+++ N + + P  I     L  ++ + N +  LP+   +L NL  L L    L  +P  F  L KL+ L +  NQL+  P  + KL  LE L++  N F E+P+ +  L  +  L++  N  L  LP  +  +KNL +L ++
Sbjct:   23 VTSLDYSHCSLETVPKEIFSFEKTLQELYLDANQIEELPKQLFNCQLLNRLSVPDNDLAVLPAA-IANLINLRELDVSKNGIQEFPDSIKNCKGLTIVEASVNRMPKLPEGFTLLLNLTQLYLNDGYLEFLPASFGRLAKLQILELRENQLQNLPKSMQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNK-LTVLPAMVGKLKNLEYLDMS 237          

HSP 4 Score: 60.077 bits (144), Expect = 9.070e-9
Identity = 75/321 (23.36%), Postives = 131/321 (40.81%), Query Frame = 3
Query:  789 SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            S  K+L +L+      L  N+I  +P +L  C  L RL+   N +  LP  I NL  L  + +  N +++ P+S+ +C  L                            I       +PK P             +  +  ++   +N   L+ L   +  L++LQ L+++            N L +LPK + +L+ LE L            ++G           SN   ++P+    L  +K L +  N+L   P+ + KLKNLE L++S+N    + + I+  + L  L L +N  L  LP ++  +K L  L ++
Sbjct:   42 SFEKTLQELY------LDANQIEELPKQLFNCQLLNRLSVPDNDLAVLPAAIANLINLRELDVSKNGIQEFPDSIKNCKGL---------------------------TIVEASVNRMPKLPEG-----------FTLLLNLTQLYLNDGYLEFLPASFGRLAKLQILELRE-----------NQLQNLPKSMQKLTQLERL------------DLG-----------SNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNA-LTQLPASIGSLKKLTALKVD 283          

HSP 5 Score: 53.9138 bits (128), Expect = 6.768e-7
Identity = 47/195 (24.10%), Postives = 86/195 (44.10%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEG----------------------SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQ 989
             + EL++ GNK++ LP  +G L NL+ L M +N ++ +  ++  C+ LQ L + +N LT     + +      + +  +      D +G L  ++ L    N++E                        L   +G    +  L L  N++  +P E+G+  KLK +N   NK+  LP +   L E+  + +  NQ
Sbjct:  207 GIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNALTQLPASIGSLKKLTALKVDENQLMFLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNKLESLPEEMGDMQKLKVINLSNNKLKNLPYSFTKLSEMTAMWLSENQ 401          
BLAST of SMED30008716 vs. Ensembl Medaka
Match: erbin (erbb2 interacting protein [Source:NCBI gene;Acc:101172095])

HSP 1 Score: 102.064 bits (253), Expect = 8.948e-22
Identity = 110/383 (28.72%), Postives = 173/383 (45.17%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSEN 1616
            Q L  L +  N ++ LP  I NLINL+EL + +N I   P  +K+CK L  ++   N +          L   ++ L            GRL KL+ L ++ N+L+ +L KS+ KL  +  LDL  N    +P  L   + +K L  + NK+  LP  +G LK LE++ +  N LE + E +S C  L++L                         +S+N    LP                         S+ + + L  L +  N L  L    +  L  + +L+ +FN +  LP  I +   + +    +N LT LP E+G  KNL  L L SN L  +P+E  +++KLK +N+S+N+LK  P    KL  +  + +SEN
Sbjct:   68 QLLNRLSVPDNDLAVLPAAIANLINLRELDVSKNGIQEFPDSIKNCKGLTIVEASVNRMPKLPEGFTLLLNLTQLYLNDGYLEFLPASFGRLAKLQILELRENQLQ-NLPKSMQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLL------------------------LSNNALTQLP------------------------ASIGSLKKLTALKVDENQLMFLPD-SVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNKLESLPEEMGDMQKLKVINLSNNKLKNLPYSFTKLSEMTAMWLSEN 400          

HSP 2 Score: 79.7221 bits (195), Expect = 8.161e-15
Identity = 97/352 (27.56%), Postives = 170/352 (48.30%), Query Frame = 3
Query:  744 KKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNI---SHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK 1790
            K L+ L +  N++E  L K L     +  L +  N + ++P  +     L+ L+   N I E P++I N K L  +    N++ K+PE  +    L +L +    +E +P++    F ++ K  I     N+  NLPK    +  ++E+ +   N  + +   + +   +K L +  N L+ L ++ +  L  L  L+++ N+L  + + IS   +L+ L L+NN LT LP  IG LK L  L ++ N L+ +PD    L  +  L+ S N+++  PS I +   +       NF  ELP  +     LT LFL  N  L +LP  +  M+ L  ++L+   L ++P  + K
Sbjct:   45 KTLQELYLDANQIE-ELPKQLFNCQLLNRLSVPDNDLAVLPAAIANLINLRELDVSKNGIQEFPDSIKNCKGLTIVEASVNRMPKLPEGFTLLLNLTQLYLNDGYLEFLPAS----FGRLAKLQILELRENQLQNLPKS-MQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAM-VGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNALTQLPASIGSLKKLTALKVDENQLMFLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNK-LESLPEEMGDMQKLKVINLSNNKLKNLPYSFTK 388          

