Adenylate cyclase type

Overview
NameAdenylate cyclase type
Smed IDSMED30008711
Length (bp)3262
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenylate cyclase type (SMED30008711) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenylate cyclase type (SMED30008711) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adenylate cyclase type (SMED30008711) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adenylate cyclase type (SMED30008711) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008711

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30008711SMESG000009033.1 SmedASXL_014737SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30008711SMESG000009033.1 dd_Smed_v4_25342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008711SMESG000009033.1 dd_Smed_v4_25342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30008711SMESG000009033.1 dd_Smed_v6_25342_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008711SMESG000009033.1 dd_Smed_v6_20189_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30008711SMESG000009033.1 Contig41736newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008711SMESG000009033.1 Contig41736uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenylate cyclase type vs. Ensembl Human
Match: ADCY9 (adenylate cyclase 9 [Source:HGNC Symbol;Acc:HGNC:240])

HSP 1 Score: 224.942 bits (572), Expect = 2.250e-59
Identity = 128/355 (36.06%), Postives = 198/355 (55.77%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFL--------------------NRIRNSD------SFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQV 1434
            ++S+ + ++ L+YT+  +   + + L + Y ++F + G +FR    ++          L             ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +                    NR + S       +F     Q  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    +T CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G ++E + + V
Sbjct:  223 SFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFR----DEACFPSPGAGAL-------------HWELLSRGLLHGCIHAIGVHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGKVIERLGQSV 558          

HSP 2 Score: 196.438 bits (498), Expect = 2.322e-50
Identity = 116/255 (45.49%), Postives = 157/255 (61.57%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMAS--DEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++       ++  +Y+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+   +  S   EHL+IL  FA +M   +  FN  N +  F F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGTV VKGKG M T+L
Sbjct:  998 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL-------KVSQTYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1241          

HSP 3 Score: 63.5438 bits (153), Expect = 2.114e-9
Identity = 58/216 (26.85%), Postives = 103/216 (47.69%), Query Frame = 1
Query:  796 RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM-SSNKTAAKLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRT-------DHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            R K+QS ++ Q  W+   I+P  V E            S  Y ++ ++  ++FA IV F+     N    K  Y +LN+L   FDE   +   ++ EKI T+G  Y   SG    +        +H     E    M R++  FN +    +  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + VSE+++ +L +  Y+F+
Sbjct: 1018 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 1224          
BLAST of Adenylate cyclase type vs. Ensembl Human
Match: ADCY1 (adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:232])

HSP 1 Score: 190.66 bits (483), Expect = 5.187e-53
Identity = 104/267 (38.95%), Postives = 159/267 (59.55%), Query Frame = 1
Query:  715 MTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFL---NRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIP 1494
            M G+++R      ++ AFL+     E RL+++   + Q   + +++P +V    KE+FL    RI     F  +Y Q  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+TDHA  CVEMGL M   I    +  + D+NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E++G  G VH+++ T   +   Y  E G          H  +  +KT   + T+F++P
Sbjct:    1 MYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERI-----FHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPG--------YGHERNSFLKTH-NIETFFIVP 253          

HSP 2 Score: 50.8322 bits (120), Expect = 7.945e-6
Identity = 48/213 (22.54%), Postives = 84/213 (39.44%), Query Frame = 1
Query: 2431 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGK-KQSNEIIFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3060
             E++ R  F   R            N+  E LL +++P+ V  E+     +  E IF   Y     N  ++FA I  F     +      +  ++LL+ +   FD L  +       +IK + DCY   SGL          +H    +    DM   +    E   +      +++G + G +  G++G  K  YD+W + V +A+ M +  
Sbjct:   10 TERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQ---CTAQELVKLLNELFGKFDELATEN---HCRRIKILGDCYYCVSGLTQ-----PKTDHAHCCVEMGLDMIDTITSVAEATEV---DLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAG 208          
BLAST of Adenylate cyclase type vs. Ensembl Human
Match: ADCY1 (adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:232])

HSP 1 Score: 190.66 bits (483), Expect = 5.187e-53
Identity = 104/267 (38.95%), Postives = 159/267 (59.55%), Query Frame = 1
Query:  715 MTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFL---NRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIP 1494
            M G+++R      ++ AFL+     E RL+++   + Q   + +++P +V    KE+FL    RI     F  +Y Q  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+TDHA  CVEMGL M   I    +  + D+NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E++G  G VH+++ T   +   Y  E G          H  +  +KT   + T+F++P
Sbjct:    1 MYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERI-----FHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPG--------YGHERNSFLKTH-NIETFFIVP 253          

HSP 2 Score: 50.8322 bits (120), Expect = 7.945e-6
Identity = 48/213 (22.54%), Postives = 84/213 (39.44%), Query Frame = 1
Query: 2431 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGK-KQSNEIIFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3060
             E++ R  F   R            N+  E LL +++P+ V  E+     +  E IF   Y     N  ++FA I  F     +      +  ++LL+ +   FD L  +       +IK + DCY   SGL          +H    +    DM   +    E   +      +++G + G +  G++G  K  YD+W + V +A+ M +  
Sbjct:   10 TERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQ---CTAQELVKLLNELFGKFDELATEN---HCRRIKILGDCYYCVSGLTQ-----PKTDHAHCCVEMGLDMIDTITSVAEATEV---DLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAG 208          
BLAST of Adenylate cyclase type vs. Ensembl Human
Match: ADCY8 (adenylate cyclase 8 [Source:HGNC Symbol;Acc:HGNC:239])

HSP 1 Score: 202.601 bits (514), Expect = 2.589e-52
Identity = 99/248 (39.92%), Postives = 151/248 (60.89%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            +  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +N + N +       F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K DV+MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +H+S+ T   +   YN E+G
Sbjct:  321 VVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 568          

HSP 2 Score: 135.576 bits (340), Expect = 1.975e-31
Identity = 90/248 (36.29%), Postives = 129/248 (52.02%), Query Frame = 1
Query: 2422 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKG 3156
             ++ E   RL+F    +A+    E     +  E++L NI+P  V +  + K + NE +  Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  F+  +   ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE     LK   F F YRG + VKG
Sbjct:  916 GQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEETYLILKDQGFAFDYRGEIYVKG 1157          

HSP 3 Score: 101.293 bits (251), Expect = 7.174e-21
Identity = 80/289 (27.68%), Postives = 144/289 (49.83%), Query Frame = 1
Query:  847 IMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTD------HAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR-YNFE-KGDILEIMKEQVHGIS---GMIKT-----SVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNE---KHNFKRR 1635
            I+PS V  +FL + R+++    +Y Q ++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG    +        H  +  +  L +   I + NK    +  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + V E+T+L+++ + + F+ +G+I       V GIS   G IKT      V  N + + PR++  +         L     + S+    Q+ LLN+++N    K ++ RR
Sbjct:  954 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIY------VKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGL-----VQSLNRQRQKQLLNENNNTGIIKGHYNRR 1228          
BLAST of Adenylate cyclase type vs. Ensembl Human
Match: ADCY8 (adenylate cyclase 8 [Source:HGNC Symbol;Acc:HGNC:239])

HSP 1 Score: 201.83 bits (512), Expect = 2.804e-52
Identity = 99/248 (39.92%), Postives = 151/248 (60.89%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            +  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +N + N +       F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K DV+MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +H+S+ T   +   YN E+G
Sbjct:  321 VVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 568          

HSP 2 Score: 135.191 bits (339), Expect = 2.192e-31
Identity = 90/244 (36.89%), Postives = 127/244 (52.05%), Query Frame = 1
Query: 2434 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKG 3156
            E   RL+F    +A+    E     +  E++L NI+P  V +  + K + NE +  Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  F+  +   ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE     LK   F F YRG + VKG
Sbjct:  789 EYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEETYLILKDQGFAFDYRGEIYVKG 1026          

HSP 3 Score: 100.523 bits (249), Expect = 9.623e-21
Identity = 80/289 (27.68%), Postives = 144/289 (49.83%), Query Frame = 1
Query:  847 IMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTD------HAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR-YNFE-KGDILEIMKEQVHGIS---GMIKT-----SVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNE---KHNFKRR 1635
            I+PS V  +FL + R+++    +Y Q ++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG    +        H  +  +  L +   I + NK    +  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + V E+T+L+++ + + F+ +G+I       V GIS   G IKT      V  N + + PR++  +         L     + S+    Q+ LLN+++N    K ++ RR
Sbjct:  823 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIY------VKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGL-----VQSLNRQRQKQLLNENNNTGIIKGHYNRR 1097          
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Match: acy-1 (Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:Q19523])

HSP 1 Score: 220.705 bits (561), Expect = 1.784e-58
Identity = 133/371 (35.85%), Postives = 197/371 (53.10%), Query Frame = 1
Query:  478 IILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL---NRIRNSDSFSLVYCQH---------------------------FENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG-DILEIMKEQVHGISGMIKTSVPMNTYFVIPR 1497
            ++LL+YT+  +   + +L+ ++Y ++F  +   +I                           EE  YI  + +L   +++ G++L     +R++  FLK+ Q+  AR  ++   + + + I+++MP  V +  L   + +R   + +   C+                              NVSILFADI GFT MSSNK+A +LV LLNDL+ RFD   R    EKI TLGDCYYCV+GCP P  DHA   VEMGL M   I +F+ D  ++VNMRVGIH+G+V+  ++G  RF+FDVFS DV +AN +ESSG AG VHVSE T  L++  Y  E+G D    ++ QV G    +K    M T+F+  R
Sbjct:  162 VVLLIYTVIPLPLYLCILIGIIYSILFEILNKNKIG-------------------------LEEAGYI--KLVLHAGVHLLGVHLFILTQVRQRKTFLKVGQSMLARKDLELETQFKDHMIQSVMPKKVADELLKDASELRRPSASNDSNCRTSNATQVDQPLAKMVPEYRKFRPFTMNLMTNVSILFADIAGFTKMSSNKSADELVNLLNDLFGRFDTLCRLRGLEKISTLGDCYYCVAGCPEPCDDHACRTVEMGLDMIVAIRQFDIDRGQEVNMRVGIHTGKVMCGMVGTKRFKFDVFSNDVTLANEMESSGVAGRVHVSEATAKLLKGLYEIEEGPDYDGPLRMQVQGTERRVKPE-SMKTFFIKGR 504          

HSP 2 Score: 170.629 bits (431), Expect = 8.591e-43
Identity = 99/254 (38.98%), Postives = 144/254 (56.69%), Query Frame = 1
Query: 2434 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEE--MASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKG-KGDMTTFLAV 3186
            E   R++F+   +A             A+ LL N+IP    + +    +       Y+      GV+FA I+N+ +  Y E+++GG   LR+L+ +I  FD LL +P +  +EKIKTI   YM ASGLN + ++  +   EHL  ++ FA  + H L +FNE  +  NF F  K+G N GP+TAG+IGT+K  YDIWGDTVN+ASRMYST    + IQV +H    L   ++F++R  + VKG  G M T+L V
Sbjct:  992 ETAFRMSFFGDVQARRDTERMQIVRDQADWLLNNVIPAHAVESLKTDTK-------YSENHETVGVLFASITNW-NDMYEENFEGGREFLRVLNEVIGDFDELLDRPDFTHIEKIKTIGPAYMAASGLNPERKKNMLHPKEHLYQMVDFALAVQHVLSVFNEDLL--NFDFVCKLGLNIGPVTAGVIGTTKLYYDIWGDTVNIASRMYSTG-VLNRIQVSQHTREYLLDRYEFEFRDHIEVKGIDGGMDTYLLV 1234          

HSP 3 Score: 70.4774 bits (171), Expect = 7.278e-12
Identity = 71/285 (24.91%), Postives = 127/285 (44.56%), Query Frame = 1
Query:  694 ILLFLMYM--TGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSN--KTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRT-------DHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQ 1500
            ++ FL Y   T   + FF  ++        A+    R+++   ++ Q  W+   ++P+   E+     +        Y ++ E V +LFA I  +  M     +   + + +LN++   FDE   +   T+ EKI T+G  Y   SG    R        +H    V+  L +  ++  FN+D    D   ++G++ G V A +IG  +  +D++   V IA+ + S+G    + VS+ T   +  RY FE  D +E     V GI G       M+TY ++ R+
Sbjct:  983 LVAFLNYQFETAFRMSFFGDVQ--------ARRDTERMQI---VRDQADWLLNNVIPAHAVESLKTDTK--------YSENHETVGVLFASITNWNDMYEENFEGGREFLRVLNEVIGDFDELLDRPDFTHIEKIKTIGPAYMAASGLNPERKKNMLHPKEHLYQMVDFALAVQHVLSVFNEDLLNFDFVCKLGLNIGPVTAGVIGTTKLYYDIWGDTVNIASRMYSTGVLNRIQVSQHTREYLLDRYEFEFRDHIE-----VKGIDG------GMDTYLLVGRK 1237          

HSP 4 Score: 52.373 bits (124), Expect = 2.100e-6
Identity = 45/185 (24.32%), Postives = 82/185 (44.32%), Query Frame = 1
Query: 2620 NAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFK----YRGTVAVKGKG 3162
            N  ++FA I+ F         K  +  + LL+ +   FD L +      LEKI T+ DCY   +G          D+H    +    DM   +R F+   I       +++G + G +  G++GT +  +D++ + V +A+ M S+      + V E  A  LK  ++ +    Y G + ++ +G
Sbjct:  317 NVSILFADIAGFTK---MSSNKSADELVNLLNDLFGRFDTLCR---LRGLEKISTLGDCYYCVAGCPE-----PCDDHACRTVEMGLDMIVAIRQFD---IDRGQEVNMRVGIHTGKVMCGMVGTKRFKFDVFSNDVTLANEMESSG-VAGRVHVSEATAKLLKGLYEIEEGPDYDGPLRMQVQG 486          
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Match: acy-2 (Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:O16880])

HSP 1 Score: 157.532 bits (397), Expect = 9.245e-39
Identity = 74/162 (45.68%), Postives = 107/162 (66.05%), Query Frame = 1
Query:  880 NRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDT 1365
            N  +N   F  ++ Q  +NVSILFADIV FT++++  TA  LV  LN+LY++FD   ++  C +I  LGDCYYCVSG P+ R +HA  CV MGL M   I +       DVNMR+G+H+G V+  I+G  +++FD++S DV +AN +ES+G  G VH+++ T
Sbjct:  294 NNTKNHKLFHDLHVQVHDNVSILFADIVNFTVLAAQLTAKDLVRTLNELYSKFDRDAQRLQCMRIKFLGDCYYCVSGMPVNRPNHADMCVVMGLEMINTIKQVRIATGVDVNMRIGVHTGSVLCGIMGLRKWQFDIWSDDVTLANHMESAGVPGAVHITKST 455          

HSP 2 Score: 119.013 bits (297), Expect = 8.383e-27
Identity = 92/277 (33.21%), Postives = 134/277 (48.38%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHA-NKIAESLLYNIIPKQVFKEIVGKKQS-NEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLN---SDHEEMASDEH------------------LKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKL-YFDFKYRGTVAVKG-KGDMTTFL 3180
            R+ E    ++F    + E R+ E     NKI   L+ NI+P  V  + +   ++ NE+   YA    N  V+FA I NF   +   D       LRLL+ I+C FD LL KP +  +EKIKT+   YM A+GLN   +D++++  ++                     +++ FA  M   L   N  +      F L+IG + GP+ AG+IG  KP YDIWG+TVN+ASRM  T      I     +   L+   +  + RG + VKG K  M TFL
Sbjct:  790 RKRESACHVSF----QNEERDVETMQDINKI---LIENILPSSVAAKFLSPDRAVNEL---YARQHENVCVMFASIPNFKDFWSEWDTNRKLECLRLLNEIVCEFDKLLSKPKFSSVEKIKTVGSTYMAAAGLNESEADYDDIYLEKQNSGKYNNNIRHGNMAFRNANLMIEFALAMSQILDALNRDSFQN---FELRIGMSVGPLVAGVIGAQKPQYDIWGNTVNLASRM-DTHGEPRKIHATTDMGRVLQTGGYRVQSRGKIRVKGVKEPMETFL 1052          

HSP 3 Score: 74.3294 bits (181), Expect = 3.606e-13
Identity = 63/237 (26.58%), Postives = 112/237 (47.26%), Query Frame = 1
Query:  751 RRKSAFLKLAQNAEARLK-MQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGF-TMMSSNKTAAKL--VYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTDH--------------------------AISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSED 1362
            +R+SA     QN E  ++ MQ   KI I   E I+PSSV   FL+  R   + + +Y +  ENV ++FA I  F    S   T  KL  + LLN++   FD+   + + ++ EKI T+G  Y   +G      D+                          A   +E  L M +++   N+D  ++  +R+G+  G ++A +IG  + ++D++   V +A+ +++ G+   +H + D
Sbjct:  791 KRESACHVSFQNEERDVETMQDINKILI---ENILPSSVAAKFLSPDR---AVNELYARQHENVCVMFASIPNFKDFWSEWDTNRKLECLRLLNEIVCEFDKLLSKPKFSSVEKIKTVGSTYMAAAGLNESEADYDDIYLEKQNSGKYNNNIRHGNMAFRNANLMIEFALAMSQILDALNRDSFQNFELRIGMSVGPLVAGVIGAQKPQYDIWGNTVNLASRMDTHGEPRKIHATTD 1021          

HSP 4 Score: 50.447 bits (119), Expect = 7.441e-6
Identity = 55/218 (25.23%), Postives = 86/218 (39.45%), Query Frame = 1
Query: 2470 EAEIRNAEATHANKIAESLLYNIIP----KQVFKEIV--------------GKKQS-NEIIFSYAHA--FANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3060
            EA  R  E        E LL ++IP     QV K I+              GK  + N  +F   H     N  ++FA I NF     +   K     +R L+ +   FD   ++   L+  +IK + DCY   SG+  +        H  + +    +M   +    +  I       ++IG + G +  GI+G  K  +DIW D V +A+ M S  
Sbjct:  241 EAVYRRTELETLKDRQEQLLLSVIPAYLADQVSKSIIQSSSTGSTVEVPRTGKNNTKNHKLFHDLHVQVHDNVSILFADIVNFTVLAAQLTAKD---LVRTLNELYSKFDRDAQR---LQCMRIKFLGDCYYCVSGMPVNRPN-----HADMCVVMGLEM---INTIKQVRIATGVDVNMRIGVHTGSVLCGIMGLRKWQFDIWSDDVTLANHMESAG 444          
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Match: acy-4 (Adenylate cyclase [Source:UniProtKB/TrEMBL;Acc:Q966F9])

HSP 1 Score: 149.828 bits (377), Expect = 2.218e-36
Identity = 80/246 (32.52%), Postives = 138/246 (56.10%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVK---ENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGD 1407
            I  + +++ L+ + G  + +     ++  F +  +  ++R+ +   +  Q   + A++P ++    +  +        F  +Y + +E++SILFADI GFT ++S      LV +LN+L+ RFD+      C +I  LGDCYYCV G P  + +HAI+ VEMG  M   I    +    +VNMRVGIH+G+    ++G  +++FDV+S DV +AN +ES G AG VH+++ T   ++  Y  E+G+
Sbjct:  212 ILTRVMMVILVNVVGSLVYYPTEFVQRKTFHETRKCVQSRMLLDKEMHRQEKILLAVLPKNIAFEVKKDMQETHEERMFHKIYIRKYEDISILFADICGFTNLASEYNPKDLVLMLNELFARFDKVASIHQCMRIKILGDCYYCVCGVPEYQKNHAINTVEMGRDMIEAIRLVREMTLVNVNMRVGIHTGKAHCGVLGLKKWQFDVWSNDVTLANQMESGGLAGRVHITDATRSYLKGAYILEEGN 457          

HSP 2 Score: 135.576 bits (340), Expect = 5.698e-32
Identity = 94/258 (36.43%), Postives = 137/258 (53.10%), Query Frame = 1
Query: 2422 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPI----YLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTF 3177
             R +E   R +F    +A     +    ++   S+L NI+P  V K  V  + +  +   Y  +  NA ++FA ++ F   Y   D    G   LRLL+ II  FD +L + +    + K+EKIKTI+  YM+ASGL     E   + H++ +  FA ++   L      NI     F L+IG N GP+ AG+IG+ KP YDIWG++VNVASRM  +      IQV E V + L+ L ++F+ RG + VKGKG M TF
Sbjct:  750 TRRSELISRYDFIWKLQALDEQLQMKRKHEQNRSVLENILPSHVAKHFV--EDATSVSKLYHESRDNACIMFATLTEFDKFYIECDGNNEGVECLRLLNEIISDFDQILDQILDREEFKKIEKIKTISTTYMVASGLAG--RECGDNSHVEAIALFAREL---LVKLESTNIHSFNNFNLRIGINVGPVVAGVIGSDKPHYDIWGNSVNVASRM-DSGGVAGRIQVTEEVKSILEPLGYNFECRGQINVKGKGMMETF 999          

HSP 3 Score: 76.2554 bits (186), Expect = 9.558e-14
Identity = 87/348 (25.00%), Postives = 153/348 (43.97%), Query Frame = 1
Query:  499 LFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM----SSNKTAAKLVYLLNDLYNRFDEQGRQ-------TNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKF---NKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDT-FLLVRHRYNFE-KGDILEIMKEQVHGISGMIKTSVPMNTYFVIP 1494
            +  + FM  +L+S++Y   F  +   ++  + Q E  +ST ++                +    C+ L L+  +    R    I R     KL Q  + +L+M+   +     +E I+PS V ++F   + ++ S S +Y +  +N  I+FA +  F         N    + + LLN++ + FD+   Q          EKI T+   Y   SG              + L    L+VK    N     + N+R+GI+ G V+A +IG+ +  +D++   V +A+ ++S G AG + V+E+   +L    YNFE +G I       V G  GM      M T+F++P
Sbjct:  692 ILSVDFMTKLLMSMIYFSSFTVLITAKLIRINQYEALLSTYAN----------------FCVLSCLTLLLVVFST---RRSELISRYDFIWKL-QALDEQLQMKRKHEQNRSVLENILPSHVAKHF---VEDATSVSKLYHESRDNACIMFATLTEFDKFYIECDGNNEGVECLRLLNEIISDFDQILDQILDREEFKKIEKIKTISTTYMVASGLAGRECGDNSHVEAIALFARELLVKLESTNIHSFNNFNLRIGINVGPVVAGVIGSDKPHYDIWGNSVNVASRMDSGGVAGRIQVTEEVKSILEPLGYNFECRGQI------NVKG-KGM------METFFLLP 1003          
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Match: gcy-13 (Receptor-type guanylate cyclase gcy-13 [Source:UniProtKB/Swiss-Prot;Acc:Q19768])

HSP 1 Score: 110.538 bits (275), Expect = 3.291e-24
Identity = 63/174 (36.21%), Postives = 102/174 (58.62%), Query Frame = 1
Query:  913 VYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPR-TDHAISCVEMGLGMCRLIVKFNKDH--KEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVR---HRYNFE-KGDIL 1413
            V  + FE+V+I F+D+VGFT++++  T  ++V LLNDLY  FD    + +  K+ T+GD Y  VSG P    T+H  +   M L +   +  F   H  +E V +R+G+HSG  +A ++G    R+ +F   V  A+ +ES+GK GF+H+S D + L+      YN E +G+++
Sbjct:  835 VEPEAFESVTIFFSDVVGFTVLANKSTPLQVVNLLNDLYTTFDAIIEKNDSYKVETIGDAYLVVSGLPRRNGTEHVANIANMSLELMDSLQAFKIPHLPQEKVQIRIGMHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNGKPGFIHLSSDCYDLLTSLYKEYNTESRGEVI 1008          

HSP 2 Score: 72.4034 bits (176), Expect = 1.498e-12
Identity = 67/240 (27.92%), Postives = 115/240 (47.92%), Query Frame = 1
Query: 2470 EAEIRNAEATHANKIAESLLYNIIPKQVFKEI-VGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLY--FDFKYRGTVAVKGKGDMTTF 3177
            E + R  E     K ++ LLY ++P+QV + + +G+    E   S    F++  V F  ++N  +             + LL+ +  TFD +++K    K+E   TI D Y++ SGL   +      EH+  +   + ++   L+ F   ++       ++IG + G   AG++G + P Y ++GDTVN ASRM S       I +     + L  LY  ++ + RG V +KGKG M T+
Sbjct:  798 EVQERMKELVEEKKKSDILLYRMLPQQVAERLKLGQSVEPEAFESVTIFFSDV-VGFTVLANKSTPLQ---------VVNLLNDLYTTFDAIIEKNDSYKVE---TIGDAYLVVSGLPRRN----GTEHVANIANMSLELMDSLQAFKIPHLPQE-KVQIRIGMHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNGK-PGFIHLSSDCYDLLTSLYKEYNTESRGEVIIKGKGVMQTY 1018          
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 108.612 bits (270), Expect = 1.488e-23
Identity = 59/164 (35.98%), Postives = 93/164 (56.71%), Query Frame = 1
Query:  913 VYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHK--EDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFE 1398
            V  + ++ V+I F+DIVGFT +SS  T  ++V LLNDLY  FD         K+ T+GD Y  VSG P  R DHA    +M L +   +  F   H+  E + +R+G+HSG V+A ++G+   R+ +F   V  ++ +ES+G    +HVS+ T+ ++     F+
Sbjct: 1077 VQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDDHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFK 1240          

HSP 2 Score: 73.9442 bits (180), Expect = 6.421e-13
Identity = 65/243 (26.75%), Postives = 109/243 (44.86%), Query Frame = 1
Query: 2476 EIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLF------NEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEHVANKL--KLYFDFKYRGTVAVKGKGDMTTF 3177
            E R  E     K  E LL+ ++P  +   ++  +         A ++    + F+ I  F S   +         + LL+ +   FD ++      K+ K++TI D YM+ SGL         D+H   +   +  + H ++ F      +EQ         L+IG + G + AG++G+  P Y ++GDTVN +SRM S   P    I V +   + L  +  F  + RG+V +KGKG  TT+
Sbjct: 1042 EERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQ------AESYDCVTIYFSDIVGFTSLSSQSTPMQ---VVTLLNDLYLAFDGVVDN---FKVYKVETIGDAYMVVSGLPERR-----DDHANQIAQMSLSLLHKVKNFVIRHRPHEQ-------LKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPL--KIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTY 1258          
BLAST of Adenylate cyclase type vs. Ensembl Fly
Match: Ac13E (gene:FBgn0022710 transcript:FBtr0074073)