HSP 3 Score: 63.929 bits (154), Expect = 5.854e-10
Identity = 61/217 (28.11%), Postives = 106/217 (48.85%), Query Frame = 3
Query: 1101 MIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            +   + SH     +PK   S    +++   + N I  +   + N Q L  L++  N+L+ L +  I NL+ L +L+++ N + + P  I     L  ++ + N +  LP+   +L NL  L L    L  +P  F  L KL+ L +  NQL+  P  + KL  LE L++  N F E+P+ +  L  +  L++  N  L  LP  +  +KNL +L ++
Sbjct:   23 VTSLDYSHCSLETVPKEIFSFEKTLQELYLDANQIEELPKQLFNCQLLNRLSVPDNDLAVLPAA-IANLINLRELDVSKNGIQEFPDSIKNCKGLTIVEASVNRMPKLPEGFTLLLNLTQLYLNDGYLEFLPASFGRLAKLQILELRENQLQNLPKSMQKLTQLERLDLGSNEFTEVPEVLEHLSGIKELWMDGNK-LTVLPAMVGKLKNLEYLDMS 237          

HSP 4 Score: 59.6918 bits (143), Expect = 9.971e-9
Identity = 75/321 (23.36%), Postives = 131/321 (40.81%), Query Frame = 3
Query:  789 SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLN 1751
            S  K+L +L+      L  N+I  +P +L  C  L RL+   N +  LP  I NL  L  + +  N +++ P+S+ +C  L                            I       +PK P             +  +  ++   +N   L+ L   +  L++LQ L+++            N L +LPK + +L+ LE L            ++G           SN   ++P+    L  +K L +  N+L   P+ + KLKNLE L++S+N    + + I+  + L  L L +N  L  LP ++  +K L  L ++
Sbjct:   42 SFEKTLQELY------LDANQIEELPKQLFNCQLLNRLSVPDNDLAVLPAAIANLINLRELDVSKNGIQEFPDSIKNCKGL---------------------------TIVEASVNRMPKLPEG-----------FTLLLNLTQLYLNDGYLEFLPASFGRLAKLQILELRE-----------NQLQNLPKSMQKLTQLERL------------DLG-----------SNEFTEVPEVLEHLSGIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNA-LTQLPASIGSLKKLTALKVD 283          

HSP 5 Score: 53.5286 bits (127), Expect = 8.980e-7
Identity = 47/195 (24.10%), Postives = 86/195 (44.10%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEG----------------------SLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQ 989
             + EL++ GNK++ LP  +G L NL+ L M +N ++ +  ++  C+ LQ L + +N LT     + +      + +  +      D +G L  ++ L    N++E                        L   +G    +  L L  N++  +P E+G+  KLK +N   NK+  LP +   L E+  + +  NQ
Sbjct:  207 GIKELWMDGNKLTVLPAMVGKLKNLEYLDMSKNNLEMVDEQISGCENLQDLLLSNNALTQLPASIGSLKKLTALKVDENQLMFLPDSVGGLTAIDELDCSFNEIEALPSSIGQWVAIRTFAADHNFLTELPPEMGNWKNLTVLFLHSNKLESLPEEMGDMQKLKVINLSNNKLKNLPYSFTKLSEMTAMWLSENQ 401          
BLAST of SMED30008716 vs. Planmine SMEST
Match: SMESG000020939.1 (SMESG000020939.1)

HSP 1 Score: 1159.82 bits (2999), Expect = 0.000e+0
Identity = 688/688 (100.00%), Postives = 688/688 (100.00%), Query Frame = 3
Query:  129 MLENESFTGSHSTDNTLSSSFESLHVFNNNEIKKPESFFYGFFNDNNSNYCAHKKTVTIMEPNGHKVYPVXXXXXXXXXXXXXXXVECHLKAXXXXXXXXXXXXXXXXXXXXXQNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALDIGLKLHEYLKMSNNKSTEKSLFSSDTALNIVSNQPSSKVSSAENNDRLAELRPTSPQNSSKQSEGLRPRSMSATAACKKEHIEKAIDRKSTPTKITIPESLVKKMKTTEAGFLACSRKMTS 2192
            MLENESFTGSHSTDNTLSSSFESLHVFNNNEIKKPESFFYGFFNDNNSNYCAHKKTVTIMEPNGHKVYPVKPIKKDKINDGNKKIVECHLKASSFLDLSSSNLSLLSRSISKLQNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHLTDDSLLVLTSLVNLRILLITHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELNIESNSIEEIPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESLDLTNNLLTTLPKEIGMLKNLKFLNLESNLLLKIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALDIGLKLHEYLKMSNNKSTEKSLFSSDTALNIVSNQPSSKVSSAENNDRLAELRPTSPQNSSKQSEGLRPRSMSATAACKKEHIEKAIDRKSTPTKITIPESLVKKMKTTEAGFLACSRKMTS
Sbjct:    1 MLENESFTGSHSTDNTLSSSFESLHVFNNNEIKKPESFFYGFFNDNNSNYCAHKKTVTIMEPNGHKVYPVKPIKKDKINDGNKKIVECHLKASSFLDLSSSNLSLLSRSISKLQNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHLTDDSLLVLTSLVNLRILLITHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELNIESNSIEEIPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESLDLTNNLLTTLPKEIGMLKNLKFLNLESNLLLKIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAYLKALDIGLKLHEYLKMSNNKSTEKSLFSSDTALNIVSNQPSSKVSSAENNDRLAELRPTSPQNSSKQSEGLRPRSMSATAACKKEHIEKAIDRKSTPTKITIPESLVKKMKTTEAGFLACSRKMTS 688          
BLAST of SMED30008716 vs. Planmine SMEST
Match: SMESG000002900.1 (SMESG000002900.1)