HSP 1 Score: 218.394 bits (555), Expect = 1.813e-57
Identity = 119/287 (41.46%), Postives = 163/287 (56.79%), Query Frame = 1
Query:  709 MYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLN-------------------RIRNSDS----FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQ 1500
            +++ G+++   N +R +  F+K+ QN   R +++   +++   I ++MP  V +  LN                   R R S+     F   +    ENVSILFADIVGFT MSS KTA +LV +LNDL+ RFD+    + CEKI TLGDCYYCVSGCP PR DHAI CVEMGLGM   +  F+    E V MRVG+H+G V+  I+G  R +FDV+S DV +AN +ESSGK   VH+S++T   +   Y  E+G       E+V G            TYFV+ R+
Sbjct:  255 VHLVGVHVLIMNLVRMRGTFMKVGQNLLVRRQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRADHAICCVEMGLGMIDAMRCFDAQRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEG-------EEVFG----------HRTYFVVGRR 524          

HSP 2 Score: 166.007 bits (419), Expect = 4.726e-41
Identity = 104/252 (41.27%), Postives = 136/252 (53.97%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E   RL FY    A        +    A+ LL+NIIPK V + +    +       Y+    N  +IFA I NF +  Y E Y GG+  LR+L+ +I  FD LL +P +  +EKIKTI   +M ASGL+  H     DEH+  LM F+  M   +  FN+  +   F   L+IG N G +TAG+IGTSK  YDIWGD VNVASRM ST    + IQV +     L   ++F+ RG+V VKGK  M  FL
Sbjct: 1323 REFEIGYRLTFYGNAVANQDKVRVQNMKNQADMLLHNIIPKHVAEHLKNTAK-------YSENHHNIAIIFASIVNF-NEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTG-DEHIHTLMEFSIAMQEVVDAFNKDLL--EFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTG-LPNRIQVGKDCLPFLTNRYEFEPRGSVYVKGKDHMEVFL 1562          

HSP 3 Score: 78.1814 bits (191), Expect = 3.768e-14
Identity = 79/353 (22.38%), Postives = 162/353 (45.89%), Query Frame = 1
Query:  394 VIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLF-RMKFMVVMLLSLLYILIFVSIGNFRI------KYVEQKELNVST-VSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-PIPR---TDHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFE 1398
            V++ +   +LL  +  E  E +Y  ++ + ++ +  F ++   V  +L+ L  L F+ I   ++      +  +Q++   S  + +++  + +  +I+ +   I      L   +  G  L F+ +          A   + ++++Q+        +  I+P  V E+  N  +        Y ++  N++I+FA IV F  M   S     + + +LN+L   FDE   +      EKI T+G  +   SG  P  R    +H  + +E  + M  ++  FNKD  E ++ +R+G++ G V A +IG  +  +D++   V +A+ ++S+G    + V +D    + +RY FE
Sbjct: 1211 VLLIIANFLLLDLEQLEAFEYHYGFLIFVCIVHFCNFTQLNCWVRNVLAFLAALCFIGIAVSQLMVYSHNRSDQQQDQEASNFIQEIKWFQDYHVEIYLDLLLILVLVWFLNREFEIGYRLTFYGN----------AVANQDKVRVQNMKNQADMLLHNIIPKHVAEHLKNTAK--------YSENHHNIAIIFASIVNFNEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGDEHIHTLMEFSIAMQEVVDAFNKDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTGLPNRIQVGKDCLPFLTNRYEFE 1545          

HSP 4 Score: 57.7658 bits (138), Expect = 6.678e-8
Identity = 41/153 (26.80%), Postives = 70/153 (45.75%), Query Frame = 1
Query: 2602 YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3060
            + H+  N  ++FA I  F         K  E  + +L+ +   FD+L         EKI T+ DCY   SG      E  +D H    +     M   +R F+ Q   G     +++G + G +  GI+GT +  +D+W + V++A++M S+ 
Sbjct:  347 HMHSMENVSILFADIVGF---TRMSSTKTAEQLVEILNDLFERFDDLCS---LSGCEKISTLGDCYYCVSGC----PEPRAD-HAICCVEMGLGMIDAMRCFDAQRHEG---VKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSG 485          
BLAST of Adenylate cyclase type vs. Ensembl Fly
Match: Ac13E (gene:FBgn0022710 transcript:FBtr0100142)

HSP 1 Score: 218.394 bits (555), Expect = 1.813e-57
Identity = 119/287 (41.46%), Postives = 163/287 (56.79%), Query Frame = 1
Query:  709 MYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLN-------------------RIRNSDS----FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQ 1500
            +++ G+++   N +R +  F+K+ QN   R +++   +++   I ++MP  V +  LN                   R R S+     F   +    ENVSILFADIVGFT MSS KTA +LV +LNDL+ RFD+    + CEKI TLGDCYYCVSGCP PR DHAI CVEMGLGM   +  F+    E V MRVG+H+G V+  I+G  R +FDV+S DV +AN +ESSGK   VH+S++T   +   Y  E+G       E+V G            TYFV+ R+
Sbjct:  255 VHLVGVHVLIMNLVRMRGTFMKVGQNLLVRRQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRADHAICCVEMGLGMIDAMRCFDAQRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEG-------EEVFG----------HRTYFVVGRR 524          

HSP 2 Score: 166.007 bits (419), Expect = 4.726e-41
Identity = 104/252 (41.27%), Postives = 136/252 (53.97%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E   RL FY    A        +    A+ LL+NIIPK V + +    +       Y+    N  +IFA I NF +  Y E Y GG+  LR+L+ +I  FD LL +P +  +EKIKTI   +M ASGL+  H     DEH+  LM F+  M   +  FN+  +   F   L+IG N G +TAG+IGTSK  YDIWGD VNVASRM ST    + IQV +     L   ++F+ RG+V VKGK  M  FL
Sbjct: 1323 REFEIGYRLTFYGNAVANQDKVRVQNMKNQADMLLHNIIPKHVAEHLKNTAK-------YSENHHNIAIIFASIVNF-NEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTG-DEHIHTLMEFSIAMQEVVDAFNKDLL--EFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTG-LPNRIQVGKDCLPFLTNRYEFEPRGSVYVKGKDHMEVFL 1562          

HSP 3 Score: 78.1814 bits (191), Expect = 3.768e-14
Identity = 79/353 (22.38%), Postives = 162/353 (45.89%), Query Frame = 1
Query:  394 VIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLF-RMKFMVVMLLSLLYILIFVSIGNFRI------KYVEQKELNVST-VSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-PIPR---TDHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFE 1398
            V++ +   +LL  +  E  E +Y  ++ + ++ +  F ++   V  +L+ L  L F+ I   ++      +  +Q++   S  + +++  + +  +I+ +   I      L   +  G  L F+ +          A   + ++++Q+        +  I+P  V E+  N  +        Y ++  N++I+FA IV F  M   S     + + +LN+L   FDE   +      EKI T+G  +   SG  P  R    +H  + +E  + M  ++  FNKD  E ++ +R+G++ G V A +IG  +  +D++   V +A+ ++S+G    + V +D    + +RY FE
Sbjct: 1211 VLLIIANFLLLDLEQLEAFEYHYGFLIFVCIVHFCNFTQLNCWVRNVLAFLAALCFIGIAVSQLMVYSHNRSDQQQDQEASNFIQEIKWFQDYHVEIYLDLLLILVLVWFLNREFEIGYRLTFYGN----------AVANQDKVRVQNMKNQADMLLHNIIPKHVAEHLKNTAK--------YSENHHNIAIIFASIVNFNEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGDEHIHTLMEFSIAMQEVVDAFNKDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTGLPNRIQVGKDCLPFLTNRYEFE 1545          

HSP 4 Score: 57.7658 bits (138), Expect = 6.678e-8
Identity = 41/153 (26.80%), Postives = 70/153 (45.75%), Query Frame = 1
Query: 2602 YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3060
            + H+  N  ++FA I  F         K  E  + +L+ +   FD+L         EKI T+ DCY   SG      E  +D H    +     M   +R F+ Q   G     +++G + G +  GI+GT +  +D+W + V++A++M S+ 
Sbjct:  347 HMHSMENVSILFADIVGF---TRMSSTKTAEQLVEILNDLFERFDDLCS---LSGCEKISTLGDCYYCVSGC----PEPRAD-HAICCVEMGLGMIDAMRCFDAQRHEG---VKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSG 485          
BLAST of Adenylate cyclase type vs. Ensembl Fly
Match: Ac13E (gene:FBgn0022710 transcript:FBtr0332497)

HSP 1 Score: 218.394 bits (555), Expect = 1.827e-57
Identity = 119/287 (41.46%), Postives = 163/287 (56.79%), Query Frame = 1
Query:  709 MYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLN-------------------RIRNSDS----FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQ 1500
            +++ G+++   N +R +  F+K+ QN   R +++   +++   I ++MP  V +  LN                   R R S+     F   +    ENVSILFADIVGFT MSS KTA +LV +LNDL+ RFD+    + CEKI TLGDCYYCVSGCP PR DHAI CVEMGLGM   +  F+    E V MRVG+H+G V+  I+G  R +FDV+S DV +AN +ESSGK   VH+S++T   +   Y  E+G       E+V G            TYFV+ R+
Sbjct:  268 VHLVGVHVLIMNLVRMRGTFMKVGQNLLVRRQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRADHAICCVEMGLGMIDAMRCFDAQRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEG-------EEVFG----------HRTYFVVGRR 537          

HSP 2 Score: 166.007 bits (419), Expect = 4.960e-41
Identity = 104/252 (41.27%), Postives = 136/252 (53.97%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E   RL FY    A        +    A+ LL+NIIPK V + +    +       Y+    N  +IFA I NF +  Y E Y GG+  LR+L+ +I  FD LL +P +  +EKIKTI   +M ASGL+  H     DEH+  LM F+  M   +  FN+  +   F   L+IG N G +TAG+IGTSK  YDIWGD VNVASRM ST    + IQV +     L   ++F+ RG+V VKGK  M  FL
Sbjct: 1336 REFEIGYRLTFYGNAVANQDKVRVQNMKNQADMLLHNIIPKHVAEHLKNTAK-------YSENHHNIAIIFASIVNF-NEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTG-DEHIHTLMEFSIAMQEVVDAFNKDLL--EFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTG-LPNRIQVGKDCLPFLTNRYEFEPRGSVYVKGKDHMEVFL 1575          

HSP 3 Score: 78.1814 bits (191), Expect = 4.286e-14
Identity = 79/353 (22.38%), Postives = 162/353 (45.89%), Query Frame = 1
Query:  394 VIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLF-RMKFMVVMLLSLLYILIFVSIGNFRI------KYVEQKELNVST-VSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-PIPR---TDHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFE 1398
            V++ +   +LL  +  E  E +Y  ++ + ++ +  F ++   V  +L+ L  L F+ I   ++      +  +Q++   S  + +++  + +  +I+ +   I      L   +  G  L F+ +          A   + ++++Q+        +  I+P  V E+  N  +        Y ++  N++I+FA IV F  M   S     + + +LN+L   FDE   +      EKI T+G  +   SG  P  R    +H  + +E  + M  ++  FNKD  E ++ +R+G++ G V A +IG  +  +D++   V +A+ ++S+G    + V +D    + +RY FE
Sbjct: 1224 VLLIIANFLLLDLEQLEAFEYHYGFLIFVCIVHFCNFTQLNCWVRNVLAFLAALCFIGIAVSQLMVYSHNRSDQQQDQEASNFIQEIKWFQDYHVEIYLDLLLILVLVWFLNREFEIGYRLTFYGN----------AVANQDKVRVQNMKNQADMLLHNIIPKHVAEHLKNTAK--------YSENHHNIAIIFASIVNFNEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGDEHIHTLMEFSIAMQEVVDAFNKDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTGLPNRIQVGKDCLPFLTNRYEFE 1558          

HSP 4 Score: 57.7658 bits (138), Expect = 6.302e-8
Identity = 41/153 (26.80%), Postives = 70/153 (45.75%), Query Frame = 1
Query: 2602 YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3060
            + H+  N  ++FA I  F         K  E  + +L+ +   FD+L         EKI T+ DCY   SG      E  +D H    +     M   +R F+ Q   G     +++G + G +  GI+GT +  +D+W + V++A++M S+ 
Sbjct:  360 HMHSMENVSILFADIVGF---TRMSSTKTAEQLVEILNDLFERFDDLCS---LSGCEKISTLGDCYYCVSGC----PEPRAD-HAICCVEMGLGMIDAMRCFDAQRHEG---VKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSG 498          
BLAST of Adenylate cyclase type vs. Ensembl Fly
Match: rut (gene:FBgn0003301 transcript:FBtr0333655)

HSP 1 Score: 186.808 bits (473), Expect = 1.851e-47
Identity = 116/379 (30.61%), Postives = 191/379 (50.40%), Query Frame = 1
Query:  370 IMRFASAMVIICM-TYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRN--SDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKE-QVHGISGMIKTSVPMNTYFVIP 1494
            I+ F +++ ++ M T   +   D+ E+M      +V ++ L Y +  ++    +   +    + +S+  ++I                +++R      + EY  +    ++   + + GL +       ++  FL       +RL++Q   +     + +++P  V     N I +  +  F  +Y Q  ENVSILFADIVGFT++SS  +A +LV LLN+L+ RFD+     +C +I  LGDCYYCVSG P PR DHA   VEMGL M   I    +     +NMRVGIH+GRV+  ++G  +++FDV+S DV +AN +ES G+ G VHV+  T   +   Y  E G   E     + HG+          +T+F++P
Sbjct:  102 ILLFTASICVVSMPTLGSVFPVDTKEVMAEGVWQIVFVVFLAYAMMPLQIWEAVAFGIALPSVHISLTVYKIF--------------TDALR------YLEYNQLIANIVIFIGVNVAGLVVNIMMERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLSGEYEVEAGHGDERSSYLRDHGV----------DTFFIVP 450          

HSP 2 Score: 149.828 bits (377), Expect = 5.317e-36
Identity = 95/256 (37.11%), Postives = 136/256 (53.12%), Query Frame = 1
Query: 2434 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-----EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTF 3177
            E   RL+F    +A     E     +  + +L+N++P  V    +  +  N +   Y  ++A  GVIFA + NF   Y   D    G   LRLL+ II  FD LLK+  +  ++KIKT+   YM   GL  +++   +D      H+  L+ +   M H L+  N  +      F L++G N GP+ AG+IG  KP YDIWG+TVNVASRM ST  P  S  QV + V + L   +F+F+ RGT+ VKGKGDM T+
Sbjct:  823 EGTARLDFLWQLQASQEKKEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNMEL-YHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHSY---NNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYS--QVTQEVVDSLVGSHFEFRCRGTIKVKGKGDMVTY 1072          

HSP 3 Score: 66.2402 bits (160), Expect = 1.691e-10
Identity = 53/217 (24.42%), Postives = 102/217 (47.00%), Query Frame = 1
Query:  766 FLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLN-RIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC----------PIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSED 1362
            FL   Q ++ + +M    +     +  ++P+ V  +FL+ + RN+     +Y Q +  V ++FA +  F    T M  +    + + LLN++   FDE   + R    +KI T+G  Y  V G           P     H  + +E    M   + + N     +  +RVGI+ G V+A +IG  + ++D++   V +A+ ++S+G  G+  V+++
Sbjct:  830 FLWQLQASQEKKEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNME---LYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHSYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQE 1043          

HSP 4 Score: 55.0694 bits (131), Expect = 4.817e-7
Identity = 54/219 (24.66%), Postives = 89/219 (40.64%), Query Frame = 1
Query: 2434 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAF--------ANAGVIFACISNF--FSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3060
            E+  R  F  TR       E    N+  E LL +++P+ V  ++      N+I+   A  F         N  ++FA I  F   SS         +  +RLL+ +   FD L      L+   IK + DCY   SGL    ++     H K  +    DM   +    E     +    +++G + G +  G++G  K  +D+W + V +A+ M S  
Sbjct:  208 ERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQM-----KNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQC-----SAQELVRLLNELFGRFDQLAHDNHCLR---IKILGDCYYCVSGLPEPRKD-----HAKCAVEMGLDMIDAIATVVEAT---DVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGG 405          
BLAST of Adenylate cyclase type vs. Ensembl Fly
Match: rut (gene:FBgn0003301 transcript:FBtr0340467)

HSP 1 Score: 186.808 bits (473), Expect = 1.851e-47
Identity = 116/379 (30.61%), Postives = 191/379 (50.40%), Query Frame = 1
Query:  370 IMRFASAMVIICM-TYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRN--SDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKE-QVHGISGMIKTSVPMNTYFVIP 1494
            I+ F +++ ++ M T   +   D+ E+M      +V ++ L Y +  ++    +   +    + +S+  ++I                +++R      + EY  +    ++   + + GL +       ++  FL       +RL++Q   +     + +++P  V     N I +  +  F  +Y Q  ENVSILFADIVGFT++SS  +A +LV LLN+L+ RFD+     +C +I  LGDCYYCVSG P PR DHA   VEMGL M   I    +     +NMRVGIH+GRV+  ++G  +++FDV+S DV +AN +ES G+ G VHV+  T   +   Y  E G   E     + HG+          +T+F++P
Sbjct:  102 ILLFTASICVVSMPTLGSVFPVDTKEVMAEGVWQIVFVVFLAYAMMPLQIWEAVAFGIALPSVHISLTVYKIF--------------TDALR------YLEYNQLIANIVIFIGVNVAGLVVNIMMERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLSGEYEVEAGHGDERSSYLRDHGV----------DTFFIVP 450          

HSP 2 Score: 149.828 bits (377), Expect = 5.317e-36
Identity = 95/256 (37.11%), Postives = 136/256 (53.12%), Query Frame = 1
Query: 2434 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-----EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTF 3177
            E   RL+F    +A     E     +  + +L+N++P  V    +  +  N +   Y  ++A  GVIFA + NF   Y   D    G   LRLL+ II  FD LLK+  +  ++KIKT+   YM   GL  +++   +D      H+  L+ +   M H L+  N  +      F L++G N GP+ AG+IG  KP YDIWG+TVNVASRM ST  P  S  QV + V + L   +F+F+ RGT+ VKGKGDM T+
Sbjct:  823 EGTARLDFLWQLQASQEKKEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNMEL-YHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHSY---NNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYS--QVTQEVVDSLVGSHFEFRCRGTIKVKGKGDMVTY 1072          

HSP 3 Score: 66.2402 bits (160), Expect = 1.691e-10
Identity = 53/217 (24.42%), Postives = 102/217 (47.00%), Query Frame = 1
Query:  766 FLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLN-RIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC----------PIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSED 1362
            FL   Q ++ + +M    +     +  ++P+ V  +FL+ + RN+     +Y Q +  V ++FA +  F    T M  +    + + LLN++   FDE   + R    +KI T+G  Y  V G           P     H  + +E    M   + + N     +  +RVGI+ G V+A +IG  + ++D++   V +A+ ++S+G  G+  V+++
Sbjct:  830 FLWQLQASQEKKEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNME---LYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEINSHSYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQE 1043          

HSP 4 Score: 55.0694 bits (131), Expect = 4.817e-7
Identity = 54/219 (24.66%), Postives = 89/219 (40.64%), Query Frame = 1
Query: 2434 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAF--------ANAGVIFACISNF--FSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3060
            E+  R  F  TR       E    N+  E LL +++P+ V  ++      N+I+   A  F         N  ++FA I  F   SS         +  +RLL+ +   FD L      L+   IK + DCY   SGL    ++     H K  +    DM   +    E     +    +++G + G +  G++G  K  +D+W + V +A+ M S  
Sbjct:  208 ERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQM-----KNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQC-----SAQELVRLLNELFGRFDQLAHDNHCLR---IKILGDCYYCVSGLPEPRKD-----HAKCAVEMGLDMIDAIATVVEAT---DVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGG 405          
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Match: adcy9 (adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-050208-455])

HSP 1 Score: 211.846 bits (538), Expect = 2.181e-55
Identity = 133/368 (36.14%), Postives = 198/368 (53.80%), Query Frame = 1
Query:  526 MLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLN-----------------------------------RIRNSDSFSLVYCQHF-----ENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQI 1503
            +LL LLY +++ ++G     ++   +L+ S V   E I    +      +   G+ +L    ++ G+++   + +R +S FLK+ Q       L+++ A+K ++  I ++MP SV +  +                                    R +NS     +  + F     E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T+CEKI TLGDCYYCV+GCP P TDHA  CVEMGLGM + I +F ++  E VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G ++E +    H ++  +K    + TY +  R++
Sbjct:  252 VLLGLLYSVLYEALG-----WLHLAQLDESYVGSREGISGTLS------WLGPGKFLLHLCAHVVGIHIFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPRSVADELMKQGDEESESSGKRYSAGTCSVAAAAAVTSSSPKSHKRKKNSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCELTSCEKISTLGDCYYCVAGCPEPLTDHAYCCVEMGLGMIQAIEQFCQEMSETVNMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVHLSEVTAGFLDDRYEREDGRVIERVG---HSVTDQLKG---LKTYLISGRKL 600          

HSP 2 Score: 188.734 bits (478), Expect = 4.112e-48
Identity = 115/255 (45.10%), Postives = 154/255 (60.39%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E + RL+++   EA+    +       A+ LL NIIP  V +++       ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL++P +  +EKIKTI   YM ASGLN     E+     HL  L  FA +M   +  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  IQV E     L ++ + F YRGTV VKGKG M T+L
Sbjct:  990 REFEVSYRLHYHGNVEADKHRIKIQTMRDQADWLLRNIIPIHVAEQL-------KVNQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRQPAFSNVEKIKTIGATYMAASGLNGQQCQEQPHPHAHLCALFDFALEMMRVVDDFN-KNMLG-FKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RIQVSEESHCVLSRMNYAFDYRGTVNVKGKGQMRTYL 1233          

HSP 3 Score: 77.411 bits (189), Expect = 7.518e-14
Identity = 68/223 (30.49%), Postives = 111/223 (49.78%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRTDHAISCV--EMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            N EA   R+K+Q+ ++ Q  W+   I+P  V E    ++  S      Y ++ +NV ++FA IV F+     S +   +   +LN+L   FDE  RQ   +N EKI T+G  Y   SG     C      HA  C   +  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    + VSE++  +L R  Y F+
Sbjct: 1003 NVEADKHRIKIQT-MRDQADWLLRNIIPIHVAEQL--KVNQS------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRQPAFSNVEKIKTIGATYMAASGLNGQQCQEQPHPHAHLCALFDFALEMMRVVDDFNKNMLGFKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRIQVSEESHCVLSRMNYAFD 1216          
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Match: CR339059.2 (pep chromosome:GRCz11:CHR_ALT_CTG3_1_31:9711779:9713274:-1 gene:ENSDARG00000116370.1 transcript:ENSDART00000164250.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR339059.2)

HSP 1 Score: 187.578 bits (475), Expect = 4.019e-52
Identity = 115/268 (42.91%), Postives = 162/268 (60.45%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE-----HLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFLAVRSHFVSPM 3210
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++       ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+K  +  +EKIKTI   YM ASGLN+   +  SD+     HL+ L  F+ +M   +  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  +QV E     L  + ++F YRGTV VKGKG M T+L  +S    P+
Sbjct:   21 REFEVSYRLHYHGNVEADQHRIKIQNMRDQADWLLRNIIPIHVAEQL-------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKSDFSNIEKIKTIGATYMAASGLNT---QQCSDQNHPHAHLRALFEFSLEMMRVVDDFN-KNMLG-FKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RVQVSEESYCVLSGMDYEFDYRGTVNVKGKGQMKTYLYPKSADSGPV 274          

HSP 2 Score: 71.633 bits (174), Expect = 1.087e-12
Identity = 62/215 (28.84%), Postives = 106/215 (49.30%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQT---NCEKIGTLGDCYYCVSG-----CPIPRTDHA--ISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLV 1377
            N EA   R+K+Q+ ++ Q  W+   I+P  V E            +  Y ++ +NV ++FA IV F+     S +   +   +LN+L   FDE  R++   N EKI T+G  Y   SG     C      HA   +  E  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++++G    V VSE+++ ++
Sbjct:   34 NVEADQHRIKIQN-MRDQADWLLRNIIPIHVAEQL--------KVTQSYSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKSDFSNIEKIKTIGATYMAASGLNTQQCSDQNHPHAHLRALFEFSLEMMRVVDDFNKNMLGFKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRVQVSEESYCVL 239          
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Match: CR339059.1 (pep chromosome:GRCz11:3:9737490:9738985:-1 gene:ENSDARG00000103847.2 transcript:ENSDART00000160102.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR339059.1)

HSP 1 Score: 187.578 bits (475), Expect = 4.019e-52
Identity = 115/268 (42.91%), Postives = 162/268 (60.45%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE-----HLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFLAVRSHFVSPM 3210
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++       ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+K  +  +EKIKTI   YM ASGLN+   +  SD+     HL+ L  F+ +M   +  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  +QV E     L  + ++F YRGTV VKGKG M T+L  +S    P+
Sbjct:   21 REFEVSYRLHYHGNVEADQHRIKIQNMRDQADWLLRNIIPIHVAEQL-------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKSDFSNIEKIKTIGATYMAASGLNT---QQCSDQNHPHAHLRALFEFSLEMMRVVDDFN-KNMLG-FKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RVQVSEESYCVLSGMDYEFDYRGTVNVKGKGQMKTYLYPKSADSGPV 274          

HSP 2 Score: 71.633 bits (174), Expect = 1.087e-12
Identity = 62/215 (28.84%), Postives = 106/215 (49.30%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQT---NCEKIGTLGDCYYCVSG-----CPIPRTDHA--ISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLV 1377
            N EA   R+K+Q+ ++ Q  W+   I+P  V E            +  Y ++ +NV ++FA IV F+     S +   +   +LN+L   FDE  R++   N EKI T+G  Y   SG     C      HA   +  E  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++++G    V VSE+++ ++
Sbjct:   34 NVEADQHRIKIQN-MRDQADWLLRNIIPIHVAEQL--------KVTQSYSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKSDFSNIEKIKTIGATYMAASGLNTQQCSDQNHPHAHLRALFEFSLEMMRVVDDFNKNMLGFKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRVQVSEESYCVL 239          
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Match: adcy9 (adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-050208-455])

HSP 1 Score: 188.734 bits (478), Expect = 1.258e-48
Identity = 115/255 (45.10%), Postives = 154/255 (60.39%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E + RL+++   EA+    +       A+ LL NIIP  V +++       ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL++P +  +EKIKTI   YM ASGLN     E+     HL  L  FA +M   +  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  IQV E     L ++ + F YRGTV VKGKG M T+L
Sbjct:  532 REFEVSYRLHYHGNVEADKHRIKIQTMRDQADWLLRNIIPIHVAEQL-------KVNQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRQPAFSNVEKIKTIGATYMAASGLNGQQCQEQPHPHAHLCALFDFALEMMRVVDDFN-KNMLG-FKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RIQVSEESHCVLSRMNYAFDYRGTVNVKGKGQMRTYL 775          