HSP 1 Score: 191.43 bits (485), Expect = 4.328e-52
Identity = 174/454 (38.33%), Postives = 255/454 (56.17%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDG-IGRLKKLETLTVKGNKLEGSLTK-SLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRIS-GSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRK-SPITVIAYLK 1820
            NL ELY+Y NK+  LP E+GNL+NL+ L +QEN + +LP  +  C+LL+ LDIRHN L +    V        +LL   N+   +D  I  L+KL+ LT++ NK+    +   L KL  + T D+S N + ++P  +G CTKL  LN ++N++  +PETIGNL  LE  G++YN L  +P SLS C +L ELN E N+I ++P  ++     +    +S N F + P     +    +  N ++N I++I  G +  A  L  L++  N L+ L   D+++   L++LNL  N L+ +P DI  L +LE L L+NN    LP  +  L+ L+ L+LE NLL  +P +   L++L+ L + SN+L   P  I  L+NL  L V EN    LP  I  +  L  L+L DN+ LN LP+ LA   NL  +S+  CPL  IP E     P  VI YLK
Sbjct:  128 NLKELYLYSNKLINLPNELGNLVNLEILMLQENSLTALPDSLSQCRLLRILDIRHNKLCEIPQFVFKLHNLTHLLLR-FNRIREVDPEIANLEKLQNLTLRENKIRLLPSNPGLEKLVNLQTFDISHNHLEMLPEAIGHCTKLTTLNLQHNELKLIPETIGNLTALERFGLRYNHLTSLPGSLSCCRMLCELNTEGNNISQLPEGLLTHLVHVTSIALSRNYFSSFPLGGPQQFASTQTLNLDHNQITQIPFGILSRAMFLTHLSMKDNLLTGLPP-DVKSWENLVELNLGTNQLAKVPDDIEYLINLEVLILSNNQFKRLPPTVKKLQKLRILDLEENLLEFLPPDIGCLQELQKLTVQSNRLTELPVSIGNLRNLTYLAVGENDLHSLPSEIGSMSALETLYLNDNLNLNDLPLELALCSNLQIMSIENCPLNKIPLEIASGGPSLVIQYLK 579          
BLAST of SMED30008716 vs. Planmine SMEST
Match: SMESG000029655.1 (SMESG000029655.1)

HSP 1 Score: 169.859 bits (429), Expect = 1.354e-44
Identity = 141/450 (31.33%), Postives = 241/450 (53.56%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVN-AQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAY 1814
            +N+ EL +  NK+ +L +    L+ L+  ++Q+N I   P+E+  C  L+ LD+R N +      +        ++L ++   +  D + +L+ L+ L +  N +   L   +GKL  ++ L+L+ N+I  +P EL  C  ++ L+  +N++ ELPE++GNL+ L  + I+ NQ+ KIP SL     LKE  +E N +E +P   +     +   N+S N F   P    ++       N   N+I  I   + + ++ L +LNL  N +  L   D+     L++L+L+ N LS +P +I  L +L+ L L++N +  LP  IG L  L  L L+ N +  +PDE   L+ + +LN+++N+LK+ P+ I KLK+L  L ++EN    +P  I E+  LT L LK+N+ L+ LP  L   + L  LSL  C L +IP + +   + +I Y
Sbjct:  130 KNIKELMLKDNKLERL-EGFPVLMQLERCYLQQNSISVFPVELSKCTGLKVLDLRSNRIEIIPECLFELQNLELLILSSNRIESIPDSVQKLQNLKHLGLDKNNI-SRLPPVIGKLQRLMNLNLAFNKIDELPEELCNCASMRDLDVMHNRLTELPESLGNLQNLVRLNIRNNQITKIPISLVKVKNLKEFIMEQNCVENLPDQFLSNLGNLDNVNLSRNAFKTFPTGGPNQFATTMSLNMSNNHIDCIPMGIFSVSKHLSILNLRGNEICTLIPNDVVTWTTLVELDLSSNQLSIIPPEIGALVNLQKLHLSSNHIKKLPPTIGNLNALVLLELDDNQIESLPDEIGNLQSVVDLNLTTNELKSLPASIGKLKSLMKLRLAENDLRIVPPEIGEMSSLTELHLKNNVNLDNLPEELTLCEKLMILSLENCGLRNIPEQVKSQGVRIIVY 577          
BLAST of SMED30008716 vs. Planmine SMEST
Match: SMESG000029655.1 (SMESG000029655.1)