HSP 2 Score: 77.0258 bits (188), Expect = 8.537e-14
Identity = 68/223 (30.49%), Postives = 111/223 (49.78%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRTDHAISCV--EMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            N EA   R+K+Q+ ++ Q  W+   I+P  V E    ++  S      Y ++ +NV ++FA IV F+     S +   +   +LN+L   FDE  RQ   +N EKI T+G  Y   SG     C      HA  C   +  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    + VSE++  +L R  Y F+
Sbjct:  545 NVEADKHRIKIQT-MRDQADWLLRNIIPIHVAEQL--KVNQS------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRQPAFSNVEKIKTIGATYMAASGLNGQQCQEQPHPHAHLCALFDFALEMMRVVDDFNKNMLGFKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRIQVSEESHCVLSRMNYAFD 758          
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Match: adcy1a (adenylate cyclase 1a [Source:ZFIN;Acc:ZDB-GENE-070705-302])

HSP 1 Score: 186.808 bits (473), Expect = 1.089e-47
Identity = 97/249 (38.96%), Postives = 151/249 (60.64%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFL---NRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            +    +LL  + ++G+++R      ++ AFL+     + RL+++   + Q   + +++P +V    KE+FL    RI     F  +Y Q  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+ DHA  CVEMGL M   I    +  + D+NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VH+++ T   +   Y  E G
Sbjct:  207 LVANAVLLVGVNLSGVFVRVRTERAQRKAFLQARNCIQQRLQLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERI-----FHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKADHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANMMEAGGLPGKVHITKATLECLNGDYEVEPG 450          

HSP 2 Score: 149.828 bits (377), Expect = 4.343e-36
Identity = 95/255 (37.25%), Postives = 132/255 (51.76%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTF 3177
            R+ +  +RL++    +AE    +        + +L+N++P  V +  +     N  +  Y  +++  GV+FA I NF   Y   D    G   LRLL+ II  FD L+ K  Y  +EKIKTI   YM A GL        + +   HL  +  +A +M   L   N Q+      F L++G N GP+ AG+IG  +P YDIWG+TVNVASRM ST      IQV E V   L  Y+DF  RG V+VKGKG M T+
Sbjct:  796 RQLDLKLRLDYLWATQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLLSNPRNMDL--YYQSYSQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDALMDKECYRDIEKIKTIGSTYMAAVGLVPTEGSKVKKSISAHLCTVADYAIEMFDVLDAINYQSY---NDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQ-GKIQVTEDVFRLLSGYYDFNCRGQVSVKGKGQMLTY 1044          

HSP 3 Score: 78.9518 bits (193), Expect = 2.818e-14
Identity = 67/270 (24.81%), Postives = 126/270 (46.67%), Query Frame = 1
Query:  646 FRTKIFEEYYYITGQCILLFLMYMTG---LYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-NRIRNSDSFSLVYCQHFENVSILFADIVGFT----MMSSNKTAAKLVYLLNDLYNRFD---EQGRQTNCEKIGTLGDCYYCVSGCPIPR---------TDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNF 1395
            +R  +   +++  G   +L ++  +G   L+ R  + ++ +  +L   Q  E R  M+         +  ++P+ V ++FL +  RN D    +Y Q +  V +LFA I  F      +  N    + + LLN++   FD   ++    + EKI T+G  Y    G  +P          + H  +  +  + M  ++   N     D  +RVGI+ G V+A +IG  R ++D++   V +A+ ++S+G  G + V+ED F L+   Y+F
Sbjct:  764 YRKAVGGGFFHTHGYDPVLAMLLFSGALVLHCRQLD-LKLRLDYLWATQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLLSNPRNMD----LYYQSYSQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDALMDKECYRDIEKIKTIGSTYMAAVGL-VPTEGSKVKKSISAHLCTVADYAIEMFDVLDAINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEDVFRLLSGYYDF 1027          

HSP 4 Score: 52.373 bits (124), Expect = 4.124e-6
Identity = 49/209 (23.44%), Postives = 84/209 (40.19%), Query Frame = 1
Query: 2431 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGK-KQSNEIIFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRM 3048
             E+  R  F   R    +  +    N+  E LL +++P+ V  E+     +  E IF   Y     N  ++FA I  F S          +  ++LL+ +   FD L  +       +IK + DCY   SGL          +H    +    DM   +    E   +      +++G + G +  G++G  K  YD+W + V +A+ M
Sbjct:  228 TERAQRKAFLQARNCIQQRLQLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTS---LASQCTAQELVKLLNELFGKFDELATEN---HCRRIKILGDCYYCVSGLTQ-----PKADHAHCCVEMGLDMIDTITSVAEATEV---DLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANMM 422          
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Match: ADCY9 (adenylate cyclase 9 [Source:NCBI gene;Acc:100126441])

HSP 1 Score: 216.468 bits (550), Expect = 8.867e-57
Identity = 128/364 (35.16%), Postives = 197/364 (54.12%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFE-EYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS--------------------------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILE-----IMKEQVHGI 1443
            ++S+ V ++LL+YT+  +   +   L + Y ++F + G +FR +                  R F   +    ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ + +  +                             F     Q  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    +T CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM   I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E   ++E     +  +Q+ G+
Sbjct:  217 SFSICVEVLLLLYTVMHLPLYLSACLGVAYSILFETFGYHFRDE------------------RCFGPLVGRMAHWELLSKALLHICIHAIGVHLFIMSEVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDDESENSVKRHSASSPKSRKKKSSIQKTPIIFRPFKMQRIEQVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRPDHAYCCIEMGLGMIEAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEKTARYLDDRYLMEDSMVVERLGQIVAADQLKGL 560          

HSP 2 Score: 191.045 bits (484), Expect = 9.074e-49
Identity = 115/255 (45.10%), Postives = 154/255 (60.39%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD--EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++       ++  SY+    +AGVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN    + +S    HL+ L  FA +M   +  FN   +   F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQ  E     L K+ +DF YRGTV VKGKG M T+L
Sbjct:  979 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL-------KVSQSYSKNHDDAGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPHYSCIEKIKTIGATYMAASGLNPSQCQDSSQPHRHLQTLFEFAKEMMSVVDDFNNNMLW--FNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQASEESYRVLVKMGYDFDYRGTVNVKGKGQMKTYL 1222          

HSP 3 Score: 61.6178 bits (148), Expect = 8.141e-9
Identity = 59/216 (27.31%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  796 RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFT-MMSSNKTAAKLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-PIPRTD------HAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            R K+QS ++ Q  W+   I+P  V E    +++ S S+S    ++ ++  ++FA IV F+     N    K  Y +LN+L   FDE   +   +  EKI T+G  Y   SG  P    D      H  +  E    M  ++  FN +    +  +R+G + G + A +IG  +  +D++   V IA+ ++++G    +  SE+++ +LV+  Y+F+
Sbjct:  999 RTKIQS-MRDQADWLLRNIIPYHVAE----QLKVSQSYS----KNHDDAGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPHYSCIEKIKTIGATYMAASGLNPSQCQDSSQPHRHLQTLFEFAKEMMSVVDDFNNNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQASEESYRVLVKMGYDFD 1205          
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Match: ADCY1 (adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:100492373])

HSP 1 Score: 191.815 bits (486), Expect = 2.591e-49
Identity = 99/244 (40.57%), Postives = 151/244 (61.89%), Query Frame = 1
Query:  694 ILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFL---NRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            IL   + ++G+++R      ++ AFL+     E RL+++   + Q   + +++P +V    KE+FL    RI     F  +Y Q  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+TDHA  CVEMGL M   I    +  + D+NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VH++++T   +   Y  E G
Sbjct:   68 ILFVSVNLSGVFVRILTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERI-----FHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLECLNGDYEVEPG 306          

HSP 2 Score: 145.591 bits (366), Expect = 1.013e-34
Identity = 95/257 (36.96%), Postives = 134/257 (52.14%), Query Frame = 1
Query: 2422 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE---HLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTF 3177
            +R+ +  +RL++    +AE    +        + +L+N++P  V +  +     N  +  Y  +++  GV+FA I NF   Y   D    G   LRLL+ II  FD L++K  Y  +EKIKTI   YM A GL       A      HL  L  F+ +M     + +E N      F L++G N GP+ AG+IG  +P YDIWG+TVNVASRM ST      IQV E V   LK   ++F  RG V+VKGKG+M T+
Sbjct:  652 SRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDL--YYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLADFSIEM---FDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQ-GKIQVTEDVHRILKSCNYEFVCRGKVSVKGKGEMLTY 902          

HSP 3 Score: 74.3294 bits (181), Expect = 1.002e-12
Identity = 66/267 (24.72%), Postives = 123/267 (46.07%), Query Frame = 1
Query:  637 IRRFRTKIFEEYYYITG-QCILLFLMYMTGLYLRFFN-SIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-NRIRNSDSFSLVYCQHFENVSILFADIVGFT----MMSSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSGCPIPRT---------DHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVR 1380
            I  +R  +  +  Y+ G + IL  L++   L L      ++ +  +L   Q  E R  M+         +  ++P+ V ++FL +  RN D    +Y Q +  V ++FA I  F      +  N    + + LLN++   FDE   +    + EKI T+G  Y    G  +P T          H  +  +  + M  ++ + N     +  +RVGI+ G V+A +IG  R ++D++   V +A+ ++S+G  G + V+ED   +++
Sbjct:  618 ISGYRKTLGGDTSYMRGYEPILAILLFSCSLALHSRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMD----LYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGL-VPTTGTKAKKSIYSHLSTLADFSIEMFDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEDVHRILK 879          
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Match: ADCY1 (adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:100492373])

HSP 1 Score: 191.815 bits (486), Expect = 4.500e-49
Identity = 99/244 (40.57%), Postives = 151/244 (61.89%), Query Frame = 1
Query:  694 ILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFL---NRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            IL   + ++G+++R      ++ AFL+     E RL+++   + Q   + +++P +V    KE+FL    RI     F  +Y Q  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+TDHA  CVEMGL M   I    +  + D+NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VH++++T   +   Y  E G
Sbjct:  202 ILFVSVNLSGVFVRILTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERI-----FHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLECLNGDYEVEPG 440          

HSP 2 Score: 145.206 bits (365), Expect = 1.504e-34
Identity = 95/257 (36.96%), Postives = 134/257 (52.14%), Query Frame = 1
Query: 2422 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE---HLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTF 3177
            +R+ +  +RL++    +AE    +        + +L+N++P  V +  +     N  +  Y  +++  GV+FA I NF   Y   D    G   LRLL+ II  FD L++K  Y  +EKIKTI   YM A GL       A      HL  L  F+ +M     + +E N      F L++G N GP+ AG+IG  +P YDIWG+TVNVASRM ST      IQV E V   LK   ++F  RG V+VKGKG+M T+
Sbjct:  779 SRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDL--YYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLADFSIEM---FDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQ-GKIQVTEDVHRILKSCNYEFVCRGKVSVKGKGEMLTY 1029          

HSP 3 Score: 73.559 bits (179), Expect = 1.519e-12
Identity = 66/267 (24.72%), Postives = 123/267 (46.07%), Query Frame = 1
Query:  637 IRRFRTKIFEEYYYITG-QCILLFLMYMTGLYLRFFN-SIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-NRIRNSDSFSLVYCQHFENVSILFADIVGFT----MMSSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSGCPIPRT---------DHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVR 1380
            I  +R  +  +  Y+ G + IL  L++   L L      ++ +  +L   Q  E R  M+         +  ++P+ V ++FL +  RN D    +Y Q +  V ++FA I  F      +  N    + + LLN++   FDE   +    + EKI T+G  Y    G  +P T          H  +  +  + M  ++ + N     +  +RVGI+ G V+A +IG  R ++D++   V +A+ ++S+G  G + V+ED   +++
Sbjct:  745 ISGYRKTLGGDTSYMRGYEPILAILLFSCSLALHSRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMD----LYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGL-VPTTGTKAKKSIYSHLSTLADFSIEMFDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEDVHRILK 1006          
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Match: ADCY1 (adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:100492373])

HSP 1 Score: 191.815 bits (486), Expect = 4.569e-49
Identity = 99/244 (40.57%), Postives = 151/244 (61.89%), Query Frame = 1
Query:  694 ILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFL---NRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            IL   + ++G+++R      ++ AFL+     E RL+++   + Q   + +++P +V    KE+FL    RI     F  +Y Q  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+TDHA  CVEMGL M   I    +  + D+NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VH++++T   +   Y  E G
Sbjct:  205 ILFVSVNLSGVFVRILTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERI-----FHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLECLNGDYEVEPG 443          

HSP 2 Score: 145.206 bits (365), Expect = 1.433e-34
Identity = 95/257 (36.96%), Postives = 134/257 (52.14%), Query Frame = 1
Query: 2422 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE---HLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTF 3177
            +R+ +  +RL++    +AE    +        + +L+N++P  V +  +     N  +  Y  +++  GV+FA I NF   Y   D    G   LRLL+ II  FD L++K  Y  +EKIKTI   YM A GL       A      HL  L  F+ +M     + +E N      F L++G N GP+ AG+IG  +P YDIWG+TVNVASRM ST      IQV E V   LK   ++F  RG V+VKGKG+M T+
Sbjct:  789 SRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDL--YYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLADFSIEM---FDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQ-GKIQVTEDVHRILKSCNYEFVCRGKVSVKGKGEMLTY 1039          

HSP 3 Score: 73.559 bits (179), Expect = 1.524e-12
Identity = 66/267 (24.72%), Postives = 123/267 (46.07%), Query Frame = 1
Query:  637 IRRFRTKIFEEYYYITG-QCILLFLMYMTGLYLRFFN-SIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-NRIRNSDSFSLVYCQHFENVSILFADIVGFT----MMSSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSGCPIPRT---------DHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVR 1380
            I  +R  +  +  Y+ G + IL  L++   L L      ++ +  +L   Q  E R  M+         +  ++P+ V ++FL +  RN D    +Y Q +  V ++FA I  F      +  N    + + LLN++   FDE   +    + EKI T+G  Y    G  +P T          H  +  +  + M  ++ + N     +  +RVGI+ G V+A +IG  R ++D++   V +A+ ++S+G  G + V+ED   +++
Sbjct:  755 ISGYRKTLGGDTSYMRGYEPILAILLFSCSLALHSRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMD----LYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGL-VPTTGTKAKKSIYSHLSTLADFSIEMFDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEDVHRILK 1016          
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Match: crabp2 (cellular retinoic acid binding protein 2 [Source:Xenbase;Acc:XB-GENE-959098])

HSP 1 Score: 189.504 bits (480), Expect = 1.188e-48
Identity = 104/283 (36.75%), Postives = 157/283 (55.48%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAG------------FVHVS---EDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTS 1464
            I  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +N + N +       F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K D++MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G             +HV    E+    + H  +   GD L   +E +   S M K S
Sbjct:  291 IVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHKIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRYVRSRTKHDIDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGNSINLLPNHLAQALHVQSGPEEINKRIEHTIDLRSGDKLR--REHIKPFSLMFKDS 571          

HSP 2 Score: 94.7449 bits (234), Expect = 5.311e-19
Identity = 61/165 (36.97%), Postives = 89/165 (53.94%), Query Frame = 1
Query: 2740 LLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLY-FDFKYRGTVAVKG----KGDMTTFLAVRSHFVSPMFL 3216
            LL +  +  +EKIKTI   YM  SGL+ + ++      HL  +  F+  ++  ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE     LK   F F+YRG + VKG    +G + T+  +     +P+ L
Sbjct:  732 LLGEERFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCAVADFSIALNESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEDTYLILKERGFAFEYRGEIYVKGISEQEGKIKTYFLLGRVQPNPLIL 892          

HSP 3 Score: 73.9442 bits (180), Expect = 1.157e-12
Identity = 68/271 (25.09%), Postives = 123/271 (45.39%), Query Frame = 1
Query:  913 VYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTD------HAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR-YNFE-KGDILEIMKEQVHGIS---GMIKT-----SVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNE---KHNFKRRDRKYKGDLKIV 1668
             Y Q  E +  ++  ++      SN    ++  L  +   RF +       EKI T+G  Y  VSG    +        H  +  +  + +   I + NK    +  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + V EDT+L+++ R + FE +G+I       V GIS   G IKT      V  N   + PR++  +         L     + S+    Q+ +LN+++N    K ++ RR     G  ++V
Sbjct:  700 AYLQELEILKDIWNSLIANMAAKSNSPLGEIKLLGEE---RFQD------IEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCAVADFSIALNESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEDTYLILKERGFAFEYRGEIY------VKGISEQEGKIKTYFLLGRVQPNPLILQPRKLTGQYSLAAVVLGL-----VQSLNRQKQKQILNENNNSGIMKGHYNRRTLLTSGGSEVV 950          

HSP 4 Score: 57.3806 bits (137), Expect = 1.511e-7
Identity = 55/240 (22.92%), Postives = 105/240 (43.75%), Query Frame = 1
Query: 2431 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVG----------KKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQ-VPEHVANKL 3108
            +++  R  F  TR            N+  E L+ +++P+ V  E++           + Q ++I   Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL     DH     +  L ++ T  +     +R   + +I       ++IG + G +  G++G  K  +D+W   V++A+++ S     +SI  +P H+A  L
Sbjct:  312 SDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHKI---YIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRY-----VRSRTKHDI------DMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGNSINLLPNHLAQAL 531          
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Match: Adcy9 (adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108450])

HSP 1 Score: 228.409 bits (581), Expect = 1.386e-60
Identity = 129/355 (36.34%), Postives = 200/355 (56.34%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFL--------------------NRIRNSD------SFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQV 1434
            ++S+ + ++LL+YT+ ++   + + L ++Y ++F + G +FR +         +                  ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +                    NR + S       +F     Q  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    QT CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G ++E + + V
Sbjct:  223 SFSICIEVLLLLYTVMQLPLYLSLFLGVVYSVLFETFGYHFRNEDCYPSPGPGAL-----------------HWELLSRALLHVCIHAIGIHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSV 558          

HSP 2 Score: 194.897 bits (494), Expect = 4.408e-50
Identity = 116/255 (45.49%), Postives = 156/255 (61.18%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++       ++  +Y+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+    E     EHL+IL  FA +M   +  FN  N +  F F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGTV VKGKG M T+L
Sbjct:  998 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL-------KVSQTYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1241          

HSP 3 Score: 62.3882 bits (150), Expect = 3.385e-9
Identity = 58/216 (26.85%), Postives = 102/216 (47.22%), Query Frame = 1
Query:  796 RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM-SSNKTAAKLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPR-------TDHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            R K+QS ++ Q  W+   I+P  V E            S  Y ++ ++  ++FA IV F+     N    K  Y +LN+L   FDE   +    + EKI T+G  Y   SG    +        +H     E    M R++  FN +    +  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + VSE+++ +L +  Y+F+
Sbjct: 1018 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 1224          
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Match: Adcy9 (adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108450])

HSP 1 Score: 228.409 bits (581), Expect = 1.386e-60
Identity = 129/355 (36.34%), Postives = 200/355 (56.34%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFL--------------------NRIRNSD------SFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQV 1434
            ++S+ + ++LL+YT+ ++   + + L ++Y ++F + G +FR +         +                  ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +                    NR + S       +F     Q  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    QT CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G ++E + + V
Sbjct:  223 SFSICIEVLLLLYTVMQLPLYLSLFLGVVYSVLFETFGYHFRNEDCYPSPGPGAL-----------------HWELLSRALLHVCIHAIGIHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSV 558          

HSP 2 Score: 194.897 bits (494), Expect = 4.408e-50
Identity = 116/255 (45.49%), Postives = 156/255 (61.18%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++       ++  +Y+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+    E     EHL+IL  FA +M   +  FN  N +  F F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGTV VKGKG M T+L
Sbjct:  998 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL-------KVSQTYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1241          

HSP 3 Score: 62.3882 bits (150), Expect = 3.385e-9
Identity = 58/216 (26.85%), Postives = 102/216 (47.22%), Query Frame = 1
Query:  796 RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM-SSNKTAAKLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPR-------TDHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            R K+QS ++ Q  W+   I+P  V E            S  Y ++ ++  ++FA IV F+     N    K  Y +LN+L   FDE   +    + EKI T+G  Y   SG    +        +H     E    M R++  FN +    +  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + VSE+++ +L +  Y+F+
Sbjct: 1018 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 1224          
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Match: Adcy9 (adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108450])

HSP 1 Score: 221.476 bits (563), Expect = 1.018e-58
Identity = 118/283 (41.70%), Postives = 169/283 (59.72%), Query Frame = 1
Query:  670 YYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFL--------------------NRIRNSD------SFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQV 1434
            ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +                    NR + S       +F     Q  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    QT CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G ++E + + V
Sbjct:   41 HWELLSRALLHVCIHAIGIHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSV 321          

HSP 2 Score: 195.282 bits (495), Expect = 2.703e-50
Identity = 115/255 (45.10%), Postives = 155/255 (60.78%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++       ++  +Y+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+    E     EHL+IL  FA +M   +  FN   +   F F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGTV VKGKG M T+L
Sbjct:  761 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL-------KVSQTYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLW--FNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1004          

HSP 3 Score: 62.3882 bits (150), Expect = 3.476e-9
Identity = 58/216 (26.85%), Postives = 102/216 (47.22%), Query Frame = 1
Query:  796 RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM-SSNKTAAKLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPR-------TDHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            R K+QS ++ Q  W+   I+P  V E            S  Y ++ ++  ++FA IV F+     N    K  Y +LN+L   FDE   +    + EKI T+G  Y   SG    +        +H     E    M R++  FN +    +  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + VSE+++ +L +  Y+F+
Sbjct:  781 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 987          
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Match: Adcy8 (adenylate cyclase 8 [Source:MGI Symbol;Acc:MGI:1341110])

HSP 1 Score: 200.675 bits (509), Expect = 5.974e-52
Identity = 99/248 (39.92%), Postives = 151/248 (60.89%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            +  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +N + N +       F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K DV+MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +H+S+ T   +   YN E+G
Sbjct:  319 VLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 566          

HSP 2 Score: 135.576 bits (340), Expect = 1.370e-31
Identity = 90/248 (36.29%), Postives = 129/248 (52.02%), Query Frame = 1
Query: 2422 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKG 3156
             ++ E   RL+F    +A+    E     +  E++L NI+P  V +  + K + NE +  Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  F+  +   ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE     LK   F F YRG + VKG
Sbjct:  884 GQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEETYLILKDQGFAFDYRGEIYVKG 1125          

HSP 3 Score: 100.908 bits (250), Expect = 6.008e-21
Identity = 80/289 (27.68%), Postives = 143/289 (49.48%), Query Frame = 1
Query:  847 IMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTD------HAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR-YNFE-KGDILEIMKEQVHGIS---GMIKT-----SVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNE---KHNFKRR 1635
            I+PS V  +FL + R+++    +Y Q ++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG    +        H  +  +  L +   I + NK    +  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + V E+T+L+++ + + F+ +G+I       V GIS   G IKT      V  N + + PR++  +         L     + S+    Q+ LLN++ N    K ++ RR
Sbjct:  922 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIY------VKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGL-----VQSLNRQRQKQLLNENSNSGIIKSHYNRR 1196          

HSP 4 Score: 51.2174 bits (121), Expect = 9.084e-6
Identity = 49/223 (21.97%), Postives = 95/223 (42.60%), Query Frame = 1
Query: 2431 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVG----------KKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3060
            +++  R  F  TR            N+  E L+ +++P+ V  E++           + Q + I   Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL     DH     +  L ++ T  F     +R   + ++       ++IG + G +  G++G  K  +D+W   V++A+++ S  
Sbjct:  340 SDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRI---YIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRF-----VRSRTKHDV------DMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGG 542          
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Match: Adcy8 (adenylate cyclase 8 [Source:MGI Symbol;Acc:MGI:1341110])

HSP 1 Score: 200.675 bits (509), Expect = 6.071e-52
Identity = 99/248 (39.92%), Postives = 151/248 (60.89%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            +  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +N + N +       F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K DV+MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +H+S+ T   +   YN E+G
Sbjct:  319 VLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 566          

HSP 2 Score: 135.191 bits (339), Expect = 1.513e-31
Identity = 90/248 (36.29%), Postives = 129/248 (52.02%), Query Frame = 1
Query: 2422 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKG 3156
             ++ E   RL+F    +A+    E     +  E++L NI+P  V +  + K + NE +  Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  F+  +   ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE     LK   F F YRG + VKG
Sbjct:  914 GQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEETYLILKDQGFAFDYRGEIYVKG 1155          

HSP 3 Score: 100.908 bits (250), Expect = 6.245e-21
Identity = 80/289 (27.68%), Postives = 143/289 (49.48%), Query Frame = 1
Query:  847 IMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTD------HAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR-YNFE-KGDILEIMKEQVHGIS---GMIKT-----SVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNE---KHNFKRR 1635
            I+PS V  +FL + R+++    +Y Q ++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG    +        H  +  +  L +   I + NK    +  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + V E+T+L+++ + + F+ +G+I       V GIS   G IKT      V  N + + PR++  +         L     + S+    Q+ LLN++ N    K ++ RR
Sbjct:  952 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIY------VKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGL-----VQSLNRQRQKQLLNENSNSGIIKSHYNRR 1226          

HSP 4 Score: 51.2174 bits (121), Expect = 8.897e-6
Identity = 49/223 (21.97%), Postives = 95/223 (42.60%), Query Frame = 1
Query: 2431 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVG----------KKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3060
            +++  R  F  TR            N+  E L+ +++P+ V  E++           + Q + I   Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL     DH     +  L ++ T  F     +R   + ++       ++IG + G +  G++G  K  +D+W   V++A+++ S  
Sbjct:  340 SDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRI---YIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRF-----VRSRTKHDV------DMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGG 542          
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Match: sp|P51830|ADCY9_MOUSE (Adenylate cyclase type 9 OS=Mus musculus OX=10090 GN=Adcy9 PE=1 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 9.693e-60
Identity = 129/355 (36.34%), Postives = 200/355 (56.34%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFL--------------------NRIRNSD------SFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQV 1434
            ++S+ + ++LL+YT+ ++   + + L ++Y ++F + G +FR +         +                  ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +                    NR + S       +F     Q  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    QT CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G ++E + + V
Sbjct:  223 SFSICIEVLLLLYTVMQLPLYLSLFLGVVYSVLFETFGYHFRNEDCYPSPGPGAL-----------------HWELLSRALLHVCIHAIGIHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSV 558          

HSP 2 Score: 194.897 bits (494), Expect = 3.083e-49
Identity = 116/255 (45.49%), Postives = 156/255 (61.18%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++       ++  +Y+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+    E     EHL+IL  FA +M   +  FN  N +  F F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGTV VKGKG M T+L
Sbjct:  998 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL-------KVSQTYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1241          