HSP 1 Score: 169.859 bits (429), Expect = 1.513e-44
Identity = 141/450 (31.33%), Postives = 241/450 (53.56%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVN-AQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPITVIAY 1814
            +N+ EL +  NK+ +L +    L+ L+  ++Q+N I   P+E+  C  L+ LD+R N +      +        ++L ++   +  D + +L+ L+ L +  N +   L   +GKL  ++ L+L+ N+I  +P EL  C  ++ L+  +N++ ELPE++GNL+ L  + I+ NQ+ KIP SL     LKE  +E N +E +P   +     +   N+S N F   P    ++       N   N+I  I   + + ++ L +LNL  N +  L   D+     L++L+L+ N LS +P +I  L +L+ L L++N +  LP  IG L  L  L L+ N +  +PDE   L+ + +LN+++N+LK+ P+ I KLK+L  L ++EN    +P  I E+  LT L LK+N+ L+ LP  L   + L  LSL  C L +IP + +   + +I Y
Sbjct:  139 KNIKELMLKDNKLERL-EGFPVLMQLERCYLQQNSISVFPVELSKCTGLKVLDLRSNRIEIIPECLFELQNLELLILSSNRIESIPDSVQKLQNLKHLGLDKNNI-SRLPPVIGKLQRLMNLNLAFNKIDELPEELCNCASMRDLDVMHNRLTELPESLGNLQNLVRLNIRNNQITKIPISLVKVKNLKEFIMEQNCVENLPDQFLSNLGNLDNVNLSRNAFKTFPTGGPNQFATTMSLNMSNNHIDCIPMGIFSVSKHLSILNLRGNEICTLIPNDVVTWTTLVELDLSSNQLSIIPPEIGALVNLQKLHLSSNHIKKLPPTIGNLNALVLLELDDNQIESLPDEIGNLQSVVDLNLTTNELKSLPASIGKLKSLMKLRLAENDLRIVPPEIGEMSSLTELHLKNNVNLDNLPEELTLCEKLMILSLENCGLRNIPEQVKSQGVRIIVY 586          
BLAST of SMED30008716 vs. Planmine SMEST
Match: SMESG000016748.1 (SMESG000016748.1)

HSP 1 Score: 88.5817 bits (218), Expect = 7.339e-18
Identity = 133/497 (26.76%), Postives = 215/497 (43.26%), Query Frame = 3
Query:  498 NKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEG--------------SLTKS--------LGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAI----------------------VLKFQQMIKFNISHNKFINLPKFPNSESIK-IEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFC--------------------------ELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIP 1775
            NK+  LP  I  L+ L+ + +  N I  +P E+ + K LQ   I  N +      + T      I   ++N+   L  I  +  L+TL + GN+ +               SL K+        L KL  +  LDLS N I  IP E+G  TKL   N   N I   P+++    +   + I   QL++ P  L +C  L EL +  N + E+P                         V     +++ + SHN    +P  P   S+K + K N  +NNI    G       L  LN+ +N +SE+    I  +  L  L+L+FN LS  P  I +L +L+ L+L+NNLL    K     + L+ ++  +N   + P E C                           L +L  LN+S+N+  T P  I++L+NL++L ++ N   ELP ++++   L ++ +++N  L  LP +L  + N      +G PL + P
Sbjct:  131 NKLKALPLTIFGLLKLQYMNLSHNQIQDIPEEIGNLKSLQTFLINSNEIVLIPSSISTITSLKTIEA-SNNQMCHLP-ISWVGSLKTLKLDGNQFQFIPSQIYDCCEMKYLSLAKNYLKFIPIELVKLRNLRQLDLSFNSIEYIPCEMGYWTKLVDFNIHGNNITYFPQSLIANHKFVCLNISGCQLKEFPLLLCNCYDLMELRVGENELNELPDKFQLFCNMKYLFMNNNNFELIPLQVCLLSTLVELDFSHNFLWQVP--PGIFSLKHLRKLNLSFNNILIFPGCTAELSYLSELNVSHNKISEICD-SISWMTFLYYLDLSFNELSTFPSAIFQLRYLKYLNLSNNLLDNFSKTDKKWEELRTIDFSNNKFTEFPVELCVHDSIRKLVFDQKEGTKIKSLPVEIKNLWRLAELNLSNNEFLTIPPVIMELENLKVLEMANNILKELPLNLSDAKNLENIDVRNN-QLTELPFSLTTLSNKIKFKFDGSPLVNPP 621          

HSP 2 Score: 88.1965 bits (217), Expect = 9.348e-18
Identity = 112/425 (26.35%), Postives = 191/425 (44.94%), Query Frame = 3
Query:  468 QNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELP-ETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDNILLNTLPVTLAGMKNLNF 1739
            + L  L +  NK+  +P EI NL +L+      N + +LP+ +     LQ++++ HN + D                         + IG LK L+T  +  N+                        IV+IP+ +   T LK +    N++  LP   +G+LK L+  G   NQ + IP  + DC  +K L++  N ++ IP  +V K + + + ++S N    +P        K+  FN   NNI+    S++       LN+    L E   L + N   L++L +  N L++LP       +++ L + NN    +P ++ +L  L  L+   N L ++P     L+ L+ LN+S N +  FP C  +L  L  LNVS N  +E+  SI+ +  L +L L  N  L+T P  +  ++ L +
Sbjct:   98 RGLQSLDVSNNKLEVIPVEIANLGHLEYFNCSHNKLKALPLTIFGLLKLQYMNLSHNQIQDIP-----------------------EEIGNLKSLQTFLINSNE------------------------IVLIPSSISTITSLKTIEASNNQMCHLPISWVGSLKTLKLDG---NQFQFIPSQIYDCCEMKYLSLAKNYLKFIPIELV-KLRNLRQLDLSFNSIEYIPC-EMGYWTKLVDFNIHGNNITYFPQSLIANHKFVCLNISGCQLKEFPLL-LCNCYDLMELRVGENELNELPDKFQLFCNMKYLFMNNNNFELIPLQVCLLSTLVELDFSHNFLWQVPPGIFSLKHLRKLNLSFNNILIFPGCTAELSYLSELNVSHNKISEICDSISWMTFLYYLDLSFN-ELSTFPSAIFQLRYLKY 468          

HSP 3 Score: 76.6406 bits (187), Expect = 3.467e-14
Identity = 97/329 (29.48%), Postives = 150/329 (45.59%), Query Frame = 3
Query:  702 THNKFTRL-DGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNNISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLSHLESXXXXXXXXXXXPKEIGMXXXXXXXXXXXXXXXXIPDEFCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINELDRLTHLFLKDN 1685
            + NK + L D I  L KL    V GN L  ++  +L     + +LD+S N++ +IP E+     L+  N  +NK+  LP TI  L +L+++ + +NQ++ IPE + +   L+   I SN I  IPS+I                         S    ++   A  N +  +  S V   SLK L L  N    + S  I +   +  L+LA N+L  +P ++ +L +L  LDL+ N +  +P E+G    L   N+  N +   P       K   LNIS  QLK FP  +    +L  L V EN   ELP        + +LF+ +N
Sbjct:   60 SKNKISDLSDEIIALSKLRHFFVNGNMLR-TINVNLFYARGLQSLDVSNNKLEVIPVEIANLGHLEYFNCSHNKLKALPLTIFGLLKLQYMNLSHNQIQDIPEEIGNLKSLQTFLINSNEIVLIPSSI-------------------------STITSLKTIEASNNQMCHLPISWVG--SLKTLKLDGNQFQFIPS-QIYDCCEMKYLSLAKNYLKFIPIELVKLRNLRQLDLSFNSIEYIPCEMGYWTKLVDFNIHGNNITYFPQSLIANHKFVCLNISGCQLKEFPLLLCNCYDLMELRVGENELNELPDKFQLFCNMKYLFMNNN 359          