HSP 3 Score: 62.3882 bits (150), Expect = 2.368e-8
Identity = 58/216 (26.85%), Postives = 102/216 (47.22%), Query Frame = 1
Query:  796 RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM-SSNKTAAKLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPR-------TDHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            R K+QS ++ Q  W+   I+P  V E            S  Y ++ ++  ++FA IV F+     N    K  Y +LN+L   FDE   +    + EKI T+G  Y   SG    +        +H     E    M R++  FN +    +  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + VSE+++ +L +  Y+F+
Sbjct: 1018 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 1224          
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Match: sp|O60503|ADCY9_HUMAN (Adenylate cyclase type 9 OS=Homo sapiens OX=9606 GN=ADCY9 PE=1 SV=4)

HSP 1 Score: 224.942 bits (572), Expect = 1.080e-58
Identity = 128/355 (36.06%), Postives = 198/355 (55.77%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFL--------------------NRIRNSD------SFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQV 1434
            ++S+ + ++ L+YT+  +   + + L + Y ++F + G +FR    ++          L             ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +                    NR + S       +F     Q  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    +T CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G ++E + + V
Sbjct:  223 SFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFR----DEACFPSPGAGAL-------------HWELLSRGLLHGCIHAIGVHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGKVIERLGQSV 558          

HSP 2 Score: 196.438 bits (498), Expect = 1.115e-49
Identity = 116/255 (45.49%), Postives = 157/255 (61.57%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMAS--DEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++       ++  +Y+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+   +  S   EHL+IL  FA +M   +  FN  N +  F F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGTV VKGKG M T+L
Sbjct:  998 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL-------KVSQTYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1241          

HSP 3 Score: 63.5438 bits (153), Expect = 1.015e-8
Identity = 58/216 (26.85%), Postives = 103/216 (47.69%), Query Frame = 1
Query:  796 RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM-SSNKTAAKLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRT-------DHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            R K+QS ++ Q  W+   I+P  V E            S  Y ++ ++  ++FA IV F+     N    K  Y +LN+L   FDE   +   ++ EKI T+G  Y   SG    +        +H     E    M R++  FN +    +  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + VSE+++ +L +  Y+F+
Sbjct: 1018 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 1224          
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Match: sp|Q9DGG6|ADCY9_CHICK (Adenylate cyclase type 9 OS=Gallus gallus OX=9031 GN=ADCY9 PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 5.462e-58
Identity = 131/348 (37.64%), Postives = 190/348 (54.60%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLNR---------IRNSDS-----------------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILE 1416
            ++S+ V ++LL+YT+  +   + + L L Y ++F     FR +      L    V                Y+ +  +  L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ + +          R+S S                 F     Q  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G + E
Sbjct:  215 SFSMCVEVLLLLYTVMHLPLYLSLFLGLSYSVLF-ETSAFRDESCTL--LGGGAV----------------YWELLSKAFLHVCIHAIGIHLFIMSEVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDDESENSVKRHSTSSPKNRKKKPSIQKTPIIFRPFKMQQIEQVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEDTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGKVTE 541          

HSP 2 Score: 185.267 bits (469), Expect = 3.463e-46
Identity = 112/255 (43.92%), Postives = 152/255 (59.61%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEH--LKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            R  E + RL+++   EA++   +        +S + NIIP  V  E+       ++  SY+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+   + ++  H  L+ L  FA +M   +  FN  N +  F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +    C  IQV E     L K+ +DF YRGTV VKGKG M T+L
Sbjct:  980 RSFEVSYRLHYHGDVEADLHRTKIQSMRDQPDSCVRNIIPYHVADEL-------KVSQSYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPHYSSIEKIKTIGATYMAASGLNTSQCQDSNHPHGHLQTLFEFAKEMMRVVDDFN--NNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTIGVEC-RIQVSEETYRILSKMGYDFDYRGTVNVKGKGQMKTYL 1223          

HSP 3 Score: 60.077 bits (144), Expect = 1.458e-7
Identity = 55/215 (25.58%), Postives = 98/215 (45.58%), Query Frame = 1
Query:  796 RLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM-SSNKTAAKLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTD-------HAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            R K+QS        +  I+P  V +            S  Y ++ ++  ++FA IV F+     N    K  Y +LN+L   FDE   +   ++ EKI T+G  Y   SG    +         H  +  E    M R++  FN +    +  +R+G + G + A +IG  +  +D++   V IA+ +++ G    + VSE+T+ +L +  Y+F+
Sbjct: 1000 RTKIQSMRDQPDSCVRNIIPYHVADEL--------KVSQSYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPHYSSIEKIKTIGATYMAASGLNTSQCQDSNHPHGHLQTLFEFAKEMMRVVDDFNNNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTIGVECRIQVSEETYRILSKMGYDFD 1206          
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Match: sp|P98999|ADCY9_XENLA (Adenylate cyclase type 9 OS=Xenopus laevis OX=8355 GN=adcy9 PE=1 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 3.766e-56
Identity = 131/376 (34.84%), Postives = 202/376 (53.72%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS--------------------------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILE-----IMKEQVHGISGMI----KTSVP 1470
            ++S+ V ++LL+YT+  +   +   L + Y ++F + G +FR      +   V  V  +             ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ + +  +                             F     Q  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    +T CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM   I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E   ++E     +  +Q+ G+   +    +T VP
Sbjct:  217 SFSICVEVLLLLYTVMHLPLYLSACLGVAYSILFETFGYHFR-----DESCFVLLVGRMA------------HWELLSKALLHVCIHAIGVHLFIMSEVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDDESENSVKRHSASSPKSRKKKSSIQKTPIIFRPFKMQRIEQVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRPDHAYCCIEMGLGMIEAIDQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEKTARYLDDRYLMEDSMVVERLGQIVAADQLKGLKTFLISGGRTRVP 573          

HSP 2 Score: 193.741 bits (491), Expect = 7.647e-49
Identity = 174/538 (32.34%), Postives = 264/538 (49.07%), Query Frame = 1
Query: 1642 KYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQI---EPIQIYSIKXXXXXXXXXXXXXXXVILLAAYVMLPKSFGFRFYSPXXXXXXXXXXXXXXXXXXXXKSE----------IPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYXXXXXXXXXXXXXX--NVISTSLSSLVKHITTGSYTAIAI--CLCFYAP-----TKRELNLYSFDNCSIYLTEPKN-MFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD--EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTF 3177
            + K D   V+ ++ED      FF+ PPIN ++L F D ++E  Y     +++    P++ ++      L  +   ++  V+L  A ++ P   G    SP         +  +     +  S           +  R+L +    W   + R  +G  +  LP+ ++ S Y  +   T  HY     S  L  ++   N    S S+L+    TG+   I I   LC   P     T  E NL + ++    L  P+  +   R+    +     + LL+++L RE + + RL+++   EA++   +       A+ LL NIIP  V +++       ++  SY+    +AGVIFA I NF S +Y E+Y+GG+   R L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN    + +S    HL+ L  FA +M   +  FN   +   F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQ  E     L K+ +DF YRGTV VKGKG M T+
Sbjct:  713 REKTDAHFVEVIKEDSLMKDYFFK-PPINPLSLNFLDKELETSYRASYQEEVIRMAPVKTFASATFSSLQDVLLNYFIFVLLSVACLLKP---GTNTVSPPTLALVLLSVCGLLGFLSLLVSVRMAFYLEDMLLCTRRLLEIISGW---VPRHFIGTVLVCLPAAVIFS-YLSSDFYTDIHYTMFLCSALLIPMVQYCNFCQLSSSALLLATITGATMLILIYLPLCPQRPPLDPGTDIEANLSTSNSSYETLDNPRTELPFTRLGQEIAVAYFLLLLLVWFLNREFDVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL-------KVSQSYSKNHDDAGVIFASIVNF-SEFYEENYEGGKECYRALNELIGDFDELLSKPHYSCIEKIKTIGATYMAASGLNPSQCQDSSQPHRHLQTLFEFAKEMMSVVDEFNNNMLW--FNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQASEESYRVLVKMGYDFDYRGTVNVKGKGQMKTY 1231          

HSP 3 Score: 61.6178 bits (148), Expect = 3.903e-8
Identity = 93/368 (25.27%), Postives = 172/368 (46.74%), Query Frame = 1
Query:  388 AMVIICMTYTVLLGTDSSEL-MELNYSL----VVLIILLMYTLFRMKFMVVMLLSL-----LYILIFVSIGNFR--IKYVEQKELNVSTV-SDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM-SSNKTAAKLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-PIPRTD------HAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
              V++C+   V+    SS+   +++Y++     +LI ++ Y  F       +LL+      + ILI++ +   R  +      E N+ST  S  E++   RT++    +   GQ I +   ++  L + F N     S  L    + EA   R K+QS ++ Q  W+   I+P  V E    +++ S S+S    ++ ++  ++FA IV F+     N    K  Y  LN+L   FDE   +   +  EKI T+G  Y   SG  P    D      H  +  E    M  ++ +FN +    +  +R+G + G + A +IG  +  +D++   V IA+ ++++G    +  SE+++ +LV+  Y+F+
Sbjct:  861 GTVLVCLPAAVIFSYLSSDFYTDIHYTMFLCSALLIPMVQYCNFCQLSSSALLLATITGATMLILIYLPLCPQRPPLDPGTDIEANLSTSNSSYETLDNPRTEL---PFTRLGQEIAV-AYFLLLLLVWFLNREFDVSYRLHYHGDVEADLHRTKIQS-MRDQADWLLRNIIPYHVAE----QLKVSQSYS----KNHDDAGVIFASIVNFSEFYEENYEGGKECYRALNELIGDFDELLSKPHYSCIEKIKTIGATYMAASGLNPSQCQDSSQPHRHLQTLFEFAKEMMSVVDEFNNNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQASEESYRVLVKMGYDFD 1215          
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Match: sp|P40145|ADCY8_HUMAN (Adenylate cyclase type 8 OS=Homo sapiens OX=9606 GN=ADCY8 PE=1 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.243e-51
Identity = 99/248 (39.92%), Postives = 151/248 (60.89%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            +  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +N + N +       F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K DV+MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +H+S+ T   +   YN E+G
Sbjct:  321 VVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 568          

HSP 2 Score: 135.576 bits (340), Expect = 9.484e-31
Identity = 90/248 (36.29%), Postives = 129/248 (52.02%), Query Frame = 1
Query: 2422 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKG 3156
             ++ E   RL+F    +A+    E     +  E++L NI+P  V +  + K + NE +  Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  F+  +   ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE     LK   F F YRG + VKG
Sbjct:  916 GQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEETYLILKDQGFAFDYRGEIYVKG 1157          

HSP 3 Score: 101.293 bits (251), Expect = 3.445e-20
Identity = 80/289 (27.68%), Postives = 144/289 (49.83%), Query Frame = 1
Query:  847 IMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTD------HAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR-YNFE-KGDILEIMKEQVHGIS---GMIKT-----SVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNE---KHNFKRR 1635
            I+PS V  +FL + R+++    +Y Q ++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG    +        H  +  +  L +   I + NK    +  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + V E+T+L+++ + + F+ +G+I       V GIS   G IKT      V  N + + PR++  +         L     + S+    Q+ LLN+++N    K ++ RR
Sbjct:  954 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIY------VKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGL-----VQSLNRQRQKQLLNENNNTGIIKGHYNRR 1228          
BLAST of Adenylate cyclase type vs. TrEMBL
Match: A0A5J4NRP7 (Adenylate cyclase 9 OS=Paragonimus westermani OX=34504 GN=DEA37_0009241 PE=4 SV=1)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 369/972 (37.96%), Postives = 558/972 (57.41%), Query Frame = 1
Query:  460 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVS-TVSDLESIRRF----RTKIFEEYYYITG-QCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLN-RIRNSDSFS--LVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPR-QIXXXXXXXXXXXQLNMANKL--YSVPH-----------SVQQILLNQDDNEKHNFKRRD-----------------RKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKXXXXXXXXXXXXXXXVILLAAYVML----PKSFGFRFYSPXXXXXXXXXXXXXXXXXXXXKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVIS-----------LYNKNILATSYHYXXXXXXXXXXXXXXNVISTSLSSLVKHITTGSYTAIAIC---LC-FYAPTKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQ---SNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLA 3183
            YS  +++++ ++ L  ++  + + +S++++   V+IG   + +   K++ +  +  ++++ RR     RT        I   Q +    + +T LY+RF+N +RR   F KL ++ +AR + +SA+K Q+ WIEAIMPS ++  +   R +N D  S   V+ + ++NVSILFADIVGFT MSSNKTA ++V +LN+L+NRFDE  + T CEKIGTLGDCYYCVSGCPI + +HA+ CVEMGLGMCR+I  FN+D  E V MR+G+H+GRV AAIIG+ RFRFDV+SYDVIIA++LES+G+AG VH+SE+TF LV++ YN  +G+ L+I KEQV GI+GM   +  +++YFV PR  + + KH+   + Q  + +++  +S  H           S  ++ +  +   + +   R+                   ++ D++++  LQ D E+    FQ+ P++  TLAF+DP+ E+ Y     D  + I + S K++  +D    L    +  L  +++       S  +   S +          +++F +  Y   I N + R  +    HPL   L    ++ +PS+++ S           L  + IL+    +      + L +     IS ++ SL+    +G+      C   LC    PT+      SF             ++LR++ I         +L+  + RENE+N RL FY +REAEI   ++  A   A+ +LYNIIPK V   +  +     S +  F+YA +  NAGV FA ISNFFS+YYREDYKGGE AL+LL++I+C FD+ L +P    +EKIKTINDCYM+A+GLN D      ++  HL  LM +   +   L  FN+  IIG   F +K+GYN GP+ AGIIG +KP+YDIWG+TVNVASRMYST      IQVP+ VA++L+ +F F YRG + VKGKGDM T+L 
Sbjct:  157 YSPDIVLVIGIFALLPLRTTICVCISVMHLT--VTIG-LEVYHSSVKDIPLKHSWLNIDAFRRLQHSNRTHALSRPLKIVAIQTLAWLPILLTALYVRFWNIVRRCFTFFKLGKSVQARNECKSALKGQVRWIEAIMPSVIRIEYQALRQKNIDVSSSMWVFNRTYDNVSILFADIVGFTRMSSNKTAHRVVTMLNNLFNRFDELCQTTKCEKIGTLGDCYYCVSGCPIAQPNHAVCCVEMGLGMCRIIKAFNRDFDESVGMRIGVHTGRVNAAIIGSQRFRFDVYSYDVIIASALESTGRAGRVHISENTFELVKNIYNCSRGEPLQIRKEQVRGIAGMELVNTYISSYFVDPRSSLWRTKHERYGQAQTELYSEMDQHSPAHRRSMSFSENETSSTEVSMGDEQVNRSSLNTREIPWRLTRNEPETLTGVIHSFERDMQLIDSLQTDSEKQCTLFQDLPLSPTTLAFRDPESEWHYYSQVRDPTKKIYMDSRKVSPLVDVSVCLAVLLISFLNCFLLASYHESVSTEYVIMSVVAVTIDVIICGLVSFAATNYDHHIGNARKRVLHRILIHPLINELCMAIITIMPSLMLSSFLKYTMNEELLLAKRQILSIVAFHCVLIHVLPLSSFFWARISCAIISLLIITLSGNCVTRLRCPNPLCSSLVPTRHGFTYVSF------------CYVLRVELIACL------VLVGLVTRENERNCRLCFYVSREAEICGDQSEQAVNEAQEMLYNIIPKYVMDHLKLRTHDDVSGQKSFNYAVSIPNAGVAFATISNFFSNYYREDYKGGENALKLLNSIVCIFDSFLGRPDMKDVEKIKTINDCYMVAAGLNRDEVTRNRSNILHLVALMNYCHMIIEALNEFNDMYIIGTDKFEIKVGYNAGPLIAGIIGNTKPMYDIWGNTVNVASRMYSTG-IVGKIQVPQDVADELQGHFRFVYRGEIFVKGKGDMKTYLC 1106          
BLAST of Adenylate cyclase type vs. TrEMBL
Match: A0A183B296 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS13331 PE=4 SV=1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 373/904 (41.26%), Postives = 530/904 (58.63%), Query Frame = 1
Query:  598 KELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLN-RIRNSDSFS--LVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQ--IXXXXXXXXXXXQLNMAN-KLYSVP----------------------HSVQQILLNQDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKXXXXXXXXXXXXXXXV---ILLAAYVMLPKSFG-FRFYSPXXXXXXXXXXXXXXXXXXXXKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATS--YHYXXXXXXXXXXXXXXNVISTSLSSLVKHITTGSYTAIAICLC-FYAPTKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIV--GKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVR 3189
            +  NV + SD + +  F          I G  IL FL ++ G+Y+  +N IRR+  F +L++N   R   Q+A+  ++ WIEAIMP+ V  +F   + RN ++     VY + F+ VSILFADIVGFT MSSNK+A +LV LLNDL++RFDE  + T CEKIGTLGDCYYCVSGCP PR DHA  CVEMGLGMCR+I  FN DH+E VNMRVG+H+GRV AAIIG  RFR+DV+SYDVI+AN +ESSG+ G VH+SE T+ LV+  YN   G+ + I +E+  GI+G+  T+  M TYFV PR   ++++  + +   QL   +  L S P                       S  Q+ L    +     +R   + + D+++++ LQ D ER +  F++PP+N + L F   + E+ Y  HT     P  I S+K+A+  DSLA      V   I + A+ + P   G +  Y   +       + ++ F S +Y  +  + +L++ Y   +H   R +L   +S+ P+I  + ++ + I+       Y   F ++    ++ + +  S ++  + I        ++C+   Y PT+ ++   ++ +  ++    +    LR   +  F  L    L+  +ARE+E+N RL FY TRE+EI +  +    + A+ LL+NIIPK V+ E+   G++  +   FSYA    NAGV+FAC++NFFS+YYREDYKGGE AL LL++I+CTFD LL +P    +EKIKTINDCYM A+GLNS          EHL +LM +   +   L  FN   IIG   F +KIGYNFGP+TAGIIGT+KPLYDIWGDTVNVASRMYST  P    IQV EHV   L  +F F++RG V VKGKGDM T++  R
Sbjct:  223 RRYNVLSESDFKPVAEF----------IAGA-ILQFLGFLLGIYVDCWNGIRRQIVFYRLSKNVRIRNAAQAALVDKVRWIEAIMPAQVTADFYQIQKRNEEAGKTMWVYNRVFDPVSILFADIVGFTKMSSNKSAIQLVTLLNDLFSRFDELCQLTRCEKIGTLGDCYYCVSGCPEPRVDHAQCCVEMGLGMCRIIKVFNCDHQETVNMRVGVHTGRVNAAIIGAQRFRYDVYSYDVIVANLMESSGQPGRVHISESTYNLVKSVYNVAPGEDMLIKREERSGIAGLALTTKTMKTYFVDPRSSILRRRHERFRAHVQLRAVDTDLLSEPVQIVADTKRETISARRTPSYARFSRGQMSLTGAQHTSIFCQREMARLEQDIELIQNLQTDSERQINLFRSPPLNPLMLNFLHHETEWHYRTHTVHHKVPTYIESLKVAILSDSLALTSVHIVITCICVLAHKLTPDWNGIYAMYYLAVLMFALVLLCLLLFSSTMYADQCQSPQLKQIYLCVAHNYGREVLIALLSTAPTISFL-IFRQAIVTEHCISDYIGLFENLCWLCVLIHGLPQSSATWCRLICC---VTCSVCIHKSYRPTRAQVRFCAWADDFVFGLSVRG---LRHMHVLDF--LFCIALVSIIARESERNCRLCFYVTRESEIASDLSDITVQEAQQLLFNIIPKYVYDELQTNGRENFSGSAFSYATLVPNAGVMFACVANFFSNYYREDYKGGEGALILLNSIMCTFDELLNRPEMKDVEKIKTINDCYMAAAGLNSAAVGRNPNKREHLILLMEYCHLVKEALDQFNALYIIGTDNFTVKIGYNFGPVTAGIIGTTKPLYDIWGDTVNVASRMYSTGLP--GEIQVAEHVVPVLSDFFLFEFRGNVFVKGKGDMRTYVCRR 1104          
BLAST of Adenylate cyclase type vs. TrEMBL
Match: A0A504YI32 (Adenylate cyclase 9 OS=Fasciola gigantica OX=46835 GN=FGIG_01544 PE=4 SV=1)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 383/974 (39.32%), Postives = 534/974 (54.83%), Query Frame = 1
Query:  460 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRI-KYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMT-------GLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFS---LVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQIXXXXX------------------XXXXXXQLNMANKLYSVPHSV---QQILLNQDDNEKHNFK-----RRD-----------RKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKXXXXXXXXXXXXXXXVILLAA------YVMLPKSF-GFRFYSPXXXXXXXXXXXXXXXXXXXXKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYXXXXXXXXXXXXXXNVISTSLSS------LVKHITTGSYTAIAICLCFYAP-TKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVR 3189
            YS  V++++ MY    +K  V + +S+++++    +  F   K  E   LN S       + R R ++    Y   G   ++    M+        +YLRF+N IRR+ AF KL ++ +AR +  +A++ Q+ WIEAIMPS V+E +    + +   S    V+ + F+NVSILFADIVGFT MSSNKTA ++V +LN+L+NRFDE    T CEKIGTLGDCYYCVSGCP+PR +HAI C+EMGLGMCR+I  FN D +E V MR+GIH+GRV AAIIG  RFRFDV+SYDVIIA+ LESSG+ G VH+SE TF LV+  YNF  G+ L + KE+V GI+GM   +  +NTYFV PR  + +K                            M+  L +V  S+   +   LN+ + ++ +       R D           R++  D+ +V  LQ DP      F++ P++   L F D + E+ Y     D      + S K+A   D +       +IL+        + +LP +F     YS             + FIS  Y+ ++ + +LR+ Y     P  R L    ++  P+++++ L+++   +T++         A       +    LSS      +   IT G  T    C+   +P   + L L  F +   Y       F L    +F+ +L     L+ +++RENE+N RL FY +REAEI   EA  A   A  LLYNIIPK V   +  K    +  FSYA +  NAGV FA ISNFFS YYREDYKGGE AL+LL++I+C FD LL+ P    +EK+KTINDCYM+A+GLN +      +S  HL  LM +   +   L  FN   IIG   F +K+GYN GP+ AG+IGT+KP+YDIWG+TVNVASRMYST      IQVP+ VA  L+ YF F YR  + VKGKG M T+L  R
Sbjct:  170 YSAGVVLLICMYAFLPLKLTVCICISVMFVITAAGLEAFHASKRFESSSLNTSLKWIHYDLFR-RLRVSNRKYAQVGSLGVVQTQIMSWIPVGIIAIYLRFWNMIRRRMAFFKLGKSVQARQECDAALQGQVRWIEAIMPSVVREEYQALRKKNLHLSAGMWVFNKTFDNVSILFADIVGFTRMSSNKTAHRVVTMLNNLFNRFDELCEATKCEKIGTLGDCYYCVSGCPVPRANHAICCIEMGLGMCRVIKVFNCDFQESVGMRIGIHTGRVNAAIIGAQRFRFDVYSYDVIIASELESSGRPGRVHISEKTFELVKSVYNFSVGEPLAVRKEEVCGIAGMTLVTTYINTYFVDPRSSQLRKKHERFGSAHVELHSFIDHRSTVRDPSFRMSAYLPAVSKSLDRQESDELNEAEQQQFDLACGSWIRADQRKFNDPQLIMRQFDRDISLVHNLQNDPAHQYRLFRHLPVSPTWLVFYDAETEWHYRTQLLDSTRRTYLDSQKVAPISDVVVCFMITLIILVNCIELQKDHQVLPSNFYVLCVYS---LIVYSIASACLIFISTTYEDQLSSVRLRQSYRILIRPWVRELCTAIITLTPTMILL-LFSRLCTSTAFLVGKRRLVSAACLHCLLIHCVPLSSAAWSRNICALITFGLITHGTNCMGKMSPHGDKCLGLTFFIDGIAY-----GKFCL----VFNVELWLCTALVLFVSRENERNCRLCFYVSREAEIAVDEAEQAMNEARDLLYNIIPKYVHDHL--KTYCTDSGFSYAVSIPNAGVAFATISNFFSKYYREDYKGGENALKLLNSIVCMFDELLELPEMKDVEKVKTINDCYMVAAGLNREEVRRNRSSQAHLIALMNYCHLVVESLDEFNNMYIIGTDQFEVKVGYNSGPLIAGVIGTTKPMYDIWGNTVNVASRMYSTG-LVGKIQVPQQVAESLQEYFRFVYRDEIFVKGKGMMQTYLCER 1126          
BLAST of Adenylate cyclase type vs. TrEMBL
Match: A0A2H1CFY2 (Adenylate cyclase 9 OS=Fasciola hepatica OX=6192 GN=D915_004743 PE=4 SV=1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 382/985 (38.78%), Postives = 533/985 (54.11%), Query Frame = 1
Query:  460 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRI-KYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITG-------QCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFS---LVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPH-------------------------SVQQILLNQDDNEKHNFKRRD-----------------------RKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKXXXXXXXXXXXXXXXVILLAA------YVMLPKSF-GFRFYSPXXXXXXXXXXXXXXXXXXXXKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYXXXXXXXXXXXXXXNVISTSLSS------LVKHITTGSYTAIAICLCFYAP-TKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVR 3189
            YS  V++++ MY    +K  V + +S++++L    +  F   K  E   LN +T+  +      R ++    Y   G       Q +    + +  +YLRF+N IRR+ AF KL ++ +AR +  +A++ Q+ WIEAIMPS V+E +    + +   S    V+ + F+NVSILFADIVGFT MSSNKTA ++V +LN+L+NRFDE    T CEKIGTLGDCYYCVSGCP+PR +HAI C+EMGLGMCR+I  FN D +E V MR+GIH+GRV AAIIG  RFRFDV+SYDVIIA+ LESSG+ G VH+SE TF LV+  YNF  G+ L + KE+V GI+GM   +  +NTYFV PR             QL   ++ +   H                         +V + L  Q+ +E +  +++                        R++  D+ +V  LQ DP      F++ P++   L F D + E+ Y     D      + S K+A   D +       +ILL        + +LP +F     YS             + FIS  Y+ ++ + +LR+ Y     P  R L    ++  P+++++ L+++   +T++         A       +    LSS      +   IT G  T    C+   +P   + L L  F +   Y       F L    +F+ +L     L+ +++RENE+N RL FY +REAEI   EA  A   A  LLYNIIPK V   +  K    +  FSYA +  NAGV FA ISNFFS YYREDYKGGE AL+LL++I+C FD LL+ P    +EK+KTINDCYM+A+GLN +      +S  HL  LM +   +   L  FN   IIG   F +K+GYN GP+ AG+IGT+KP+YDIWG+TVNVASRMYST      IQVP+ VA  L+ YF F YR  + VKGKG M T+L  R
Sbjct:  170 YSAGVVLLICMYAFLPLKLTVCICISVMFVLTAAGLEAFHASKRFESPSLN-TTLKWIHYDLFRRLRVSNRKYAQVGSLGVVQTQIMSWIPVGIIAIYLRFWNMIRRRMAFFKLGKSVQARHECDAALQGQVRWIEAIMPSVVREEYQALRKKNLHLSAGMWVFNKTFDNVSILFADIVGFTRMSSNKTAHRVVTMLNNLFNRFDELCEATKCEKIGTLGDCYYCVSGCPVPRANHAICCIEMGLGMCRVIKVFNCDFQESVGMRIGIHTGRVNAAIIGAQRFRFDVYSYDVIIASELESSGRPGRVHISEKTFELVKSVYNFSVGEPLAVKKEEVCGIAGMTLVTTYINTYFVDPRS-----------SQLRKKHERFGSAHVELHSFIDHRSTVRDPSFRMSAYLPAVSKPLDRQESDELNEAEQQQFDLACGSWIRADQRKLNDPQLIMRQFDRDISLVHNLQNDPAHQYRLFRHLPVSPTWLVFYDAETEWHYRTQLLDSTRRTYLDSQKVAPISDVVVCFMITLIILLNCIQLQKDHHVLPSNFYVLCVYS---LVVYSIASACLIFISTTYEDQLSSVRLRQSYRILIRPWVRELCTAIITLTPTMILL-LFSRLCTSTAFLVGKRRLVSAACLHCLLIHCVPLSSAAWSRNICALITFGLITHGTNCMGKMSPHGDKCLGLTFFIDDVAY-----GKFCL----VFNVELWLCTALVLFVSRENERNCRLCFYVSREAEIAVDEAEQAMNEARDLLYNIIPKYVHDHL--KTYCTDSGFSYAVSIPNAGVAFATISNFFSKYYREDYKGGENALKLLNSIVCMFDELLELPEMKDVEKVKTINDCYMVAAGLNREEVRRNRSSQAHLIALMNYCHLVVESLDEFNNMYIIGTDQFEVKVGYNSGPLIAGVIGTTKPMYDIWGNTVNVASRMYSTG-LVGKIQVPQQVAESLQEYFRFIYRDEIFVKGKGMMQTYLCER 1126          
BLAST of Adenylate cyclase type vs. TrEMBL
Match: A0A4E0RSE2 (Adenylate cyclase type 9 OS=Fasciola hepatica OX=6192 GN=D915_005129 PE=4 SV=1)

HSP 1 Score: 557.37 bits (1435), Expect = 8.050e-177
Identity = 369/1003 (36.79%), Postives = 540/1003 (53.84%), Query Frame = 1
Query:  469 VVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNF---RIKYVEQKELN--VSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFS---LVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPR--QIXXXXXXXXXXXQLNMANKLY-------SVPHSVQQILLNQDDNEK----HN--------------------FKRRD------------------------RKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIE--YQYLFHTTDQIEPIQIYSIKXXXXXXXXXXXXXXXVILLAAYVMLPKSFGFRFYSPXXXXXXXXXXXXXXXXXXXXKS---------EIPNRK-LRKFYCFWSHPLSRLLLGVYMSSLPSI--LVISLYNKNILATSYHYXXXXXXXXXXXXXXNVISTSLSSLVKHIT----------TGSYTAIAICLCFYAPTKRELN---LYSFDNCSIYLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQ--SNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE------HLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTF 3177
            +V + LL+     + F + + +++ Y +    + N    R+   E +EL+   S+ +D   + R RT I E    +T  C+ + + +++     F++ +RR+ AFL + Q+  AR + + +   QI WI+AIMPS V + ++   + +   S    VY +  +NVSILFADIVGFT MSS+KTA ++VYLL+DLYN FDE    T CEKI TLGDCYYCVSGCP+PR +HA  C+EMGLGMCR+I +FN+ H E VNMRVGIH+G+V AAIIG  RFR+DV+SYDV IANS+ESSG  G VH+SE T+ L++H Y    GD +E+  EQ+ GI+GM+   V + TYF+ P+  Q+ ++  K  +    N   K Y       S  H + Q L N   + K    HN                    ++R+                         ++ +G L  +  L+ DPER VE FQ  P+  IT  F D  +E  YQY F  T+Q  P+ + S++               VI+L   + + + F +   S +        I+ I        +         E P+ K L++ + F SHP++R  + ++ + +P I  +++S +      TS    S F  +   ++  +V+  S   LV+ +           T + +     LC +   +  ++   L+ F+ C ++ T      +L   C                 R N+ + RL F+ + EA   + EA  A + AE LLYNIIPK V ++++ ++   +     +YA +  N G+ FACISNFF++YYREDYKGGE AL+LL+ IIC+FD LL KP++ ++EKIKTINDCYM+ASGLN       + +      HL  LM F F +   L  FN   IIG+ +F LK+GYN GP+TAG+IGT KP+YD+WGDTVNVASRMYST      +QVP  V   LK +++F+  G   VKGKG M TF
Sbjct:  146 LVHLPLLLSVFIPLTFNIHITITVFYCMTSQVLDNIYYNRLYKPENRELHHLTSSETDPHGVSRERT-IHEIKRVLTWLCVFIVMFHVS-----FWSHLRRRVAFLLMGQSLYARARNKRSTARQISWIDAIMPSVVSKEYMALRKKNTGLSSEMWVYSKPVDNVSILFADIVGFTRMSSSKTAQQVVYLLSDLYNSFDELCDATQCEKIATLGDCYYCVSGCPLPRKNHAECCIEMGLGMCRIIKQFNQVHSESVNMRVGIHTGKVNAAIIGQIRFRYDVYSYDVAIANSMESSGLPGRVHISETTYELIKHIYQVAPGDPMEVKTEQLSGIAGMVLKVVSIRTYFIDPKSSQLYRRGEKFGYLYARNQTAKTYAGQRSDLSDAHRLTQTLDNMLSSVKGEQLHNPPSGLGTFLYDGMKPVSNGKWRRKSGVQIKQKGLHFQNIATAAAIREHHKQSRGILFFINDLRNDPERRVEQFQRMPLEPITQVFLDFNLEKSYQYAFRATNQ--PVFLNSLQ---------LAVLFDVIVLCILISISQLFTWLHLSSLDKVQPRIIIVSILACLFATGTFVWSLWILHECPSSKYLKQIWLFSSHPVTRECILMFTALVPCIQTVLLSFWVSKQPNTSNWTHSLFVLLRDLSITIHVVPLSSHPLVRLLGYIVCITTIGLTQNQSDSGWVLCAWGDNRSIVDYHRLFRFNMCELFATG----LMLYSLC-----------------RLNQHSCRLCFHVSHEARTCSLEAEKAQQEAEELLYNIIPKYVIEQMMIERHELNTGSQGTYAVSLPNIGIAFACISNFFATYYREDYKGGESALKLLNAIICSFDQLLSKPMFAEVEKIKTINDCYMVASGLNQKATTATATQDSDRRTHLVSLMDFCFMLLDTLNTFNTDYIIGSESFVLKVGYNIGPVTAGVIGTKKPMYDVWGDTVNVASRMYSTGK-PGLVQVPNLVREILKSHYNFERIGETFVKGKGVMETF 1109          
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Match: adcy9 (adenylate cyclase 9 [Source:NCBI gene;Acc:103022434])

HSP 1 Score: 220.705 bits (561), Expect = 2.681e-58
Identity = 137/363 (37.74%), Postives = 204/363 (56.20%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNA--EARLKMQSAIKIQIYWIEAIMPSSV-----------KENFLNRIRNSDS-----------------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILE----IMKEQVHGI 1443
             +SL + ++LL+Y++  ++    +LL +LY ++F ++G F + +V+ +E   S++  L                + G+ +L    ++ G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP  V            EN   R  +S S                 F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E V+MRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G ++E     + EQ+ G+
Sbjct:  232 TFSLCMEVLLLLYSMLHLRLYASVLLGILYSVLFETLGWFHLTHVDGEEEANSSLMQL----------------VLGKVLLHLCAHVIGIHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPQVVADELMKQGDDESENSGKRPTSSSSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCELTRCEKISTLGDCYYCVAGCPEPREDHAYCCVEMGLGMIQAIEQFCQETRETVDMRVGVHTGTVLCGILGIKRFKFDVWSNDVNLANLMEQLGMAGKVHLSEATASFLDDRYVREDGRVMERAGQSVTEQLKGL 576          

HSP 2 Score: 194.897 bits (494), Expect = 3.934e-50
Identity = 117/255 (45.88%), Postives = 155/255 (60.78%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++       ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN     E+     HL  L  FA +M H +  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  IQV E     L  + + F YRGTV VKGKG M T+L
Sbjct:  925 REFEVSYRLHYHGNVEADKHRIKIQNMRDQADWLLRNIIPIHVAEQL-------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFN-KNMLG-FQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RIQVSEESHCILSGMNYAFDYRGTVNVKGKGQMRTYL 1168          

HSP 3 Score: 71.2478 bits (173), Expect = 5.174e-12
Identity = 63/215 (29.30%), Postives = 106/215 (49.30%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRTDHAISCV--EMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLV 1377
            N EA   R+K+Q+ ++ Q  W+   I+P  V E    ++  S      Y ++ +NV ++FA IV F+     S +   +   +LN+L   FDE  R+   +N EKI T+G  Y   SG     C      HA  C   E  L M  ++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    + VSE++  ++
Sbjct:  938 NVEADKHRIKIQN-MRDQADWLLRNIIPIHVAEQL--KVTQS------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFNKNMLGFQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRIQVSEESHCIL 1143          
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Match: adcy9 (adenylate cyclase 9 [Source:NCBI gene;Acc:103022434])

HSP 1 Score: 214.157 bits (544), Expect = 3.292e-56
Identity = 133/377 (35.28%), Postives = 202/377 (53.58%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNA--EARLKMQSAIKIQIYWIEAIMPSSVKENFLNR------------------------------------------IRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILE----IMKEQVHGI 1443
             +SL + ++LL+Y++  ++    +LL +LY ++F ++G F + +V+ +E   S++  L                + G+ +L    ++ G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP  V +  + +                                           R    F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E V+MRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G ++E     + EQ+ G+
Sbjct:  232 TFSLCMEVLLLLYSMLHLRLYASVLLGILYSVLFETLGWFHLTHVDGEEEANSSLMQL----------------VLGKVLLHLCAHVIGIHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPQVVADELMKQGDDESENSGKRYSATGTGQASASTGPTSSSSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCELTRCEKISTLGDCYYCVAGCPEPREDHAYCCVEMGLGMIQAIEQFCQETRETVDMRVGVHTGTVLCGILGIKRFKFDVWSNDVNLANLMEQLGMAGKVHLSEATASFLDDRYVREDGRVMERAGQSVTEQLKGL 590          

HSP 2 Score: 196.052 bits (497), Expect = 1.910e-50
Identity = 153/407 (37.59%), Postives = 215/407 (52.83%), Query Frame = 1
Query: 2008 NRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYXXXXXXXXXXXXXXNVIS----TSLSSLVKHITTGSYTAIAICLCFYAPTKRELN-----LYSFDNCSI----YLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFL 3180
             + L K    W   + R ++G  + SLP+I V S      LA S H           A+I  VI       LS  ++ +   +     I + F APT+  +N       +F N S+    Y T+P +  +  +          + LL+++L RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++       ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN     E+     HL  L  FA +M H +  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  IQV E     L  + + F YRGTV VKGKG M T+L
Sbjct:  879 TKSLLKVVSGW---VPRHVIGAVLVSLPAISVFSH-----LAYSLHLPIQVMMFLCSAIIIAVIQYCNFCQLSFWMRSVLATATGLSMIVVLFSAPTRISINDSFPVTGNFSNASMGIVPYHTDPGSTALDLLIRETPLSFFLLLLLVWFLNREFEVSYRLHYHGNVEADKHRIKIQNMRDQADWLLRNIIPIHVAEQL-------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFN-KNMLG-FQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RIQVSEESHCILSGMNYAFDYRGTVNVKGKGQMRTYL 1266          

HSP 3 Score: 71.2478 bits (173), Expect = 5.995e-12
Identity = 63/215 (29.30%), Postives = 106/215 (49.30%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRTDHAISCV--EMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLV 1377
            N EA   R+K+Q+ ++ Q  W+   I+P  V E    ++  S      Y ++ +NV ++FA IV F+     S +   +   +LN+L   FDE  R+   +N EKI T+G  Y   SG     C      HA  C   E  L M  ++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    + VSE++  ++
Sbjct: 1036 NVEADKHRIKIQN-MRDQADWLLRNIIPIHVAEQL--KVTQS------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFNKNMLGFQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRIQVSEESHCIL 1241          
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Match: adcy9 (adenylate cyclase 9 [Source:NCBI gene;Acc:103022434])

HSP 1 Score: 214.157 bits (544), Expect = 3.552e-56
Identity = 133/377 (35.28%), Postives = 202/377 (53.58%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNA--EARLKMQSAIKIQIYWIEAIMPSSVKENFLNR------------------------------------------IRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILE----IMKEQVHGI 1443
             +SL + ++LL+Y++  ++    +LL +LY ++F ++G F + +V+ +E   S++  L                + G+ +L    ++ G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP  V +  + +                                           R    F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E V+MRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G ++E     + EQ+ G+
Sbjct:  232 TFSLCMEVLLLLYSMLHLRLYASVLLGILYSVLFETLGWFHLTHVDGEEEANSSLMQL----------------VLGKVLLHLCAHVIGIHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPQVVADELMKQGDDESENSGKRYSATGTGQASASTGPTSSSSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCELTRCEKISTLGDCYYCVAGCPEPREDHAYCCVEMGLGMIQAIEQFCQETRETVDMRVGVHTGTVLCGILGIKRFKFDVWSNDVNLANLMEQLGMAGKVHLSEATASFLDDRYVREDGRVMERAGQSVTEQLKGL 590          

HSP 2 Score: 196.052 bits (497), Expect = 1.817e-50
Identity = 153/407 (37.59%), Postives = 215/407 (52.83%), Query Frame = 1
Query: 2008 NRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYXXXXXXXXXXXXXXNVIS----TSLSSLVKHITTGSYTAIAICLCFYAPTKRELN-----LYSFDNCSI----YLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFL 3180
             + L K    W   + R ++G  + SLP+I V S      LA S H           A+I  VI       LS  ++ +   +     I + F APT+  +N       +F N S+    Y T+P +  +  +          + LL+++L RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++       ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN     E+     HL  L  FA +M H +  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  IQV E     L  + + F YRGTV VKGKG M T+L
Sbjct:  846 TKSLLKVVSGW---VPRHVIGAVLVSLPAISVFSH-----LAYSLHLPIQVMMFLCSAIIIAVIQYCNFCQLSFWMRSVLATATGLSMIVVLFSAPTRISINDSFPVTGNFSNASMGIVPYHTDPGSTALDLLIRETPLSFFLLLLLVWFLNREFEVSYRLHYHGNVEADKHRIKIQNMRDQADWLLRNIIPIHVAEQL-------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFN-KNMLG-FQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RIQVSEESHCILSGMNYAFDYRGTVNVKGKGQMRTYL 1233          

HSP 3 Score: 71.2478 bits (173), Expect = 4.987e-12
Identity = 63/215 (29.30%), Postives = 106/215 (49.30%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRTDHAISCV--EMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLV 1377
            N EA   R+K+Q+ ++ Q  W+   I+P  V E    ++  S      Y ++ +NV ++FA IV F+     S +   +   +LN+L   FDE  R+   +N EKI T+G  Y   SG     C      HA  C   E  L M  ++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    + VSE++  ++
Sbjct: 1003 NVEADKHRIKIQN-MRDQADWLLRNIIPIHVAEQL--KVTQS------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFNKNMLGFQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRIQVSEESHCIL 1208          
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Match: adcy8 (adenylate cyclase 8 [Source:NCBI gene;Acc:103024991])

HSP 1 Score: 191.43 bits (485), Expect = 4.546e-49
Identity = 95/248 (38.31%), Postives = 146/248 (58.87%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            +  Q +L   M   G+++ +     ++ AFL+  +  EARL++++  + Q   + +++P  V    +N +   +       F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K D++MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +H+S+     +   Y  E G
Sbjct:  291 LCAQVLLFVCMNTAGVFISYLADRAQRQAFLETRRCIEARLRLETENQRQERLVLSVLPRFVVLEMINDMSTVEDENLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRPDHAHCCVEMGLSMIKTIRYVRSRTKHDIDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKAALDCLNGDYEVEAG 538          

HSP 2 Score: 140.198 bits (352), Expect = 3.917e-33
Identity = 93/259 (35.91%), Postives = 136/259 (52.51%), Query Frame = 1
Query: 2434 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFLAVRSHFV 3201
            E   RL+F    +A+    E     +  E++L NI+P  V +  + K + NE +  Y+ ++ + GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  FA  ++  ++  N+ +      F L+IG   G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE     L +  F F+YRG + VKG  +      +R+HF+
Sbjct:  897 EYTARLDFLWRVQAKEEINEMRELREHNENMLRNILPSHVARHFLEKDRDNEEL--YSQSYDSVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFAIALNESIQEINKHSF---NNFQLRIGMAHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-ISGKIQVPEETFTILTERGFAFEYRGEIYVKGISEQEG--KIRTHFL 1147          

HSP 3 Score: 97.0561 bits (240), Expect = 6.076e-20
Identity = 78/289 (26.99%), Postives = 142/289 (49.13%), Query Frame = 1
Query:  847 IMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTD------HAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR-YNFE-KGDILEIMKEQVHGIS---GMIKT-----SVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNE---KHNFKRR 1635
            I+PS V  +FL + R+++    +Y Q +++V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG    +        H  +  +  + +   I + NK    +  +R+G+  G V+A +IG  + ++D++   V +A+ ++S+G +G + V E+TF ++  R + FE +G+I       V GIS   G I+T      V  N   + PR++  +         L     + S+    Q+ +LN+++N    K ++ RR
Sbjct:  931 ILPSHVARHFLEKDRDNEE---LYSQSYDSVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFAIALNESIQEINKHSFNNFQLRIGMAHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGISGKIQVPEETFTILTERGFAFEYRGEIY------VKGISEQEGKIRTHFLMGRVQPNPLILQPRKLTGQYSLAAVVLGL-----VQSLNRQKQKQILNENNNSGIMKGHYNRR 1205          

HSP 4 Score: 50.8322 bits (120), Expect = 9.367e-6
Identity = 50/220 (22.73%), Postives = 97/220 (44.09%), Query Frame = 1
Query: 2434 EKNIRLNFYATR---EAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQS-------NEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYS 3054
            ++  R  F  TR   EA +R       N+  E L+ +++P+ V  E++    +       ++    Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL     DH     +  L ++ T  +     +R   + +I       ++IG + G +  G++G  K  +D+W   V++A+++ S
Sbjct:  313 DRAQRQAFLETRRCIEARLR---LETENQRQERLVLSVLPRFVVLEMINDMSTVEDENLQHQFHRIYIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRPDHAHCCVEMGLSMIKTIRY-----VRSRTKHDI------DMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLES 512          
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Match: adcy8 (adenylate cyclase 8 [Source:NCBI gene;Acc:103024991])

HSP 1 Score: 191.045 bits (484), Expect = 5.357e-49
Identity = 95/248 (38.31%), Postives = 146/248 (58.87%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            +  Q +L   M   G+++ +     ++ AFL+  +  EARL++++  + Q   + +++P  V    +N +   +       F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K D++MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +H+S+     +   Y  E G
Sbjct:  291 LCAQVLLFVCMNTAGVFISYLADRAQRQAFLETRRCIEARLRLETENQRQERLVLSVLPRFVVLEMINDMSTVEDENLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRPDHAHCCVEMGLSMIKTIRYVRSRTKHDIDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKAALDCLNGDYEVEAG 538          

HSP 2 Score: 139.813 bits (351), Expect = 4.028e-33
Identity = 93/259 (35.91%), Postives = 136/259 (52.51%), Query Frame = 1
Query: 2434 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFLAVRSHFV 3201
            E   RL+F    +A+    E     +  E++L NI+P  V +  + K + NE +  Y+ ++ + GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  FA  ++  ++  N+ +      F L+IG   G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE     L +  F F+YRG + VKG  +      +R+HF+
Sbjct:  831 EYTARLDFLWRVQAKEEINEMRELREHNENMLRNILPSHVARHFLEKDRDNEEL--YSQSYDSVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFAIALNESIQEINKHSF---NNFQLRIGMAHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-ISGKIQVPEETFTILTERGFAFEYRGEIYVKGISEQEG--KIRTHFL 1081          

HSP 3 Score: 97.0561 bits (240), Expect = 7.174e-20
Identity = 78/289 (26.99%), Postives = 142/289 (49.13%), Query Frame = 1
Query:  847 IMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTD------HAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR-YNFE-KGDILEIMKEQVHGIS---GMIKT-----SVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNE---KHNFKRR 1635
            I+PS V  +FL + R+++    +Y Q +++V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG    +        H  +  +  + +   I + NK    +  +R+G+  G V+A +IG  + ++D++   V +A+ ++S+G +G + V E+TF ++  R + FE +G+I       V GIS   G I+T      V  N   + PR++  +         L     + S+    Q+ +LN+++N    K ++ RR
Sbjct:  865 ILPSHVARHFLEKDRDNEE---LYSQSYDSVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFAIALNESIQEINKHSFNNFQLRIGMAHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGISGKIQVPEETFTILTERGFAFEYRGEIY------VKGISEQEGKIRTHFLMGRVQPNPLILQPRKLTGQYSLAAVVLGL-----VQSLNRQKQKQILNENNNSGIMKGHYNRR 1139          

HSP 4 Score: 50.8322 bits (120), Expect = 9.999e-6
Identity = 50/220 (22.73%), Postives = 97/220 (44.09%), Query Frame = 1
Query: 2434 EKNIRLNFYATR---EAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQS-------NEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYS 3054
            ++  R  F  TR   EA +R       N+  E L+ +++P+ V  E++    +       ++    Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL     DH     +  L ++ T  +     +R   + +I       ++IG + G +  G++G  K  +D+W   V++A+++ S
Sbjct:  313 DRAQRQAFLETRRCIEARLR---LETENQRQERLVLSVLPRFVVLEMINDMSTVEDENLQHQFHRIYIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRPDHAHCCVEMGLSMIKTIRY-----VRSRTKHDI------DMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLES 512          
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Match: adcy9 (adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-050208-455])

HSP 1 Score: 233.802 bits (595), Expect = 3.109e-63
Identity = 134/364 (36.81%), Postives = 198/364 (54.40%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS---------------------------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILE------IMKEQVHGI 1443
            ++++ V ++LL+YT   +      LL L Y ++F  +G      +    ++   +S      R  T+       + G+  L   ++  G+++   + +R +S FLK+ Q+      L+++ A+K ++  I A+MP  + +  L +  + DS                           F     +    VS+LFADIVGFT MS+NK+AA LV LLNDL+ RFD+    T CEKI TLGDCYYCV+GCP PRTDHA  CVEMGLGM   I +F +D++E V+MRVG+H+G V+  I+G  RF+FDV S DV +AN +E  G AG VHVSE T L +  RY  E G + E      ++ EQ+  +
Sbjct:  145 SFAVCVEVLLLLYTAMPLPLYACALLGLSYSVLFEVVGQLWSTGLLLPNVSAGWLS------RAHTEGLAAT--VVGKAFLHLCIHAIGIHIFIMSQVRSRSTFLKVGQSIIHGKELEVEKALKEKM--IHAVMPRMIADELLRQQGDDDSEASAPTTASNPGPRKKKKGSIPREQLPFRPFTMKRMSEVSVLFADIVGFTKMSANKSAATLVRLLNDLFGRFDKLCEVTGCEKISTLGDCYYCVAGCPEPRTDHAACCVEMGLGMIAAIEQFCRDNRETVDMRVGVHTGTVLCGILGMKRFKFDVLSNDVNLANMMEQLGVAGKVHVSEATALCLDERYTMEDGRLFERIGPNAVLAEQLKAL 498          

HSP 2 Score: 193.741 bits (491), Expect = 1.700e-50
Identity = 117/255 (45.88%), Postives = 153/255 (60.00%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEH--LKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKL-KLYFDFKYRGTVAVKGKGDMTTFL 3180
            RE E   RLN++   EAE+   +  H    A+ LL+NIIP  V  ++  K Q +     Y+    + GVIFA I NF S +Y E+Y+GG+   R+LH ++   D LL +  Y  +EKIKTI   YM ASGLN   E  A D H  L+ L  FA DM   +  FN+  +   F F L+IG+N GP+TAG+IGT+KPLYDIWGDTVN+ASRM ST   C  +QV +   + L  + + F YRGTV VKGKG M T+L
Sbjct:  932 REFEVAYRLNYHGNVEAELHQRKIQHMKNQADLLLHNIIPGHVADQL--KVQPH-----YSKNHEDVGVIFASIVNF-SEFYEENYEGGKECYRVLHELMSDLDQLLARDHYGGIEKIKTIGATYMAASGLNVP-EPRAGDAHAHLRTLFEFARDMMSIVEDFNKDMLW--FNFRLRIGFNHGPLTAGVIGTTKPLYDIWGDTVNIASRMDSTGVDC-RVQVSQESYHVLCDMGYQFDYRGTVNVKGKGQMKTYL 1174          

HSP 3 Score: 62.003 bits (149), Expect = 7.381e-10
Identity = 50/174 (28.74%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  916 YCQHFENVSILFADIVGFT-MMSSNKTAAKLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSG--CPIPRTD----HAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            Y ++ E+V ++FA IV F+     N    K  Y +L++L +  D+   +      EKI T+G  Y   SG   P PR      H  +  E    M  ++  FNKD    +  +R+G + G + A +IG  +  +D++   V IA+ ++S+G    V VS++++ +L    Y F+
Sbjct:  984 YSKNHEDVGVIFASIVNFSEFYEENYEGGKECYRVLHELMSDLDQLLARDHYGGIEKIKTIGATYMAASGLNVPEPRAGDAHAHLRTLFEFARDMMSIVEDFNKDMLWFNFRLRIGFNHGPLTAGVIGTTKPLYDIWGDTVNIASRMDSTGVDCRVQVSQESYHVLCDMGYQFD 1157          
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008766.1 (pep scaffold:Pmarinus_7.0:GL476654:390837:418056:1 gene:ENSPMAG00000007932.1 transcript:ENSPMAT00000008766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.407 bits (446), Expect = 1.814e-49
Identity = 93/233 (39.91%), Postives = 137/233 (58.80%), Query Frame = 1
Query:  715 MTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENF---LNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            M G+   +   + ++ AF +  +  +ARL+ Q   + Q   + +++P  V       +N  +    F  +Y Q  +NVSILFADI GFT ++S  TA +LV  LN+L+ RFD+   + +C +I  LGDCYYCVSG P  R DHA  CVEMG+ M   I    +    +VNMRVGIHSGRV   ++G  +++FDV+S DV +AN +E+ GKAG +H+++ T   +   Y  E G
Sbjct:   24 MAGVCTHYPTEVAQRQAFHETRECIKARLRTQKENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLIKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLRYLNGDYEVEAG 256          

HSP 2 Score: 58.151 bits (139), Expect = 3.575e-9
Identity = 52/205 (25.37%), Postives = 84/205 (40.98%), Query Frame = 1
Query: 2446 RLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKE----IVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRM 3048
            R  F+ TRE           N+  E LL +++P+ V  E    I  KK+       Y     N  ++FA I  F S          E+ +  L+ +   FD L  +   L+   IK + DCY   SGL       A  +H    +    DM   + L  E   +      +++G + G +  G++G  K  +D+W + V +A+ M
Sbjct:   38 RQAFHETRECIKARLRTQKENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTS--LASQCTAQELVM-TLNELFARFDKLAAENHCLR---IKILGDCYYCVSGLPE-----ARADHAHCCVEMGVDMIEAISLVRE---VTGVNVNMRVGIHSGRVHCGVLGLIKWQFDVWSNDVTLANHM 228          
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Match: ADCY1 (adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:232])

HSP 1 Score: 186.808 bits (473), Expect = 8.710e-49
Identity = 96/238 (40.34%), Postives = 145/238 (60.92%), Query Frame = 1
Query:  715 MTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFL---NRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGD 1407
            ++G ++R      ++ AFL+     E RL+++   + Q   + +++P  V    KE+FL    RI     F  +Y Q  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+ DHA  CVEMGL M   I    +  + D+NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VH+++ T   +   Y  E G+
Sbjct:   28 LSGAFIRVLTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRHVAMEMKEDFLKPPERI-----FHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKADHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKSTLDCLNGDYEVEPGN 260          

HSP 2 Score: 144.436 bits (363), Expect = 2.391e-35
Identity = 93/257 (36.19%), Postives = 134/257 (52.14%), Query Frame = 1
Query: 2422 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLY-FDFKYRGTVAVKGKGDMTTF 3177
            +R+ +  +RL++    +AE    +        + +L+N++P  V +  +     N  +  Y  +++  GV+FA I NF   Y   D    G   LRLL+ II  FD LL K  +  +EKIKTI   YM A GL   +    + +   HL  +  FA +M     + +E N      F L++G + GP+ AG+IG  +P YDIWG+TVNVASRM ST      IQV E V   LK   ++F  RG V VKGKG+M T+
Sbjct:  604 SRQLDLKLRLDYLWASQAEDERGDMERVKNDNKRILFNLLPAHVAQHFLQSNPRNMDL--YYQSYSQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELLDKECFKDIEKIKTIGSTYMAAVGLVPTSGTKAKCSIISHLSSVADFAMEM---FDVVDEINYQSYNDFVLRVGISVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTG-LPGKIQVSEDVYKILKQSNYEFTCRGKVTVKGKGEMLTY 854          

HSP 3 Score: 65.855 bits (159), Expect = 4.455e-11
Identity = 84/327 (25.69%), Postives = 146/327 (44.65%), Query Frame = 1
Query:  541 LYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-NRIRNSDSFSLVYCQHFENVSILFADIVGFT----MMSSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-CPIPRT-------DHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE---------KGDILEIMKEQVHGI 1443
            +Y+L+ + +G +R         +++  S L        K +E         ILLF+  M GL+ R  + ++ +  +L  +Q  + R  M+         +  ++P+ V ++FL +  RN D    +Y Q +  V +LFA I  F      +  N    + + LLN++   FDE   +    + EKI T+G  Y    G  P   T        H  S  +  + M  ++ + N     D  +RVGI  G V+A +IG  R ++D++   V +A+ ++S+G  G + VSED + +L +  Y F          KG++L    E   G+
Sbjct:  563 VYVLV-LELGGYR---------HIAGTSAL------YMKAYEPVLT-----ILLFICAM-GLHSRQLD-LKLRLDYLWASQAEDERGDMERVKNDNKRILFNLLPAHVAQHFLQSNPRNMD----LYYQSYSQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELLDKECFKDIEKIKTIGSTYMAAVGLVPTSGTKAKCSIISHLSSVADFAMEMFDVVDEINYQSYNDFVLRVGISVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGLPGKIQVSEDVYKILKQSNYEFTCRGKVTVKGKGEMLTYFLEGKQGL 862          

HSP 4 Score: 50.447 bits (119), Expect = 2.431e-6
Identity = 49/209 (23.44%), Postives = 83/209 (39.71%), Query Frame = 1
Query: 2431 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGK-KQSNEIIFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRM 3048
             E+  R  F   R            N+  E LL +++P+ V  E+     +  E IF   Y     N  ++FA I  F S   +      +  ++LL+ +   FD L  +       +IK + DCY   SGL          +H    +    DM   +    E   +      +++G + G +  G++G  K  YD+W + V +A+ M
Sbjct:   37 TERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRHVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ---CTAQELVKLLNELFGKFDELATEN---HCRRIKILGDCYYCVSGLTQ-----PKADHAHCCVEMGLDMIDTITSVAEATEV---DLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVM 231          
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006025.1 (pep scaffold:Pmarinus_7.0:GL480980:9262:24123:1 gene:ENSPMAG00000005435.1 transcript:ENSPMAT00000006025.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.866 bits (442), Expect = 3.721e-46
Identity = 94/241 (39.00%), Postives = 144/241 (59.75%), Query Frame = 1
Query:  694 ILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            +LL      G  +R F    ++S F +  ++   RL +    + Q   + +++P  V    +++FL     +  F  VY Q  ENVSILFADIVGFT M+S  TA +LV LLN+L+++FDE   + +C +I  LGDCYYCVSG  + + DHA  CV+MGL M   I    +  +  +NMRVG+H+GRV+  ++G  ++++DV+S DV +AN++E+ G  G VH+++ T   +R  Y  E G
Sbjct:  172 VLLVSACACGGAVRIFTERVQRSTFRRTWESVRQRLLLDDENEKQERLLVSLLPRHVAIELRQDFLKP--PNHIFHKVYIQRHENVSILFADIVGFTGMASQCTAQELVKLLNELFSKFDELATENHCRRIKILGDCYYCVSGLALAKADHAHCCVKMGLDMIDTIDLVAEAMEVRLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANAMEAGGLPGKVHITKATLDGLRGDYEVEPG 410          

HSP 2 Score: 56.225 bits (134), Expect = 3.508e-8
Identity = 51/209 (24.40%), Postives = 86/209 (41.15%), Query Frame = 1
Query: 2431 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGK--KQSNEIIFS-YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRM 3048
             E+  R  F  T E+  +       N+  E LL +++P+ V  E+     K  N I    Y     N  ++FA I  F            +  ++LL+ +   FD L  +       +IK + DCY   SGL      +A  +H    +    DM   + L  E   +      +++G + G +  G++G  K  YD+W + V +A+ M
Sbjct:  188 TERVQRSTFRRTWESVRQRLLLDDENEKQERLLVSLLPRHVAIELRQDFLKPPNHIFHKVYIQRHENVSILFADIVGFTGM---ASQCTAQELVKLLNELFSKFDELATEN---HCRRIKILGDCYYCVSGL-----ALAKADHAHCCVKMGLDMIDTIDLVAEAMEV---RLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANAM 382          
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Match: adcy2a (adenylate cyclase 2a [Source:ZFIN;Acc:ZDB-GENE-061109-1])

HSP 1 Score: 169.859 bits (429), Expect = 1.800e-43
Identity = 77/172 (44.77%), Postives = 116/172 (67.44%), Query Frame = 1
Query:  889 RNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
             NS++F  +Y +  ++VSIL+ADIVGFT ++S+ + A+LV+ LN L+ +FD+  +  +C +I  LGDCYYCVSG PI    HA +CV+MG+ MC  I K       D+NMRVG+HSG V+  +IG  ++++DV+S+DV +AN +E+ G  G VH++E T   +   Y  E+G
Sbjct:   40 ENSNNFHNLYVRRHKSVSILYADIVGFTRLASDCSPAELVHTLNQLFGKFDQIAKDNDCMRIKILGDCYYCVSGLPISLPSHAKNCVKMGIDMCEAIKKVRYATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITEATLEHLHGAYEVEEG 211          

HSP 2 Score: 154.066 bits (388), Expect = 2.131e-38
Identity = 97/263 (36.88%), Postives = 142/263 (53.99%), Query Frame = 1
Query: 2422 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDY-KGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE------HLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFLAV 3186
            AR+NE   RL+F   ++ +    E      +   LL N++P  V +  +   + NE +  Y  ++    V+FA I +F   Y   D  K G   LRLL+ II  FD LL KP +  +EKIKTI   YM A+GLN+   +    E      H+ I++ FA  +   L + N+ +      F L++G N GP+ AG+IG  KP YDIWG++VNV+SRM ST      IQV E  ++ L+ L ++ + RG + VKGKG++ TF  V
Sbjct:  595 ARQNEYYCRLDFLWKQKFKKEREEIETMENLNRVLLENVLPAHVAEHFLTHHRKNEDL--YHQSYECVCVMFASIPDFKEFYQESDVNKEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNAAVGQENGQEPERQYAHIGIMVEFAMALMGKLDVINKHSF---NNFRLRVGINHGPVIAGVIGAQKPQYDIWGNSVNVSSRMDSTG-VLGKIQVTEETSDILQTLGYNCQCRGMIKVKGKGELKTFFVV 851          

HSP 3 Score: 80.4925 bits (197), Expect = 1.215e-15
Identity = 73/286 (25.52%), Postives = 130/286 (45.45%), Query Frame = 1
Query:  694 ILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM----SSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-----------PIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKT--SVPMNTYFVI 1491
            I L + + T L L   N    +  FL   +  + R ++++   +    +E ++P+ V E+FL   R ++    +Y Q +E V ++FA I  F         NK   + + LLN++   FDE   + + +  EKI T+G  Y   +G            P  +  H    VE  + +   +   NK    +  +RVGI+ G VIA +IG  + ++D++   V +++ ++S+G  G + V+E+T             DIL+ +        GMIK      + T+FV+
Sbjct:  582 IWLIVFFFTLLVLARQNEYYCRLDFLWKQKFKKEREEIETMENLNRVLLENVLPAHVAEHFLTHHRKNED---LYHQSYECVCVMFASIPDFKEFYQESDVNKEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNAAVGQENGQEPERQYAHIGIMVEFAMALMGKLDVINKHSFNNFRLRVGINHGPVIAGVIGAQKPQYDIWGNSVNVSSRMDSTGVLGKIQVTEET------------SDILQTLGYNCQ-CRGMIKVKGKGELKTFFVV 851          
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Match: EDO47010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN58])

HSP 1 Score: 216.083 bits (549), Expect = 1.888e-57
Identity = 136/370 (36.76%), Postives = 200/370 (54.05%), Query Frame = 1
Query:  460 YSLVVLIILLMYTLFRMKFMVVMLLSL-LYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS----------------------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQ 1500
            +S+    IL++YT         ML SL LYI IF+++  F I +    E+  +   + +  +R + +  E    I    +L   +++ G+ + F   +R +S F K+ Q+  AR  ++   +++   I ++MP  V ++ LN + + D                       F        ENVSILFADIVGFT MSSNK+A +LV LLNDL+ RFD      +CEKI TLGDCYYCV+GCP P  +HA  CVEMGL M   I +F+ D   DV+MRVG+H+G V+  I+G  RF+FDV+S DV +AN +E++G  G VH++E T   +R +Y  E G   E     + GI+          TYF++ R+
Sbjct:  128 FSVCTCFILVIYT---------MLHSLRLYICIFITVA-FSIAH----EVLYAFFGNSKG-QRLKGQGEE----IASIVLLHACIHLIGISIFFMAQVRERSTFWKVGQSYVARRDLEIEKQVKERMIRSVMPEIVADSLLN-VDDEDENKNGNGREMGNGKRKHKKAKMVFRPFQMHRMENVSILFADIVGFTKMSSNKSADQLVRLLNDLFGRFDRLTEYNHCEKISTLGDCYYCVAGCPKPTPNHATYCVEMGLDMLEQIKEFDNDTDNDVDMRVGVHTGTVLCGIVGTKRFKFDVWSNDVTLANRMETAGLPGRVHITEATVGFLRDQYIVENGH-GETRNAALKGIT----------TYFIVGRK 466          

HSP 2 Score: 181.03 bits (458), Expect = 2.153e-46
Identity = 109/257 (42.41%), Postives = 158/257 (61.48%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREA-EIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTIN-DCYMLASGLNSD---HEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFL 3180
            R+ E  +R NF    EA +++     H  + A+ LL ++ PK V + +   K S+     Y+  + NAGV+FA I NF S +Y E+++GG+  +R+L+ ++  FD LL    Y+++EKIKT+N   +M  +GLN +     E+   EHLK L+ FA +M + +  FNE  +   F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST      IQV E     L  +F F+ RGT+ VKGKG +TT+L
Sbjct:  847 RQLEMGVRRNFSGDAEAAKVKKKSQVHKQQ-ADWLLLSLFPKHVSEAL---KTSDH----YSMNYNNAGVMFASIVNF-SDFYEENFEGGKECIRVLNELVGDFDELLDNIEYMEVEKIKTVNGSTFMAGAGLNQEDNIRREIHPYEHLKQLVEFALEMFNVVDRFNEHML--GFKFKLRIGFNAGPVTAGVIGTTKLLYDIWGDTVNLASRMDSTG-VPEKIQVSESTKEMLNDFFIFERRGTIPVKGKGYVTTYL 1091          

HSP 3 Score: 61.2326 bits (147), Expect = 2.418e-9
Identity = 56/221 (25.34%), Postives = 104/221 (47.06%), Query Frame = 1
Query:  793 ARLKMQSAI-KIQIYWIE-AIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSN--KTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTD----------HAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEK 1401
            A++K +S + K Q  W+  ++ P  V E     ++ SD +S+ Y     N  ++FA IV F+       +   + + +LN+L   FDE          EKI T+    + ++G  + + D          H    VE  L M  ++ +FN+        +R+G ++G V A +IG  +  +D++   V +A+ ++S+G    + VSE T  ++   + FE+
Sbjct:  864 AKVKKKSQVHKQQADWLLLSLFPKHVSE----ALKTSDHYSMNY----NNAGVMFASIVNFSDFYEENFEGGKECIRVLNELVGDFDELLDNIEYMEVEKIKTVNGSTF-MAGAGLNQEDNIRREIHPYEHLKQLVEFALEMFNVVDRFNEHMLGFKFKLRIGFNAGPVTAGVIGTTKLLYDIWGDTVNLASRMDSTGVPEKIQVSESTKEMLNDFFIFER 1075          

HSP 4 Score: 58.5362 bits (140), Expect = 1.498e-8
Identity = 42/168 (25.00%), Postives = 72/168 (42.86%), Query Frame = 1
Query: 2608 HAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK 3111
            H   N  ++FA I  F         K  +  +RLL+ +   FD L +   Y   EKI T+ DCY   +G         +  H    +    DM   ++ F+      +    +++G + G +  GI+GT +  +D+W + V +A+RM  TA     + + E     L+
Sbjct:  285 HRMENVSILFADIVGFTK---MSSNKSADQLVRLLNDLFGRFDRLTE---YNHCEKISTLGDCYYCVAGCPK-----PTPNHATYCVEMGLDMLEQIKEFDNDT---DNDVDMRVGVHTGTVLCGIVGTKRFKFDVWSNDVTLANRM-ETAGLPGRVHITEATVGFLR 437          
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Match: EDO45868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ7])

HSP 1 Score: 190.274 bits (482), Expect = 2.569e-49
Identity = 98/246 (39.84%), Postives = 148/246 (60.16%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            + G  +L     +TG++  +   I ++ AFL+  +  EARL +Q   + Q   + +++P  V    K++  + I  +  F  +Y Q  ENVSILFADI GFT++SS  TA  L+  LN+LY RFD+   + +C +I  LGDCYYCVSG P PR DHA SC+EMGL M   I       + ++NMRVG+H G+V + ++G  ++++DV+S DV IAN +ES G  G VH++++    +   Y  E+G
Sbjct:  254 LVGNLLLFICANITGVFTHYPTEISQRQAFLETRRCIEARLTIQKENQNQERLLLSVLPRYVAMEMKDDIESGISQNSQFHKIYIQRHENVSILFADIEGFTVLSSQCTAQSLIKTLNELYARFDQLAVENHCLRIKILGDCYYCVSGLPDPRPDHAHSCIEMGLAMIDAISFVRDATQVNLNMRVGVHMGKVHSGVLGLVKWQYDVWSDDVTIANHMESGGLPGRVHITKEVLDCLNGDYEVEEG 499          

HSP 2 Score: 159.458 bits (402), Expect = 1.005e-39
Identity = 103/253 (40.71%), Postives = 138/253 (54.55%), Query Frame = 1
Query: 2431 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVG-KKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSD-HEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLY-FDFKYRGTVAVKGKGDMTTF 3177
            +E+  RL+F    +A     E     +  + LLYNI+P  V +  +G K   NE +  Y  +     V+F+ I NF   Y   D  G G   LRLL+ I+  FD LL +P +  +EKIKTI + YM ASG+  +  E++A+  H+  +  FA  M   L   N  +      F +KIG NFGP+ AG+IG  KP YDIWGDTVNVASRMYST    + IQV + +   L    + F  RG VAVKGKG M T+
Sbjct:  792 HEQISRLDFLWKLQATEEKKEMEQLREYNKKLLYNILPVHVAQHFLGHKANKNEDL--YYQSCDKVAVMFSNICNFSDFYTELDANGEGVECLRLLNEILADFDELLSEPQFQCIEKIKTIGETYMAASGIKPESQEKLATLNHICTMADFAMAMKRKLEDINLHSF---NNFAMKIGLNFGPVVAGVIGAHKPQYDIWGDTVNVASRMYSTGKD-NHIQVTKAMYEILSTRGYTFDCRGLVAVKGKGKMVTY 1038          

HSP 3 Score: 78.9518 bits (193), Expect = 8.149e-15
Identity = 72/311 (23.15%), Postives = 148/311 (47.59%), Query Frame = 1
Query:  508 MKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE--QGRQTNC-EKIGTLGDCYYCVSGCP------IPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR-YNFE 1398
            +KF ++ +++++YIL+        ++YV +   N     D        +  F E+  ++   +++F++ +T  +      I R     KL Q  E + +M+   +     +  I+P  V ++FL    N +    +Y Q  + V+++F++I  F    T + +N    + + LLN++   FDE     Q  C EKI T+G+ Y   SG        +   +H  +  +  + M R +   N     +  M++G++ G V+A +IG H+ ++D++   V +A+ + S+GK   + V++  + ++  R Y F+
Sbjct:  727 LKFSLLTVMAIVYILL--------VQYVAK---NSFLRHDFLQFCGLGSGHFIEWSDLSILIVVIFILALTA-HGYLHEQISRLDFLWKL-QATEEKKEMEQLREYNKKLLYNILPVHVAQHFLGHKANKNED--LYYQSCDKVAVMFSNICNFSDFYTELDANGEGVECLRLLNEILADFDELLSEPQFQCIEKIKTIGETYMAASGIKPESQEKLATLNHICTMADFAMAMKRKLEDINLHSFNNFAMKIGLNFGPVVAGVIGAHKPQYDIWGDTVNVASRMYSTGKDNHIQVTKAMYEILSTRGYTFD 1022          

HSP 4 Score: 55.0694 bits (131), Expect = 1.791e-7
Identity = 55/211 (26.07%), Postives = 89/211 (42.18%), Query Frame = 1
Query: 2446 RLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEI-----VGKKQSNEIIFSYAHAFANAGVIFACISNF--FSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAF-DMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYS 3054
            R  F  TR            N+  E LL +++P+ V  E+      G  Q+++    Y     N  ++FA I  F   SS         +  ++ L+ +   FD L  +   L+   IK + DCY   SGL     + A   H  I M  A  D    +R   + N+       +++G + G + +G++G  K  YD+W D V +A+ M S
Sbjct:  280 RQAFLETRRCIEARLTIQKENQNQERLLLSVLPRYVAMEMKDDIESGISQNSQFHKIYIQRHENVSILFADIEGFTVLSSQCT-----AQSLIKTLNELYARFDQLAVENHCLR---IKILGDCYYCVSGLPDPRPDHA---HSCIEMGLAMIDAISFVRDATQVNL------NMRVGVHMGKVHSGVLGLVKWQYDVWSDDVTIANHMES 473          
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Match: EDO42810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0C5])

HSP 1 Score: 150.214 bits (378), Expect = 9.332e-37
Identity = 105/367 (28.61%), Postives = 180/367 (49.05%), Query Frame = 1
Query:  751 RRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-------NRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHK-EDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGD------------ILEIMKEQVHGISGMIKTSVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTD 1791
            +++ + L+  ++ E +L + +  + Q   + +++P  V E          N     ++F  ++ +  +  SILFADIVGFT +SS  TA +L+  LN+L+  FD+   + +C +I  LGDCYYC+SG      +HA+  V MGL M   I    ++   + +NMRVGIH+G V+A ++G  +++F+ +S DV +AN +ES G  G VH+SE T   ++  +  E GD            I   +  Q   I    K    ++T  + P    +K+      +  N  + +     + ++     +D+EK +      +   +  + + L    ERTV   Q   +N +TL FK+  +EYQY     D
Sbjct:  294 KQRRSVLETRESLEVKLTLDAQNQQQRRLLLSVLPKHVAEEMTKDFEGDGNPALTDNAFKKLFIRTHDTCSILFADIVGFTELSSKCTAEQLIVTLNELFANFDKLAAKNHCLRIKILGDCYYCISGLD-DSCNHALCAVNMGLDMVEHIAHVREEKGVKSLNMRVGIHTGMVLAGVLGQRKWQFEAWSNDVTLANHMESGGIPGRVHISEPTLNSIKDYFEVEDGDGGSRDDYLADKKIKTYLITQAKPIWDGEKED--LDTLVLPPETSPEKRRSSSPPEVANDKDSIIGRDGNRRRTSSYMEDSEKSDASTTSNEKMLNKLLCEVLD---ERTVGKIQE-DMNPVTLRFKNYDVEYQYALEKQD 653          

HSP 2 Score: 145.206 bits (365), Expect = 3.425e-35
Identity = 82/195 (42.05%), Postives = 113/195 (57.95%), Query Frame = 1
Query: 2602 YAHAFANAGVIFACISNFFSSYYREDY--KGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLY-FDFKYRGTVAVKGKGDMTTF 3177
            Y+H++    V+FA I NF S +Y ED    GG   +RLL+ +I  FD +L  P +L +EKIKTI+  YM ASGL  + E+    ++L  ++ FA  +   L   N+++      F L++G   GPI AG+IG  KP YDIWG+TVNVASRM +T      IQ+       +K   F F YRG V VKGKG + T+
Sbjct:  890 YSHSYKRVSVMFASIPNF-SEFYSEDNINNGGVECIRLLNEVITDFDEVLADPRFLGVEKIKTISSTYMAASGLRPESEDAEESQNLVDIVDFALTLRDKLDFINQESF---NQFVLRVGICQGPIVAGVIGAKKPHYDIWGNTVNVASRMETTGK-AGCIQITAQTYETIKDKDFVFVYRGAVRVKGKGQLITY 1079          

HSP 3 Score: 68.5514 bits (166), Expect = 1.496e-11
Identity = 45/171 (26.32%), Postives = 84/171 (49.12%), Query Frame = 1
Query:  913 VYCQHFENVSILFADIVGFTMMSS----NKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTDHA------ISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR 1386
            +Y   ++ VS++FA I  F+   S    N    + + LLN++   FDE     R    EKI T+   Y   SG   P ++ A      +  V+  L +   +   N++      +RVGI  G ++A +IG  +  +D++   V +A+ +E++GKAG + ++  T+  ++ +
Sbjct:  889 LYSHSYKRVSVMFASIPNFSEFYSEDNINNGGVECIRLLNEVITDFDEVLADPRFLGVEKIKTISSTYMAASGLR-PESEDAEESQNLVDIVDFALTLRDKLDFINQESFNQFVLRVGICQGPIVAGVIGAKKPHYDIWGNTVNVASRMETTGKAGCIQITAQTYETIKDK 1058          

HSP 4 Score: 55.8398 bits (133), Expect = 1.096e-7
Identity = 55/240 (22.92%), Postives = 98/240 (40.83%), Query Frame = 1
Query: 2434 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFA--------NAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFK 3129
            ++  R +   TRE+          N+    LL +++PK V +E+    + +       +AF            ++FA I  F     +      E  +  L+ +   FD L  K   L+   IK + DCY   SGL+       S  H    +    DM  H+    E+   G  +  +++G + G + AG++G  K  ++ W + V +A+ M S       + + E   N +K YF+ +
Sbjct:  292 DRKQRRSVLETRESLEVKLTLDAQNQQQRRLLLSVLPKHVAEEMTKDFEGDGNPALTDNAFKKLFIRTHDTCSILFADIVGFTELSSK---CTAEQLIVTLNELFANFDKLAAKNHCLR---IKILGDCYYCISGLDD------SCNHALCAVNMGLDMVEHIAHVREEK--GVKSLNMRVGIHTGMVLAGVLGQRKWQFEAWSNDVTLANHMESGG-IPGRVHISEPTLNSIKDYFEVE 516          
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Match: EDO34267 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPS8])

HSP 1 Score: 113.62 bits (283), Expect = 2.502e-27
Identity = 74/212 (34.91%), Postives = 120/212 (56.60%), Query Frame = 1
Query:  838 IEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTD-HAISCVEMGLGM-----CRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNF---EKGDI-LEIMKEQVHGI 1443
            +E ++P  V +  L R ++      V  + F  VSI F+DIVGFT +S+  +  ++V LLNDLY  FD+  R+ +  K+ T+GD Y  VSG PI   + HA    +M L +        IV++   +K  + +RVGIHSG V+A ++GN   R+ +F   V  A+ +ES+G+A  +H+SEDT  ++     F    +G++ L++ + Q  G+
Sbjct:  116 LERMLPKPVTDQ-LKRGKS------VEAESFHEVSIYFSDIVGFTELSAESSPLQVVSLLNDLYTLFDDIIREYDVYKVETIGDAYMVVSGLPIRNGNRHAGEIAKMALHLIEAVQTEFIVRYKPTYK--LKLRVGIHSGPVVAGVVGNTMPRYCLFGDTVNTASRMESNGEALRIHISEDTKRILDQLGGFVVEGRGEVYLKVRRRQRDGV 318          