HSP 4 Score: 54.299 bits (129), Expect = 3.232e-7
Identity = 79/328 (24.09%), Postives = 136/328 (41.46%), Query Frame = 3
Query:  471 NLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKSCKLLQHLDIRHNHXXXXXXXXXXXXXXXXXXXXTHNKFTRLDGIGRLKKLETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRLNFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELXXXXXXXXXXPSAIVLKFQQMIKFNISHNKFINLP------------KFPNSESIKIEKFNAEYNNISR-------------ISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSDLPKDISRLS 1379
            +L EL +  N++++LP +     N+K L+M  N  + +P+++     L  LD  HN L                            GI  LK L                          L+LS N I+I P    E + L  LN  +NKI E+ ++I  +  L ++ + +N+L   P ++     LK LN+ +N ++   S    K++++   + S+NKF   P             F   E  KI+    E  N+ R             I   ++  ++LKVL +  N L EL  L++ +   L ++++  N L++LP  ++ LS
Sbjct:  327 DLMELRVGENELNELPDKFQLFCNMKYLFMNNNNFELIPLQVCLLSTLVELDFSHNFLWQVP-----------------------PGIFSLKHLR------------------------KLNLSFNNILIFPGCTAELSYLSELNVSHNKISEICDSISWMTFLYYLDLSFNELSTFPSAIFQLRYLKYLNLSNNLLDNF-SKTDKKWEELRTIDFSNNKFTEFPVELCVHDSIRKLVFDQKEGTKIKSLPVEIKNLWRLAELNLSNNEFLTIPPVIMELENLKVLEMANNILKEL-PLNLSDAKNLENIDVRNNQLTELPFSLTTLS 605          
The following BLAST results are available for this feature:
BLAST of SMED30008716 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SHOC24.295e-6037.03SHOC2 leucine rich repeat scaffold protein [Source... [more]
SHOC24.994e-4734.59SHOC2 leucine rich repeat scaffold protein [Source... [more]
SHOC26.086e-4037.02SHOC2 leucine rich repeat scaffold protein [Source... [more]
ERBIN1.058e-2228.60erbb2 interacting protein [Source:HGNC Symbol;Acc:... [more]
ERBIN1.107e-2228.78erbb2 interacting protein [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of SMED30008716 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
soc-26.798e-6037.61Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
soc-29.983e-6037.61Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
soc-21.208e-5937.61Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
soc-21.208e-5937.61Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
soc-22.172e-5937.61Leucine-rich repeat protein soc-2 [Source:UniProt... [more]
back to top
BLAST of SMED30008716 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sur-81.474e-6135.70gene:FBgn0038504 transcript:FBtr0339532[more]
Sur-81.474e-6135.70gene:FBgn0038504 transcript:FBtr0083448[more]
Sur-81.474e-6135.70gene:FBgn0038504 transcript:FBtr0083447[more]
Sur-82.841e-6135.62gene:FBgn0038504 transcript:FBtr0339531[more]
Lap13.585e-2928.99gene:FBgn0033984 transcript:FBtr0087407[more]
back to top
BLAST of SMED30008716 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shoc23.865e-5937.03SHOC2 leucine rich repeat scaffold protein [Source... [more]
shoc23.865e-5937.03SHOC2 leucine rich repeat scaffold protein [Source... [more]
shoc23.865e-5937.03SHOC2 leucine rich repeat scaffold protein [Source... [more]
erbin7.773e-2228.47erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GEN... [more]
erbin9.150e-2228.47erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30008716 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shoc21.227e-6136.48SHOC2 leucine-rich repeat scaffold protein [Source... [more]
shoc21.463e-6136.48SHOC2 leucine-rich repeat scaffold protein [Source... [more]
LRRD18.668e-2327.01leucine-rich repeats and death domain containing 1... [more]
prrc2a1.148e-2227.21proline rich coiled-coil 2A [Source:Xenbase;Acc:XB... [more]
prrc2a1.207e-2227.21proline rich coiled-coil 2A [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of SMED30008716 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shoc24.914e-6037.03Shoc2, leucine rich repeat scaffold protein [Sourc... [more]
Shoc24.914e-6037.03Shoc2, leucine rich repeat scaffold protein [Sourc... [more]
Shoc21.212e-3937.02Shoc2, leucine rich repeat scaffold protein [Sourc... [more]
Lrrd15.106e-2530.70leucine rich repeats and death domain containing 1... [more]
Erbin1.947e-2127.67Erbb2 interacting protein [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of SMED30008716 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4LXW1|SUR8_DROVI3.090e-6336.36Leucine-rich repeat protein soc-2 homolog OS=Droso... [more]
sp|B4JTV9|SUR8_DROGR4.929e-6336.36Leucine-rich repeat protein soc-2 homolog OS=Droso... [more]
sp|Q8AVI4|SHOC2_XENLA1.258e-6236.92Leucine-rich repeat protein SHOC-2 OS=Xenopus laev... [more]
sp|B5DX45|SUR8_DROPS3.503e-6235.62Leucine-rich repeat protein soc-2 homolog OS=Droso... [more]
sp|B3LWU3|SUR8_DROAN5.229e-6135.70Leucine-rich repeat protein soc-2 homolog OS=Droso... [more]
back to top
BLAST of SMED30008716 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LK301.047e-7741.59Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3Q0KP105.061e-7340.31Putative shoc2 OS=Schistosoma mansoni OX=6183 PE=4... [more]
A0A5J4NYI97.262e-7239.45Leucine-rich repeat protein SHOC2 (Fragment) OS=Pa... [more]
A0A4Z2DNU01.284e-7039.87Leucine-rich repeat protein soc-2 OS=Schistosoma j... [more]