HSP 2 Score: 66.6254 bits (161), Expect = 1.101e-11
Identity = 61/240 (25.42%), Postives = 113/240 (47.08%), Query Frame = 1
Query: 2482 RNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKK-PIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNII---GNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVR 3189
            +  +     K  ++LL  ++PK V  ++   K         A +F    + F+ I  F +    E      V+L  L+ +   FD+++++  +Y    K++TI D YM+ SGL   +    + E  K+ +       H +     + I+     +   L++G + GP+ AG++G + P Y ++GDTVN ASRM S      ++++  H++   K   D    G   V+G+G++  +L VR
Sbjct:  101 KTGQLIEEKKKTDALLERMLPKPVTDQLKRGKSVE------AESFHEVSIYFSDIVGF-TELSAESSPLQVVSL--LNDLYTLFDDIIREYDVY----KVETIGDAYMVVSGLPIRNGNRHAGEIAKMAL-------HLIEAVQTEFIVRYKPTYKLKLRVGIHSGPVVAGVVGNTMPRYCLFGDTVNTASRMESNG---EALRI--HISEDTKRILD--QLGGFVVEGRGEV--YLKVR 311          
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 112.464 bits (280), Expect = 9.096e-26
Identity = 70/175 (40.00%), Postives = 99/175 (56.57%), Query Frame = 1
Query:  868 ENFLNR-IRNSDSFSLVY-----CQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRT-DHAISCVEMGLGMCRLIVKFNKDHK--EDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDT 1365
            EN LNR +  S +  LV+      ++F+ VSI F+DIVGFT +SS  T  ++V LLNDLY  FDE     +  K+ T+GD Y  VSG PI     HA     M L M R I  F   H+  + + +R+GIHSG  +A ++G    R+ +F   V  A+ +ES+G+A  +H+S  T
Sbjct:  309 ENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQVVDLLNDLYTLFDEIINNYDVYKVETIGDAYMVVSGLPIRNGHQHAGEIATMALHMLREIDSFKIRHRPNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPST 483          

HSP 2 Score: 74.7146 bits (182), Expect = 8.407e-14
Identity = 68/245 (27.76%), Postives = 109/245 (44.49%), Query Frame = 1
Query: 2476 EIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFD------FKYRGTVAVKGKGDMTTFLAVRS 3192
            E R ++     +  E+LL  ++P  V K++V  KQ     F     F +  V F  +S+  +     D         LL+ +   FD ++       + K++TI D YM+ SGL   +      +H   + T A  M   +  F  ++   N    L+IG + G   AG++G   P Y ++GDTVN ASRM S      ++++  H++   K   D       + RG V +KGKG   T+  V S
Sbjct:  295 EERTSQLADEKRKTENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQVVD---------LLNDLYTLFDEIINN---YDVYKVETIGDAYMVVSGLPIRN----GHQHAGEIATMALHMLREIDSFKIRHR-PNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNG---EALKI--HISPSTKRILDELGGYHIQKRGKVFLKGKGTWITYWLVGS 517          
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Match: crebbpb (adenylate cyclase 9 [Source:NCBI gene;Acc:101155516])

HSP 1 Score: 224.942 bits (572), Expect = 1.313e-59
Identity = 159/547 (29.07%), Postives = 259/547 (47.35%), Query Frame = 1
Query:  460 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMP------------SSVKENFLNRIRNSDSFSLVYC-----------------------QHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILE-----IMKEQVHG-----ISG------------MIKTSVPMNTYFVIPRQIX-----------XXXXXXXXXXQLNMANKLYSVPHSVQQILLNQ---------------DDNEKHNF---------------KRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIE 1800
            +SL + ++LL+Y++  ++    +LL LLY ++F S+G   +  V+  +      S+  ++           +    + +L    +  G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP              + +N   R   S + +++                         +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+S+ T   +  RY  E G ++E     ++ +Q+ G     ISG             +++SVP +    +P  +              K K     + + A      P +V  +L  Q                + EK  +               + ++ + + D   V  ++ED     ++F  PP+N+++L F +  +E  Y     +++E
Sbjct:  242 FSLCIEVLLLLYSVLHVRLYASVLLGLLYSVVFESLGWMHLSQVDGDQ-----SSEWATL----------TWLGPAKALLHLCAHAIGMHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPRLVADELMKQSDEDIGDNSAKRYSTSGAAAVISSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEITGCEKISTLGDCYYCVAGCPEPRPDHAYCCVEMGLGMIQAIEQFCQEKREMVNMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVHLSQATAKFLDDRYRREDGQVVERIGPSVVADQLKGQRTYLISGRRDELHSHCSCSRMESSVPEDHQCPMPSALTPDGAPPACTLPPDKTKDSSNLKCSPAASFGRSPKAVNGLLSPQLEALNNSQTSLCEMLQEKEKKTWSGAGMGMDHSALIPLRSKNFRERSDAHFVDVIKED-SLMKDYFYKPPLNKLSLTFLERSLESAYRISYQEEVE 770          

HSP 2 Score: 195.282 bits (495), Expect = 3.393e-50
Identity = 117/265 (44.15%), Postives = 161/265 (60.75%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEH--LKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFLAVRSHFVSPM 3210
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++       ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN+     A+  H  L+ L  FA +M   +  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  +QV E     L  + ++F YRGTV VKGKG M TFL  +S    P+
Sbjct:  997 REFEVSYRLHYHGNVEADQHRIKIQNMRDQADWLLRNIIPIHVAEQL-------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFN-KNMLG-FGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RVQVSEESYCVLSGMDYEFDYRGTVNVKGKGQMKTFLYPKSSDSGPV 1250          

HSP 3 Score: 71.2478 bits (173), Expect = 5.308e-12
Identity = 63/215 (29.30%), Postives = 107/215 (49.77%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRTDHA--ISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLV 1377
            N EA   R+K+Q+ ++ Q  W+   I+P  V E    ++  S      Y ++ +NV ++FA IV F+     S +   +   +LN+L   FDE  R+    N EKI T+G  Y   SG     C      HA   +  E  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++++G    V VSE+++ ++
Sbjct: 1010 NVEADQHRIKIQN-MRDQADWLLRNIIPIHVAEQL--KVTQS------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFNKNMLGFGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRVQVSEESYCVL 1215          
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Match: crebbpb (adenylate cyclase 9 [Source:NCBI gene;Acc:101155516])

HSP 1 Score: 224.172 bits (570), Expect = 1.779e-59
Identity = 156/531 (29.38%), Postives = 252/531 (47.46%), Query Frame = 1
Query:  457 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMP------------SSVKENFLNRIRNSDSFSLVYC-----------------------QHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILE-----IMKEQVHG-----ISG------------MIKTSVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSV---PHSVQQILLNQ---------------DDNEKHNF---------------KRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQY 1773
             +SL + ++LL+Y++  ++    +LL LLY ++F S+G   +  V+  +      S+  ++           +    + +L    +  G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP              + +N   R   S + +++                         +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+S+ T   +  RY  E G ++E     ++ +Q+ G     ISG             +++SVP +    +P  +             +      S    P +V  +L  Q                + EK  +               + ++ + + D   V  ++ED     ++F  PP+N+++L F +  +E  Y
Sbjct:  221 TFSLCIEVLLLLYSVLHVRLYASVLLGLLYSVVFESLGWMHLSQVDGDQ-----SSEWATLT----------WLGPAKALLHLCAHAIGMHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPRLVADELMKQSDEDIGDNSAKRYSTSGAAAVISSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEITGCEKISTLGDCYYCVAGCPEPRPDHAYCCVEMGLGMIQAIEQFCQEKREMVNMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVHLSQATAKFLDDRYRREDGQVVERIGPSVVADQLKGQRTYLISGRRDELHSHCSCSRMESSVPEDHQCPMPSALTPDGAPPACTLPPDKTKVTASFGRSPKAVNGLLSPQLEALNNSQTSLCEMLQEKEKKTWSGAGMGMDHSALIPLRSKNFRERSDAHFVDVIKED-SLMKDYFYKPPLNKLSLTFLERSLESAY 733          

HSP 2 Score: 194.512 bits (493), Expect = 4.388e-50
Identity = 117/265 (44.15%), Postives = 161/265 (60.75%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEH--LKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFLAVRSHFVSPM 3210
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++       ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN+     A+  H  L+ L  FA +M   +  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  +QV E     L  + ++F YRGTV VKGKG M TFL  +S    P+
Sbjct:  951 REFEVSYRLHYHGNVEADQHRIKIQNMRDQADWLLRNIIPIHVAEQL-------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFN-KNMLG-FGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RVQVSEESYCVLSGMDYEFDYRGTVNVKGKGQMKTFLYPKSSDSGPV 1204          

HSP 3 Score: 71.2478 bits (173), Expect = 4.989e-12
Identity = 66/223 (29.60%), Postives = 110/223 (49.33%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRTDHA--ISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTF-LLVRHRYNFE 1398
            N EA   R+K+Q+ ++ Q  W+   I+P  V E    ++  S      Y ++ +NV ++FA IV F+     S +   +   +LN+L   FDE  R+    N EKI T+G  Y   SG     C      HA   +  E  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++++G    V VSE+++ +L    Y F+
Sbjct:  964 NVEADQHRIKIQN-MRDQADWLLRNIIPIHVAEQL--KVTQS------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFNKNMLGFGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRVQVSEESYCVLSGMDYEFD 1177          
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Match: crebbpb (adenylate cyclase 9 [Source:NCBI gene;Acc:101155516])

HSP 1 Score: 222.246 bits (565), Expect = 1.003e-58
Identity = 130/369 (35.23%), Postives = 200/369 (54.20%), Query Frame = 1
Query:  460 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMP------------SSVKENFLNRIRNSDSFSLVYC-----------------------QHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILE-----IMKEQVHG 1440
            +SL + ++LL+Y++  ++    +LL LLY ++F S+G   +  V+  +      S+  ++           +    + +L    +  G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP              + +N   R   S + +++                         +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+S+ T   +  RY  E G ++E     ++ +Q+ G
Sbjct:  242 FSLCIEVLLLLYSVLHVRLYASVLLGLLYSVVFESLGWMHLSQVDGDQ-----SSEWATL----------TWLGPAKALLHLCAHAIGMHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPRLVADELMKQSDEDIGDNSAKRYSTSGAAAVISSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEITGCEKISTLGDCYYCVAGCPEPRPDHAYCCVEMGLGMIQAIEQFCQEKREMVNMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVHLSQATAKFLDDRYRREDGQVVERIGPSVVADQLKG 593          

HSP 2 Score: 194.897 bits (494), Expect = 4.361e-50
Identity = 117/265 (44.15%), Postives = 161/265 (60.75%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEH--LKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFLAVRSHFVSPM 3210
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++       ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN+     A+  H  L+ L  FA +M   +  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  +QV E     L  + ++F YRGTV VKGKG M TFL  +S    P+
Sbjct: 1032 REFEVSYRLHYHGNVEADQHRIKIQNMRDQADWLLRNIIPIHVAEQL-------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFN-KNMLG-FGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RVQVSEESYCVLSGMDYEFDYRGTVNVKGKGQMKTFLYPKSSDSGPV 1285          

HSP 3 Score: 70.8626 bits (172), Expect = 6.948e-12
Identity = 63/215 (29.30%), Postives = 107/215 (49.77%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRTDHA--ISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLV 1377
            N EA   R+K+Q+ ++ Q  W+   I+P  V E    ++  S      Y ++ +NV ++FA IV F+     S +   +   +LN+L   FDE  R+    N EKI T+G  Y   SG     C      HA   +  E  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++++G    V VSE+++ ++
Sbjct: 1045 NVEADQHRIKIQN-MRDQADWLLRNIIPIHVAEQL--KVTQS------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFNKNMLGFGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRVQVSEESYCVL 1250          
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Match: adcy8 (adenylate cyclase 8 [Source:NCBI gene;Acc:101161086])

HSP 1 Score: 198.749 bits (504), Expect = 1.647e-51
Identity = 97/248 (39.11%), Postives = 150/248 (60.48%), Query Frame = 1
Query:  679 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDS------FSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKG 1404
            +T Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +N + N +       F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K D++MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +H+S+     +   Y  E+G
Sbjct:  297 VTAQAVLFLCMNTAGIFISYLSDRAQRQAFLETRRCIEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRPDHAHCCVEMGLSMIKTIRYVRSRTKHDIDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKAALDCLNGDYEVEEG 544          

HSP 2 Score: 140.198 bits (352), Expect = 3.136e-33
Identity = 95/259 (36.68%), Postives = 135/259 (52.12%), Query Frame = 1
Query: 2434 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFLAVRSHFV 3201
            E   RL+F    +A+    E     +  E++L NI+P  V +  + K + NE +  Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ D ++      HL  L  FA  ++  ++  N+ +      F L+IG   G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE     LK   F F+YRG + VKG  +      +R+HF+
Sbjct:  765 EYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEKDRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPDKQQCEDKWGHLCELADFAIALNESIQEINKHSF---NNFELRIGMAHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGKIQVPEDTYLILKDRGFAFEYRGEIYVKGISEQEG--KIRTHFL 1015          

HSP 3 Score: 100.908 bits (250), Expect = 4.410e-21
Identity = 80/291 (27.49%), Postives = 142/291 (48.80%), Query Frame = 1
Query:  847 IMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGF----TMMSSNKTAAKLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRTD------HAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHR-YNFE-KGDILEIMKEQVHGIS---GMIKT-----SVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNE-----KHNFKRR 1635
            I+PS V  +FL + R+++    +Y Q ++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG    +        H     +  + +   I + NK    +  +R+G+  G V+A +IG  + ++D++   V +A+ ++S+G +G + V EDT+L+++ R + FE +G+I       V GIS   G I+T      V  N   + PR+I  +         L     + S+    Q+ +LN+++N       H++ RR
Sbjct:  799 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPDKQQCEDKWGHLCELADFAIALNESIQEINKHSFNNFELRIGMAHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGKIQVPEDTYLILKDRGFAFEYRGEIY------VKGISEQEGKIRTHFLQGRVQPNPLILQPRKITGQYSLAAVVLGL-----VQSLNRQKQKQILNENNNSGIMKGHHHYNRR 1075          
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Match: adcy9 (adenylate cyclase type 9 [Source:NCBI gene;Acc:101163149])

HSP 1 Score: 198.364 bits (503), Expect = 3.163e-51
Identity = 120/261 (45.98%), Postives = 159/261 (60.92%), Query Frame = 1
Query: 2425 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLN----SDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLK-LYFDFKYRGTVAVKGKGDMTTFLAVRS 3192
            RE E + RL+++   EA+   A+       AE LL NIIP  V  ++       ++  SY+    + GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN    ++ E+     HL+ L  FA +M   L  FN +N++G F F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  +QV E     L  +  DF+YRGTV VKGKG M TFL  +S
Sbjct: 1064 REFEVSYRLHYHGNVEADKHRAKIQTMRDQAEWLLGNIIPIHVADQL-------KVTQSYSKNHDSVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPEFKSVEKIKTIGSTYMAASGLNVQQLAETEDDCPHAHLRALFNFALEMMGVLDDFN-KNMLG-FGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RVQVSEESHTVLSDMGLDFEYRGTVNVKGKGQMRTFLYPKS 1313          

HSP 2 Score: 193.356 bits (490), Expect = 1.496e-49
Identity = 95/166 (57.23%), Postives = 116/166 (69.88%), Query Frame = 1
Query:  937 VSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQV 1434
            VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++  E V+MRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +  RY  E G + E   + V
Sbjct:  443 VSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEITCCEKISTLGDCYYCVAGCPEPRPDHAYCCVEMGLGMIQAIEQFCQETCETVDMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVHLSEATSHFLDDRYLMEDGRVAERAGQSV 608          

HSP 3 Score: 58.9214 bits (141), Expect = 2.968e-8
Identity = 59/216 (27.31%), Postives = 101/216 (46.76%), Query Frame = 1
Query:  784 NAEA---RLKMQSAIKIQIYWIEA-IMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMM--SSNKTAAKLVYLLNDLYNRFDEQGRQT---NCEKIGTLGDCYYCVSG------------CPIPRTDHAISCVEMGLGMCRLIVKFNKDHKE-DVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDT 1365
            N EA   R K+Q+ ++ Q  W+   I+P  V +    ++  S      Y ++ ++V ++FA IV F+     S +   +   +LN+L   FDE  R+    + EKI T+G  Y   SG            CP     H  +     L M  ++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    V VSE++
Sbjct: 1077 NVEADKHRAKIQT-MRDQAEWLLGNIIPIHVADQL--KVTQS------YSKNHDSVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPEFKSVEKIKTIGSTYMAASGLNVQQLAETEDDCP---HAHLRALFNFALEMMGVLDDFNKNMLGFGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRVQVSEES 1280          
BLAST of Adenylate cyclase type vs. Planmine SMEST
Match: SMESG000009033.1 (SMESG000009033.1)

HSP 1 Score: 1890.93 bits (4897), Expect = 0.000e+0
Identity = 1010/1010 (100.00%), Postives = 1010/1010 (100.00%), Query Frame = 1
Query:  217 MKVLILYCYCEIVSSHISERGIIFRPXXXXXXXXXXXXXXXXTVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKXXXXXXXXXXXXXXXVILLAAYVMLPKSFGFRFYSPXXXXXXXXXXXXXXXXXXXXKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYXXXXXXXXXXXXXXNVISTSLSSLVKHITTGSYTAIAICLCFYAPTKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVRSHFVSPMFLDRVPFSSLEV 3246
            MKVLILYCYCEIVSSHISERGIIFRPILALVVFCIFFIIFAATVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQIKKKKHKHKHKKQLNMANKLYSVPHSVQQILLNQDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKLALFLDSLASLFYASVILLAAYVMLPKSFGFRFYSPIIYGSGYFFIIIIAFISLIYKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYASAFFSIALFALISNVISTSLSSLVKHITTGSYTAIAICLCFYAPTKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFQLLQICLLIYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVRSHFVSPMFLDRVPFSSLEV
Sbjct:    1 MKVLILYCYCEIVSSHISERGIIFRPILALVVFCIFFIIFAATVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQIKKKKHKHKHKKQLNMANKLYSVPHSVQQILLNQDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKLALFLDSLASLFYASVILLAAYVMLPKSFGFRFYSPIIYGSGYFFIIIIAFISLIYKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYASAFFSIALFALISNVISTSLSSLVKHITTGSYTAIAICLCFYAPTKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFQLLQICLLIYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVRSHFVSPMFLDRVPFSSLEV 1010          
BLAST of Adenylate cyclase type vs. Planmine SMEST
Match: SMESG000009035.1 (SMESG000009035.1)

HSP 1 Score: 1538.47 bits (3982), Expect = 0.000e+0
Identity = 814/1034 (78.72%), Postives = 905/1034 (87.52%), Query Frame = 1
Query:  100 MIRLKLEEVSKVMSLRSSILSDYFYTLMTNHNIKSIRNGMKVLILYCYCEIVSSHISERGIIFRPXXXXXXXXXXXXXXXXTVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIP-RQIXXXXXXXXXXXQLNMANKLYSVPHSVQQILLNQDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKXXXXXXXXXXXXXXXVILLAAYVMLPKSFGFRFYSPXXXXXXXXXXXXXXXXXXXXKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYXXXXXXXXXXXXXXNVISTSLSSLVKHITTGSYTAIAICLCFYAPTKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKK--QSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVRS 3192
            M+RLKLEEVSKVMSLRSSILS+YF+TLMTNHNIKSIRNGMKVLILYCYCE+VSSHISERG+++RPILAL  FCI+F IFA+TV VK++ T++RFAS MVIICM +TV LGTD  ELMELNYSL++LIIL+MYTLFRMKFM+VMLLS +YILIFVSIGNFRIKY++  +LN+S    L++IR  R+ I ++YY++ GQCILL LMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL RIRN+D FSLVYC+ FENVSILFADIVGFTMMSSNKTAA+LVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPR DHAISCVEMGLGMCRLIVKFNKDHKE+VNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSG+AGFVH+SEDT+LLVRH Y FE G+IL IMKEQVHGISGMI+ SVP+ TYFVIP +   K+K + +     N +NKL       ++I     D  K+ FK++D K+KGDLKIVKCLQ+DPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIK ALF+DS+AS+ Y + IL AAYVM+P++ GF+FYSPIIY +GY +I+IIAFISL+YKSEI N+ LRK Y F+SHPL+RL L VY+SSLPSI V SL+    +  +YHY +A+ S+ LFALI NVISTS  SL+KHITT  +T   I L        E      + C   L   +N+  +RI+C FSFQL QICLL+YYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKK   SNE+ FSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMH+HLRLFNEQNI+G +TFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE+V  KLKLYFDFKYRGT++VKGKG+M T+L VRS
Sbjct:    1 MLRLKLEEVSKVMSLRSSILSEYFHTLMTNHNIKSIRNGMKVLILYCYCEVVSSHISERGVLYRPILALFAFCIYFFIFASTVKVKKSVTMIRFASIMVIICMIHTVALGTDPMELMELNYSLIILIILMMYTLFRMKFMIVMLLSSMYILIFVSIGNFRIKYIDTADLNISAAPILQTIRGRRSGIVDKYYFVCGQCILLLLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNTSNKL---AEKSRKIF---SDKAKNLFKKKDEKFKGDLKIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPIIYVTGYIYIVIIAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRS 1028          
BLAST of Adenylate cyclase type vs. Planmine SMEST
Match: SMESG000009036.1 (SMESG000009036.1)

HSP 1 Score: 1258.43 bits (3255), Expect = 0.000e+0
Identity = 682/1039 (65.64%), Postives = 832/1039 (80.08%), Query Frame = 1
Query:  100 MIRLKLEEVSKVMSLRSSILSDYFYTLMTNHNIKSIRNGMKVLILYCYCEIVSSHISERGIIFRPXXXXXXXXXXXXXXXXTVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQIXXXXXXXXXXXQ-LNMANKLYSVPHSVQQILLNQDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKXXXXXXXXXXXXXXXVILLAAYVMLPKSFGFRFYSPXXXXXXXXXXXXXXXXXXXXKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYXXXXXXXXXXXXXXNVISTSLSSLVKHITTGSYTAIAICLCFYAP-----TKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKK-QSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVRSH 3195
            M+R K+  + K+ SLRS+ILS YFYTLMTNHNIKSIRNGMKVLI+Y Y E+VSSHISERG+IFRPILAL+ FCIFF+I+  T+ V++T T+ R AS MVI+CMTYTV+LGTD  E+ME++YSL +LIIL+MYTLFR KF++ +LLS++YILIFVSIGN+R+K+VE   ++V   + LE  R  + +I   + +I  QC L FL Y+TGLYLR FNSIRRKSAFLKLAQNA+AR+KMQSAI++QIYWIEAIMPSSVKE FL RIR++D FSLVYCQ+F+NVSILFADIVGFT MS+NKTAAKLVYLLNDLYNRFD QGRQTNCEKIGTLGDCYYCVSGCPIPR DHAI+CVEMGLGMCR+I+KFNKDHKE VNMRVGIHSGRVIAAIIGNHRFRFDVFS DV+IANSLESSGK G VH+SEDT++LVRH Y   +G+ LEI KE+VHGISGM++  VPM+TYFVIP  +  K           N++N    +    +++L+   D +  ++KR+D K K DLKIV+ LQEDPER++EFF+NPPI+  +  FKD +IEYQYL+HTTDQIEP++I +IK+A F+DS+ASL YA++ILL + +M+P +  F+ YSP+IY SG+ F  I A+IS  YKS+I N   R  Y FWSHPLSRL L VY+SSLPS+LV+S ++K +L   Y +  A+ S+ +FALI N I T+  SL+KHITT S+  + I L  + P     +K E++L    NCS  +    +   +R+QC F+FQLL +CL+IYYL RENEK  R+NFYATREA+IRNAEA  A +IAESLLYNIIPK VF +I  +K Q  E+ F+YAHAFANAGV+FACISNFFSSYYREDYKGGEVAL+LLHTIICTFDNLL KP Y  LEKIKTINDCYM+ASG+N D   +  DEHL  LMTFA DMH+HL+LFNEQNI+G  TFYLKIG+NFGP+TAGIIGT+KPLYDIWGDTVNVASRMYST+P  S+IQVP++V  +LK  F FKYRG V+VKGKG+M T+L +RS+
Sbjct:    1 MLRAKIANLRKITSLRSAILSAYFYTLMTNHNIKSIRNGMKVLIIYWYFEVVSSHISERGVIFRPILALIAFCIFFLIYVLTIRVQKTNTMTRMASLMVILCMTYTVILGTDILEIMEIHYSLSLLIILMMYTLFRFKFLITVLLSIVYILIFVSIGNYRLKFVENINMSVFYTTPLEISRAMKIEIKNHHSFIVAQCGLFFLAYITGLYLRCFNSIRRKSAFLKLAQNAQARMKMQSAIQVQIYWIEAIMPSSVKEQFLKRIRDNDMFSLVYCQNFDNVSILFADIVGFTKMSANKTAAKLVYLLNDLYNRFDVQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAINCVEMGLGMCRIIMKFNKDHKEKVNMRVGIHSGRVIAAIIGNHRFRFDVFSNDVVIANSLESSGKPGLVHISEDTYVLVRHAYAVNEGEALEIKKEEVHGISGMMQKIVPMSTYFVIPDSVPYKLKIKDRAVHDFNVSNTTIKISKDTKKLLIK--DAKAESYKRKDAKLKEDLKIVQMLQEDPERSIEFFKNPPIHNFSQTFKDREIEYQYLYHTTDQIEPLKIDTIKVATFIDSVASLVYATIILLISLLMIPNNVRFKLYSPLIYASGFVFTFIAAYISFFYKSQIRNPVARLIYAFWSHPLSRLFLSVYISSLPSLLVLSFFDKEVLHGHYQFMIAYLSLTIFALIGNTICTASVSLIKHITTLSFAMVPIILVVFQPFEIDSSKEEMSL----NCSDLIKNKVDFSKVRMQCNFTFQLLSVCLVIYYLTRENEKTTRINFYATREADIRNAEAIRAKRIAESLLYNIIPKHVFADISARKTQEKEMSFTYAHAFANAGVVFACISNFFSSYYREDYKGGEVALKLLHTIICTFDNLLHKPAYSLLEKIKTINDCYMIASGINVDSSLLKEDEHLIALMTFALDMHYHLKLFNEQNIVGKNTFYLKIGFNFGPVTAGIIGTTKPLYDIWGDTVNVASRMYSTSPSGSTIQVPDYVCVRLKDSFQFKYRGVVSVKGKGEMITYLVIRSY 1033          
BLAST of Adenylate cyclase type vs. Planmine SMEST
Match: SMESG000050966.1 (SMESG000050966.1)