A0A1V9XVE21.284e-6839.69Leucine-rich repeat protein soc-2-like OS=Tropilae... [more]
back to top
BLAST of SMED30008716 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shoc29.793e-6037.03SHOC2 leucine rich repeat scaffold protein [Source... [more]
shoc21.133e-5937.03SHOC2 leucine rich repeat scaffold protein [Source... [more]
erbin1.357e-2128.61erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GEN... [more]
erbin2.472e-2128.61erbb2 interacting protein [Source:ZFIN;Acc:ZDB-GEN... [more]
lrrc15.085e-2027.07leucine rich repeat containing 1 [Source:NCBI gene... [more]
back to top
BLAST of SMED30008716 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004940.13.113e-6036.73pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-... [more]
scrib6.037e-2127.17scribble planar cell polarity protein [Source:NCBI... [more]
ENSPMAT00000008894.14.529e-1625.72pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 ge... [more]
lrrc403.994e-1526.18leucine rich repeat containing 40 [Source:NCBI gen... [more]
ENSPMAT00000011392.11.775e-1233.90pep scaffold:Pmarinus_7.0:GL489956:7319:8005:-1 ge... [more]
back to top
BLAST of SMED30008716 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CYR12.904e-1027.92Adenylate cyclase; required for cAMP production an... [more]
CCR43.893e-940.96Component of the CCR4-NOT transcriptional complex;... [more]
back to top
BLAST of SMED30008716 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO374996.023e-6136.18Leucine-rich repeat protein soc-2 homolog [Source... [more]
EDO469742.135e-2130.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380395.228e-2129.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482179.459e-1726.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334325.180e-1532.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30008716 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shoc25.650e-5936.81SHOC2 leucine rich repeat scaffold protein [Source... [more]
shoc29.813e-4533.92SHOC2 leucine rich repeat scaffold protein [Source... [more]
erbin4.710e-2228.72erbb2 interacting protein [Source:NCBI gene;Acc:10... [more]
erbin5.716e-2228.72erbb2 interacting protein [Source:NCBI gene;Acc:10... [more]
erbin8.948e-2228.72erbb2 interacting protein [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30008716 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020939.10.000e+0100.00SMESG000020939.1[more]
SMESG000002900.14.328e-5238.33SMESG000002900.1[more]
SMESG000029655.11.354e-4431.33SMESG000029655.1[more]
SMESG000029655.11.513e-4431.33SMESG000029655.1[more]
SMESG000016748.17.339e-1826.76SMESG000016748.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008716 ID=SMED30008716|Name=SMED30008716|organism=Schmidtea mediterranea sexual|type=transcript|length=2274bp
ATATGGCTGAGAATAAATTCATATTTGCTGATCGTCATGGATTAATATGT
AGAATCAAATCTTCACAGAAAGAACCTCCGAAGACTCAGCCATTAATAAG
AGCGCGGACAAATTCTGTGACCGAAAATATGTTGGAAAACGAATCATTTA
CAGGCAGTCATTCTACAGATAATACTCTAAGTTCTTCATTCGAAAGTCTC
CATGTTTTCAACAATAATGAAATAAAAAAACCCGAATCCTTTTTTTACGG
ATTTTTTAATGATAATAACAGCAATTATTGTGCACACAAGAAAACTGTTA
CAATAATGGAACCGAATGGTCACAAAGTCTATCCAGTTAAACCAATAAAA
AAAGACAAAATTAATGATGGTAACAAAAAGATCGTAGAATGCCACTTAAA
AGCTAGCAGTTTTCTCGATTTATCATCGTCGAATCTCAGCCTTCTATCAA
GATCAATTTCTAAATTACAAAATTTAACCGAGCTCTATATCTATGGCAAT
AAAATCTCAAAACTTCCGAAGGAAATTGGAAATTTGATTAATTTAAAAGA
ATTATGGATGCAAGAGAACATAATTGACAGTTTGCCAATAGAAATGAAAA
GTTGCAAACTCCTTCAGCACTTGGACATTCGGCACAACCATTTGACAGAT
GACAGCCTGTTGGTGCTGACTAGTTTGGTGAATTTGAGGATCTTACTAAT
AACTCATAATAAATTCACTCGTCTTGATGGAATTGGTAGACTGAAGAAAC
TTGAGACATTGACTGTAAAAGGTAACAAGTTAGAAGGTTCGTTGACAAAG
TCATTGGGAAAATTACATTGTATGGTGACATTAGATTTGTCAAAGAACAG
AATAGTTATAATTCCAAATGAGCTTGGTGAATGCACTAAATTGAAACGTC
TCAATTTCGAATATAATAAAATCGTCGAATTGCCAGAAACAATTGGAAAT
CTTAAAGAGCTGGAATTCATTGGAATCAAGTACAATCAGTTGGAAAAAAT
CCCAGAGTCTCTCAGTGATTGTGGTCTGTTAAAAGAATTGAATATTGAAA
GCAATTCAATTGAAGAAATACCTAGTGCGATCGTTTTGAAATTCCAACAA
ATGATCAAGTTTAACATCTCCCACAATAAATTCATCAATTTGCCGAAATT
TCCAAATTCCGAATCCATCAAAATTGAAAAATTCAATGCTGAATATAATA
ACATATCTAGAATTTCCGGATCTGTGGTAAATGCACAGAGCTTGAAAGTT
CTTAATTTATGTTACAACAACTTGTCGGAACTTCAATCACTTGATATCCA
AAATTTGGTATGTCTAATCGACCTTAATTTGGCCTTTAACCATTTAAGTG
ATTTACCAAAGGACATCTCTCGACTTTCCCACCTCGAAAGTTTAGATTTA
ACAAACAATCTTTTGACAACTCTTCCAAAAGAAATCGGAATGTTGAAAAA
TTTAAAGTTCTTGAATTTAGAATCGAATCTTTTGTTAAAGATACCAGACG
AGTTTTGTGAGTTAGAAAAGCTGAAAAATCTCAATATAAGTAGTAATCAA
TTGAAAACATTTCCCAGTTGTATTGTAAAATTAAAAAATTTGGAAATGCT
TAACGTATCAGAAAACTTTTTTGCAGAATTACCAAAGTCTATTAATGAAC
TCGACCGATTAACTCACCTGTTTTTGAAAGATAACATTCTACTTAATACT
CTCCCAGTAACTTTAGCTGGGATGAAAAATCTTAATTTTCTCAGTCTTAA
TGGATGTCCATTGGGCGATATTCCGGGAGAGTACAGGAAAAGCCCAATCA
CAGTTATAGCGTATTTAAAAGCTCTTGATATCGGGCTGAAATTGCATGAA
TACTTGAAAATGTCCAATAATAAATCTACTGAAAAATCGTTGTTTTCTTC
AGATACAGCTCTAAACATTGTCAGTAACCAACCTTCTTCCAAGGTGTCCT
CGGCAGAAAACAACGACAGATTAGCAGAATTGAGACCGACTTCTCCACAA
AACTCTTCAAAGCAATCGGAGGGTCTCAGACCTCGGTCAATGTCAGCTAC
AGCCGCCTGTAAAAAAGAGCACATTGAAAAAGCAATAGATAGGAAATCAA
CACCAACGAAAATCACGATTCCGGAATCTCTAGTAAAGAAAATGAAGACA
ACAGAAGCCGGATTCTTAGCTTGTTCAAGGAAAATGACATCAAAAAAATA
AAAAAACCTTCTGATTAAAAATTGATTTTTAAAAAAAAGTTACAAATACG
AGTTTTTATTGGTAAACATAAATC
back to top

protein sequence of SMED30008716-orf-1

>SMED30008716-orf-1 ID=SMED30008716-orf-1|Name=SMED30008716-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=733bp
MAENKFIFADRHGLICRIKSSQKEPPKTQPLIRARTNSVTENMLENESFT
GSHSTDNTLSSSFESLHVFNNNEIKKPESFFYGFFNDNNSNYCAHKKTVT
IMEPNGHKVYPVKPIKKDKINDGNKKIVECHLKASSFLDLSSSNLSLLSR
SISKLQNLTELYIYGNKISKLPKEIGNLINLKELWMQENIIDSLPIEMKS
CKLLQHLDIRHNHLTDDSLLVLTSLVNLRILLITHNKFTRLDGIGRLKKL
ETLTVKGNKLEGSLTKSLGKLHCMVTLDLSKNRIVIIPNELGECTKLKRL
NFEYNKIVELPETIGNLKELEFIGIKYNQLEKIPESLSDCGLLKELNIES
NSIEEIPSAIVLKFQQMIKFNISHNKFINLPKFPNSESIKIEKFNAEYNN
ISRISGSVVNAQSLKVLNLCYNNLSELQSLDIQNLVCLIDLNLAFNHLSD
LPKDISRLSHLESLDLTNNLLTTLPKEIGMLKNLKFLNLESNLLLKIPDE
FCELEKLKNLNISSNQLKTFPSCIVKLKNLEMLNVSENFFAELPKSINEL
DRLTHLFLKDNILLNTLPVTLAGMKNLNFLSLNGCPLGDIPGEYRKSPIT
VIAYLKALDIGLKLHEYLKMSNNKSTEKSLFSSDTALNIVSNQPSSKVSS
AENNDRLAELRPTSPQNSSKQSEGLRPRSMSATAACKKEHIEKAIDRKST
PTKITIPESLVKKMKTTEAGFLACSRKMTSKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003591Leu-rich_rpt_typical-subtyp
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 294..315
e-value: 290.0
score: 1.3
coord: 154..177
e-value: 0.17
score: 21.0
coord: 457..479
e-value: 0.44
score: 19.6
coord: 526..549
e-value: 7.2
score: 14.4
coord: 411..433
e-value: 180.0
score: 2.9
coord: 434..456
e-value: 30.0
score: 9.4
coord: 480..502
e-value: 17.0
score: 11.5
coord: 340..362
e-value: 270.0
score: 1.5
coord: 316..339
e-value: 28.0
score: 9.5
coord: 224..246
e-value: 28.0
score: 9.6
coord: 270..293
e-value: 6.4
score: 14.8
coord: 503..525
e-value: 51.0
score: 7.5
NoneNo IPR availableSMARTSM00364LRR_bac_2coord: 480..499
e-value: 370.0
score: 1.7
coord: 154..173
e-value: 28.0
score: 10.3
coord: 339..358
e-value: 80.0
score: 6.8
coord: 503..522
e-value: 4.8
score: 16.2
coord: 316..335
e-value: 20.0
score: 11.4
coord: 293..312
e-value: 30.0
score: 10.1
coord: 363..382
e-value: 330.0
score: 2.2
coord: 457..476
e-value: 19.0
score: 11.6
coord: 410..429
e-value: 76.0
score: 7.0
coord: 526..545
e-value: 19.0
score: 11.5
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 549..565
e-value: 560.0
score: 1.3
coord: 270..291
e-value: 220.0
score: 4.7
coord: 457..490
e-value: 780.0
score: 0.1
coord: 224..245
e-value: 460.0
score: 2.0
coord: 154..179
e-value: 16.0
score: 13.9
coord: 293..318
e-value: 440.0
score: 2.2
coord: 503..531
e-value: 550.0
score: 1.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 641..702
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 641..677
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 682..698
NoneNo IPR availablePANTHERPTHR45752FAMILY NOT NAMEDcoord: 91..596
NoneNo IPR availablePANTHERPTHR45752:SF77LEUCINE-RICH REPEAT PROTEIN SOC-2 HOMOLOGcoord: 91..596
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 390..631
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 132..403
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 492..606
e-value: 3.9E-22
score: 80.4
coord: 387..491
e-value: 1.3E-22
score: 81.9
coord: 17..238
e-value: 1.4E-19
score: 72.1
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 239..386
e-value: 9.7E-31
score: 108.3
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 482..537
e-value: 7.9E-9
score: 35.1
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 482..503
score: 7.312
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 318..339
score: 5.325
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 528..549
score: 6.064
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 389..410
score: 4.763
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 156..177
score: 7.165
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 459..480
score: 7.743
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 436..458
score: 6.642
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 226..247
score: 7.05
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 341..362
score: 7.204
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 505..527
score: 6.726
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 295..316
score: 6.38
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 412..433
score: 7.735
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 575..596
score: 5.664
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 272..293
score: 5.848
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 202..222
score: 6.364
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 179..200
score: 6.464