HSP 1 Score: 1030.39 bits (2663), Expect = 0.000e+0
Identity = 568/1037 (54.77%), Postives = 758/1037 (73.10%), Query Frame = 1
Query:  100 MIRLKLEEVSKVMSLRSSILSDYFYTLMTNHNIKSIRNGMKVLILYCYCEIVSSHISERGIIFRPXXXXXXXXXXXXXXXXTVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVST-VSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQIXXXXXXXXXXXQLNMA---NKLYSVPHSVQQILLNQDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKXXXXXXXXXXXXXXXVILLAAYVMLPKSFGFRFYSPXXXXXXXXXXXXXXXXXXXXKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYXXXXXXXXXXXXXXNVISTSLSSLVKHITTGSYTAIAICLCFYAPTKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKQSNEII-FSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVRSH 3195
            M++ K+E+V +V+SL S+  S+YF+ LMT HNIKSIRNG KVLI Y  CEI+SSH+++R +I++PI+AL+ F +F   F  TVNV++T+T++  AS MV++CM+Y+V++GTD+ E+ME  +SL+V +IL+MYTLF ++F++ MLLS++YILIF+S  N+R+   E +E N++   S L  +R     I  +YY + GQ IL F++Y+TGLYLR FNSIRRKSAFLKLAQNA+A++KM SAIK+QIYWIEAIMP++V+  FL  IR+ D F+L YC+ F+NVSILFADIVGFT MSSNKTA +LVYLLNDLYNRFD+ G+  NCEKI TLGDCYYCVSGCP+PR+DHA+ CVEMGLGMC++I+ FN+ HKE+VNMRVG+HSGRVIAAIIGN RFRFDV+S DV IAN+LESSGK G VH+S+ TF LV H Y F +G+ L + KE+  G+ G   T VPM TYFV     +  ++ ++     + +   N+  S      QI +++   E   FK RD K K DL++++ LQ DPERTV+ FQNPP+N +TL FKD +IE  + FH  DQI  I I S+K+ALF D++A    ++ ++++A+ ++ +S G    + ++Y SG   I+I  +I L+YKSEIP+   RK +  +SHPLSRL +G+Y+S LP++LV +LY+   L  +Y Y   +F++  FALISN I T   S++K ++T + TA ++ L    PTK E+++Y + +C  +L +   +   +++  FSFQL QICLL+Y+L RENEKNIR+ FYA+REAEIRN EA    K+AE  LYNIIPK VF +I G     +   FSYA    NAGV+FA I NFFS YYREDYK GE AL++LH IIC FDNLL+ P+Y  LEKIKT+NDCYM+ASGLN+  +    D HL  LM F+FD+ + L  +NE+NI+GN  FYLKIGYNFGP+TAGIIGTSKPLYDIWGDTVNVASRMYSTAP    IQV ++V   L  +F F+YRG V +KGKGD+ T+LA+R +
Sbjct:    1 MLKQKVEKVLRVLSLNSTAFSEYFHMLMTVHNIKSIRNGTKVLIFYFCCEIISSHMADRTVIYKPIVALIAFIVFVCFFGLTVNVEKTSTMISLASIMVVLCMSYSVIIGTDADEMMEARFSLMVAVILMMYTLFHLRFLITMLLSIVYILIFLSAVNYRLGLNESEEHNITKFTSALRKVRHSEHDIPNKYYMLIGQIILFFMVYLTGLYLRIFNSIRRKSAFLKLAQNAQAKMKMDSAIKVQIYWIEAIMPAAVRGEFLESIRSKDLFNLGYCKQFKNVSILFADIVGFTAMSSNKTAKQLVYLLNDLYNRFDDFGKIMNCEKIATLGDCYYCVSGCPVPRSDHALCCVEMGLGMCKMILAFNRLHKEEVNMRVGVHSGRVIAAIIGNLRFRFDVYSNDVSIANALESSGKPGKVHISKKTFKLVCHAYTFIEGEKLMVTKERQFGLEGFAPTLVPMPTYFVESYSTEFDEYFNRKVIDESKSYERNEEKSNESKPSQIGIDKSALE---FKIRDEKMKNDLELIRHLQSDPERTVQCFQNPPLNPLTLTFKDTEIESHFQFHVVDQIREININSVKVALFFDAIACQVCSTFVIISAFFLIIESGGISKTTTLVYMSGIPLIMIAGWICLVYKSEIPSEIFRKIFVIFSHPLSRLSIGIYISVLPTLLVHTLYDAEKLYNNYEYTVGYFTLTFFALISNCIFTISYSVLKQMSTAACTAGSLYLLL-QPTK-EMDIYEYSSCVDFLVDYVEIQTQKLKYFFSFQLFQICLLLYFLTRENEKNIRIFFYASREAEIRNDEARRERKVAEKFLYNIIPKYVFFQITGSADDKKSTKFSYAKTIVNAGVVFASIGNFFSGYYREDYKRGESALKVLHNIICGFDNLLRLPLYKGLEKIKTVNDCYMMASGLNASSKAYRED-HLYKLMLFSFDLLNQLAYYNEENIVGNKHFYLKIGYNFGPVTAGIIGTSKPLYDIWGDTVNVASRMYSTAP-AGKIQVSDYVHKYLATHFLFEYRGKVFMKGKGDVETYLALRPY 1030          
BLAST of Adenylate cyclase type vs. Planmine SMEST
Match: SMESG000050971.1 (SMESG000050971.1)

HSP 1 Score: 988.408 bits (2554), Expect = 0.000e+0
Identity = 556/1044 (53.26%), Postives = 747/1044 (71.55%), Query Frame = 1
Query:  100 MIRLKLEEVSKVMSLRSSILSDYFYTLMTNHNIKSIRNGMKVLILYCYCEIVSSHISERGIIFRPXXXXXXXXXXXXXXXXTVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNV----STVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIPRQIXXXXXXXXXXXQLNMANKLYS---VPHSVQQILLNQDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKXXXXXXXXXXXXXXXVILLAAYVMLPKSFGFRFYSPXXXXXXXXXXXXXXXXXXXXKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYXXXXXXXXXXXXXXNVISTSLSSLVKHITTGSYTAIAICLCFYAPTKRELNL--YSFDNCSIYLTEPKNMFILRIQCIFSFXXXXXXXXXXXXARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVG---KKQSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVRSH 3195
            M   K++++ KVMSL S+  S+YF+ LMT HN+KSIRNG KV+I+Y   EI+ SH+ ER IIF PI+AL+ FCIF +I+  T NV  + T++  AS MV+ CMTY+V+L +D+ E++E   SL+V  IL+M+TLF ++F++ ++LS++YILIF+S  N+R+K      L      ++++ L  +R+    I  +Y  +  +C+L F +Y+ GLYLRFFNSIRRKSAFLKLAQNA+A++KM+SAI++QIYWIEAIMPS+VK  FL  +R+ D F+LVYC+ F++VSILFADIVGFT MSSNKTA +LVYLLNDLYNRFD+ G   NCEKI TLGDCYYCVSGCP+PR+DHA+ CVEMGLGMC++I+ FNK HKE+VNMRVG+HSGRVIAAIIGN RFRFDV+S DV IAN+LESSGK G VH+SE TF LV H Y F +G+ L I KE+  G+ G  +T VP+ TYFV   + +  ++ ++     +   + YS   V   V + ++   D     FK RD K K DL +++ LQ DPE+TV+FF +PPIN  TL F D +IE  + FH+ D +  I I S+K+AL  D++A   Y++ IL+++YV++ KS G    + ++Y SG    +I ++I L+YKSEIP+  +R  +  ++HP+SRL +G+Y+SS P+ LV +LYN+  +   Y Y   +F++  F+LISN I T   S++K ++T   TA ++    Y   K +L+   Y   +C  +L       I ++Q  + FQLLQ+CLLIYYL +ENEKNIR+ FYA+REAEIRN EA    K+AE  LYNIIPK VF +I G   +K++N+  FSYAH   NAGV+FACISNFFS YYRED+K G  AL++LH IIC FDNLL+ P+Y  LEKIKT+NDCYM+ASGLN+  +    D HL  LM F+FD+ + L  +NE+NI+GN  FYLKIGYNFGP+TAGIIGT+KPLYDIWGDTVNVASRMYSTAP    IQV ++V   L  +F F+YRG+V +KGKGD+ T+LAV+ +
Sbjct:    1 MFDHKIQKILKVMSLHSTAFSEYFHMLMTVHNVKSIRNGTKVIIIYFCSEIIVSHMGERSIIFGPIVALIAFCIFALIYILTANVDNSDTMISMASVMVVFCMTYSVILASDNEEMIEGRLSLMVANILMMFTLFHLRFLITLVLSIVYILIFMSAVNYRLKTDIPHNLTRGHLRNSLNTLAVVRQEDHHIAHKYNLLVAECLLFFAVYLVGLYLRFFNSIRRKSAFLKLAQNAQAKMKMESAIEVQIYWIEAIMPSAVKTEFLQNVRHKDFFNLVYCRQFKDVSILFADIVGFTAMSSNKTAKQLVYLLNDLYNRFDDFGNIMNCEKIATLGDCYYCVSGCPVPRSDHALCCVEMGLGMCKMIMTFNKVHKEEVNMRVGVHSGRVIAAIIGNLRFRFDVYSNDVSIANALESSGKPGKVHISEKTFKLVCHAYTFVEGEKLMIKKERKFGLEGFAQTLVPIPTYFVESVETEYDEYFNRINVNESKIYERYSEKLVESPVPETVI---DKSSLAFKMRDEKMKNDLDLIRHLQSDPEKTVQFFHSPPINTFTLTFTDTEIESHFQFHSNDHLREINIDSVKIALLFDAIACQVYSTFILISSYVLVIKSSGISKSTSLMYLSGLIMTLISSWICLVYKSEIPSDIIRGIFIIFNHPVSRLFIGIYVSSFPTFLVYTLYNQTKMYDEYEYTVEYFTLIFFSLISNCIFTGSYSVIKQMSTAVCTATSL----YILLKPKLDPIDYEISSCQEFLINILQYKIQKLQYFYGFQLLQVCLLIYYLTQENEKNIRIFFYASREAEIRNDEARRERKVAERFLYNIIPKYVFFQITGSTDEKKTNK--FSYAHTIPNAGVVFACISNFFSGYYREDFKRGLNALKVLHNIICGFDNLLRLPLYKGLEKIKTVNDCYMMASGLNASSKAYRED-HLYKLMLFSFDLLNQLAHYNEENIVGNKHFYLKIGYNFGPVTAGIIGTTKPLYDIWGDTVNVASRMYSTAP-AGKIQVSDYVHKYLATHFQFEYRGSVFMKGKGDVETYLAVKPY 1033          
The following BLAST results are available for this feature:
BLAST of Adenylate cyclase type vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADCY92.250e-5936.06adenylate cyclase 9 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY15.187e-5338.95adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY15.187e-5338.95adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY82.589e-5239.92adenylate cyclase 8 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY82.804e-5239.92adenylate cyclase 8 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acy-11.784e-5835.85Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:Q19... [more]
acy-29.245e-3945.68Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:O16... [more]
acy-42.218e-3632.52Adenylate cyclase [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
gcy-133.291e-2436.21Receptor-type guanylate cyclase gcy-13 [Source:Un... [more]
gcy-281.488e-2335.98Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ac13E1.813e-5741.46gene:FBgn0022710 transcript:FBtr0074073[more]
Ac13E1.813e-5741.46gene:FBgn0022710 transcript:FBtr0100142[more]
Ac13E1.827e-5741.46gene:FBgn0022710 transcript:FBtr0332497[more]
rut1.851e-4730.61gene:FBgn0003301 transcript:FBtr0333655[more]
rut1.851e-4730.61gene:FBgn0003301 transcript:FBtr0340467[more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adcy92.181e-5536.14adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-0502... [more]
CR339059.24.019e-5242.91pep chromosome:GRCz11:CHR_ALT_CTG3_1_31:9711779:97... [more]
CR339059.14.019e-5242.91pep chromosome:GRCz11:3:9737490:9738985:-1 gene:EN... [more]
adcy91.258e-4845.10adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-0502... [more]
adcy1a1.089e-4738.96adenylate cyclase 1a [Source:ZFIN;Acc:ZDB-GENE-070... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADCY98.867e-5735.16adenylate cyclase 9 [Source:NCBI gene;Acc:10012644... [more]
ADCY12.591e-4940.57adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:... [more]
ADCY14.500e-4940.57adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:... [more]
ADCY14.569e-4940.57adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:... [more]
crabp21.188e-4836.75cellular retinoic acid binding protein 2 [Source:X... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adcy91.386e-6036.34adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108... [more]
Adcy91.386e-6036.34adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108... [more]
Adcy91.018e-5841.70adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108... [more]
Adcy85.974e-5239.92adenylate cyclase 8 [Source:MGI Symbol;Acc:MGI:134... [more]
Adcy86.071e-5239.92adenylate cyclase 8 [Source:MGI Symbol;Acc:MGI:134... [more]
back to top
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51830|ADCY9_MOUSE9.693e-6036.34Adenylate cyclase type 9 OS=Mus musculus OX=10090 ... [more]
sp|O60503|ADCY9_HUMAN1.080e-5836.06Adenylate cyclase type 9 OS=Homo sapiens OX=9606 G... [more]
sp|Q9DGG6|ADCY9_CHICK5.462e-5837.64Adenylate cyclase type 9 OS=Gallus gallus OX=9031 ... [more]
sp|P98999|ADCY9_XENLA3.766e-5634.84Adenylate cyclase type 9 OS=Xenopus laevis OX=8355... [more]
sp|P40145|ADCY8_HUMAN1.243e-5139.92Adenylate cyclase type 8 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Adenylate cyclase type vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NRP70.000e+037.96Adenylate cyclase 9 OS=Paragonimus westermani OX=3... [more]
A0A183B2960.000e+041.26Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A504YI320.000e+039.32Adenylate cyclase 9 OS=Fasciola gigantica OX=46835... [more]
A0A2H1CFY20.000e+038.78Adenylate cyclase 9 OS=Fasciola hepatica OX=6192 G... [more]
A0A4E0RSE28.050e-17736.79Adenylate cyclase type 9 OS=Fasciola hepatica OX=6... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adcy92.681e-5837.74adenylate cyclase 9 [Source:NCBI gene;Acc:10302243... [more]
adcy93.292e-5635.28adenylate cyclase 9 [Source:NCBI gene;Acc:10302243... [more]
adcy93.552e-5635.28adenylate cyclase 9 [Source:NCBI gene;Acc:10302243... [more]
adcy84.546e-4938.31adenylate cyclase 8 [Source:NCBI gene;Acc:10302499... [more]
adcy85.357e-4938.31adenylate cyclase 8 [Source:NCBI gene;Acc:10302499... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adcy93.109e-6336.81adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-0502... [more]
ENSPMAT00000008766.11.814e-4939.91pep scaffold:Pmarinus_7.0:GL476654:390837:418056:1... [more]
ADCY18.710e-4940.34adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ENSPMAT00000006025.13.721e-4639.00pep scaffold:Pmarinus_7.0:GL480980:9262:24123:1 ge... [more]
adcy2a1.800e-4344.77adenylate cyclase 2a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470101.888e-5736.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458682.569e-4939.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428109.332e-3728.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342672.502e-2734.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342759.096e-2640.00Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crebbpb1.313e-5929.07adenylate cyclase 9 [Source:NCBI gene;Acc:10115551... [more]
crebbpb1.779e-5929.38adenylate cyclase 9 [Source:NCBI gene;Acc:10115551... [more]
crebbpb1.003e-5835.23adenylate cyclase 9 [Source:NCBI gene;Acc:10115551... [more]
adcy81.647e-5139.11adenylate cyclase 8 [Source:NCBI gene;Acc:10116108... [more]
adcy93.163e-5145.98adenylate cyclase type 9 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Adenylate cyclase type vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009033.10.000e+0100.00SMESG000009033.1[more]
SMESG000009035.10.000e+078.72SMESG000009035.1[more]
SMESG000009036.10.000e+065.64SMESG000009036.1[more]
SMESG000050966.10.000e+054.77SMESG000050966.1[more]
SMESG000050971.10.000e+053.26SMESG000050971.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008711 ID=SMED30008711|Name=Adenylate cyclase type|organism=Schmidtea mediterranea sexual|type=transcript|length=3262bp
GTACTAATTTAAAAGAAAAAATCGTTACTGATAAAGTAATTATTTTAAAT
TGGGCTTCGCAGATTTCTCGATGAAACCATAAAAGCGAAAAAAGAAATAA
TGATAAGATTAAAATTAGAGGAAGTTAGCAAAGTGATGAGTTTAAGATCC
AGTATTTTAAGTGATTACTTTTACACTTTAATGACTAATCATAATATCAA
ATCTATCAGAAATGGAATGAAGGTCTTGATTCTCTACTGTTATTGTGAAA
TTGTGAGTTCCCATATTTCCGAAAGAGGAATTATTTTTCGACCGATTTTA
GCACTGGTTGTCTTTTGTATATTTTTCATTATATTTGCAGCTACTGTTAA
TGTCAAAGAAACTACTACAATTATGAGATTCGCATCGGCGATGGTAATAA
TTTGTATGACATATACCGTTTTGTTAGGCACTGATTCGAGTGAATTAATG
GAACTTAATTATTCCCTTGTTGTTTTGATAATTTTGCTGATGTACACATT
ATTTCGGATGAAATTTATGGTTGTGATGTTATTGAGTTTATTGTATATTT
TAATATTTGTGTCAATAGGGAATTTTCGGATAAAATATGTTGAGCAAAAA
GAATTGAATGTTTCAACTGTTTCAGATTTAGAGTCTATTCGACGTTTTCG
GACTAAAATTTTTGAAGAATACTATTATATTACTGGACAATGTATTTTGC
TTTTTCTAATGTACATGACTGGACTGTATTTACGGTTTTTTAACTCGATC
CGTAGAAAATCGGCTTTCCTAAAGTTGGCTCAAAATGCCGAAGCCCGACT
GAAGATGCAATCTGCTATTAAAATACAAATTTATTGGATCGAGGCCATTA
TGCCAAGCTCCGTGAAAGAGAATTTTCTAAATAGAATCCGAAATAGTGAC
AGTTTTAGTTTGGTGTACTGTCAGCATTTTGAAAACGTCAGTATCCTGTT
TGCGGATATTGTCGGATTTACAATGATGAGTTCAAACAAAACTGCAGCGA
AACTTGTTTATTTATTGAATGATTTGTATAATAGATTTGATGAGCAAGGA
CGTCAGACGAATTGCGAGAAAATCGGAACTCTTGGAGATTGTTATTACTG
TGTTTCCGGATGTCCAATTCCAAGAACAGATCATGCGATAAGTTGCGTAG
AAATGGGTTTGGGGATGTGTAGATTGATAGTGAAATTCAATAAAGACCAC
AAAGAAGATGTGAATATGCGTGTTGGAATCCACAGTGGACGAGTAATTGC
AGCCATAATAGGAAATCATCGGTTTAGGTTTGATGTATTTTCATATGATG
TTATTATCGCTAACTCTTTGGAATCAAGCGGCAAAGCTGGTTTCGTACAC
GTTTCTGAAGATACGTTTTTGCTTGTCCGACACAGATATAATTTTGAGAA
AGGTGACATTTTAGAAATAATGAAAGAACAAGTCCATGGAATTTCAGGAA
TGATTAAAACATCTGTTCCCATGAATACTTACTTCGTCATACCAAGGCAA
ATTAAAAAGAAAAAACACAAACATAAACATAAAAAACAGTTAAATATGGC
AAATAAATTGTATTCTGTACCACACAGTGTTCAGCAAATTCTTTTGAATC
AAGATGATAATGAGAAACATAATTTCAAAAGGCGTGATAGAAAATATAAA
GGAGACTTGAAGATTGTGAAATGTTTGCAGGAAGACCCAGAAAGGACTGT
TGAATTTTTTCAAAATCCCCCAATTAATCAAATTACTTTAGCCTTTAAAG
ATCCCCAAATCGAATATCAATATTTATTTCATACAACAGACCAAATTGAA
CCGATACAAATTTATTCTATTAAGTTAGCCTTATTTTTAGATTCACTTGC
TAGTTTGTTTTACGCATCTGTCATTTTACTTGCGGCTTACGTGATGCTTC
CCAAATCTTTTGGGTTTAGATTCTATTCACCAATAATTTATGGCAGTGGT
TACTTCTTTATTATTATAATTGCTTTCATTTCACTTATATATAAAAGTGA
AATTCCAAATCGTAAATTGAGGAAATTCTATTGTTTTTGGAGTCATCCAT
TAAGTAGATTGCTTTTGGGTGTCTATATGTCGTCACTGCCGTCAATATTG
GTGATTAGTTTGTATAATAAAAATATTTTAGCGACTAGTTACCATTATGC
AAGTGCTTTCTTTTCTATCGCGTTATTCGCTTTGATTAGCAATGTTATTT
CTACATCGTTGTCTAGCTTAGTCAAGCACATCACAACTGGATCCTATACC
GCCATTGCAATTTGTTTGTGCTTCTATGCTCCAACTAAAAGAGAATTGAA
TTTATATTCATTTGATAATTGCTCAATATATTTGACGGAACCTAAAAACA
TGTTTATTCTTAGAATTCAATGTATTTTTTCATTTCAACTGTTACAAATC
TGTTTGCTTATTTATTATTTGGCAAGAGAAAATGAAAAGAATATTCGATT
GAATTTCTATGCGACAAGGGAAGCCGAAATCCGAAATGCTGAAGCGACCC
ATGCGAATAAAATCGCTGAAAGTCTTTTATACAATATAATACCGAAACAG
GTTTTCAAAGAAATTGTTGGAAAAAAGCAAAGCAATGAAATTATTTTTAG
CTATGCTCATGCTTTCGCGAATGCCGGAGTAATTTTTGCATGTATTAGTA
ACTTTTTCTCGTCGTATTATAGAGAGGATTATAAAGGTGGCGAAGTGGCT
CTGCGATTACTTCATACTATAATTTGCACATTTGATAATTTGTTAAAAAA
ACCAATTTATTTGAAGTTAGAGAAAATTAAAACAATAAACGATTGTTACA
TGTTGGCGTCGGGTTTGAACTCAGATCATGAAGAAATGGCAAGTGATGAG
CATTTGAAAATTCTGATGACATTTGCATTTGATATGCATCATCATCTTCG
TCTGTTTAATGAACAGAATATAATTGGAAACTTTACTTTTTATTTGAAAA
TCGGTTACAATTTTGGACCAATCACAGCCGGAATAATTGGCACTTCAAAA
CCACTTTATGATATTTGGGGTGACACGGTAAATGTTGCCAGCCGAATGTA
TAGTACGGCCCCATATTGTAGTTCTATACAAGTGCCTGAACATGTAGCTA
ATAAACTTAAACTTTACTTTGACTTTAAATATCGTGGAACTGTAGCTGTT
AAAGGAAAAGGCGATATGACTACGTTTTTAGCTGTGAGATCGCACTTTGT
ATCACCAATGTTTTTAGATAGAGTGCCATTTTCTTCATTAGAAGTTTAGT
TAGTTAGTCACA
back to top

protein sequence of SMED30008711-orf-1

>SMED30008711-orf-1 ID=SMED30008711-orf-1|Name=SMED30008711-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1050bp
MIRLKLEEVSKVMSLRSSILSDYFYTLMTNHNIKSIRNGMKVLILYCYCE
IVSSHISERGIIFRPILALVVFCIFFIIFAATVNVKETTTIMRFASAMVI
ICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYI
LIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCIL
LFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAI
MPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAA
KLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCV
EMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYD
VIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISG
MIKTSVPMNTYFVIPRQIKKKKHKHKHKKQLNMANKLYSVPHSVQQILLN
QDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFK
DPQIEYQYLFHTTDQIEPIQIYSIKLALFLDSLASLFYASVILLAAYVML
PKSFGFRFYSPIIYGSGYFFIIIIAFISLIYKSEIPNRKLRKFYCFWSHP
LSRLLLGVYMSSLPSILVISLYNKNILATSYHYASAFFSIALFALISNVI
STSLSSLVKHITTGSYTAIAICLCFYAPTKRELNLYSFDNCSIYLTEPKN
MFILRIQCIFSFQLLQICLLIYYLARENEKNIRLNFYATREAEIRNAEAT
HANKIAESLLYNIIPKQVFKEIVGKKQSNEIIFSYAHAFANAGVIFACIS
NFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCY
MLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLK
IGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVA
NKLKLYFDFKYRGTVAVKGKGDMTTFLAVRSHFVSPMFLDRVPFSSLEV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001054A/G_cyclase
IPR029787Nucleotide_cyclase
Vocabulary: biological process
TermDefinition
GO:0009190cyclic nucleotide biosynthetic process
GO:0035556intracellular signal transduction
Vocabulary: molecular function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclaseSMARTSM00044cyc_6coord: 238..434
e-value: 3.6E-49
score: 179.3
coord: 801..1011
e-value: 8.3E-18
score: 75.2
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 836..1027
e-value: 2.8E-36
score: 124.9
coord: 272..439
e-value: 8.0E-50
score: 169.0
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 281..408
score: 35.445
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 843..984
score: 31.489
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 834..1032
e-value: 1.6E-46
score: 160.3
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 267..474
e-value: 1.3E-59
score: 202.9
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 270..434
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 840..1028
NoneNo IPR availablePANTHERPTHR45627:SF8ADENYLATE CYCLASE TYPE 9coord: 20..1031
NoneNo IPR availablePANTHERPTHR45627FAMILY NOT NAMEDcoord: 20..1031
NoneNo IPR availableCDDcd07302CHDcoord: 279..463
e-value: 1.27238E-47
score: 165.83
NoneNo IPR availableCDDcd07302CHDcoord: 841..1027
e-value: 1.6168E-34
score: 128.081
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 753..775
NoneNo IPR availableTMHMMTMhelixcoord: 191..213
NoneNo IPR availableTMHMMTMhelixcoord: 707..729
NoneNo IPR availableTMHMMTMhelixcoord: 651..673
NoneNo IPR availableTMHMMTMhelixcoord: 678..700
NoneNo IPR availableTMHMMTMhelixcoord: 89..111
NoneNo IPR availableTMHMMTMhelixcoord: 608..630
NoneNo IPR availableTMHMMTMhelixcoord: 576..598
NoneNo IPR availableTMHMMTMhelixcoord: 118..135
NoneNo IPR availableTMHMMTMhelixcoord: 445..464
NoneNo IPR availableTMHMMTMhelixcoord: 139..161
NoneNo IPR availableTMHMMTMhelixcoord: 831..853