Rho guanine nucleotide exchange factor 10

Overview
NameRho guanine nucleotide exchange factor 10
Smed IDSMED30008699
Length (bp)2862
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho guanine nucleotide exchange factor 10 (SMED30008699) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho guanine nucleotide exchange factor 10 (SMED30008699) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho guanine nucleotide exchange factor 10 (SMED30008699) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho guanine nucleotide exchange factor 10 (SMED30008699) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008699

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30008699SMESG000022298.1 dd_Smed_v4_11936_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Human
Match: ARHGEF10 (Rho guanine nucleotide exchange factor 10 [Source:HGNC Symbol;Acc:HGNC:14103])

HSP 1 Score: 59.3066 bits (142), Expect = 3.963e-8
Identity = 79/379 (20.84%), Postives = 162/379 (42.74%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSR---KIMFKSSVYYLKPN------FNIPRKLIKLP----YIL---ILC---------DSEIIIYPK-----NYPLNEVPSEMIFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQ 1239
            +R   + ++  +E NY+  ++ +L       ++   K L  +     FY++   I   H    + L   + E+ S + IG V +    K  + + Y +YV+N           CA       ++  Q  S   P   TL S++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++R++  +       R  +KQI   I  R   K++   S Y ++ +      +N   +++K      ++L   ++C         DS ++   +     + PL  V  + I Y S A T    +++     E  +     K  +++          ++  +++ +L+D N+I +I   + NL   Y +++Q
Sbjct:  421 VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVK-EILQCHSLFQIALASRVSEWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKEQEAS---PDRTTLYSLMMKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQ------RCEVKQIAKAINERYLNKLLSSGSRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSVPLGHV--DAIEYGSSAGTGEHSRHLAVHPPESLAVVANAKPNKVY------MGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNLNQ 781          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Human
Match: ARHGEF10 (Rho guanine nucleotide exchange factor 10 [Source:HGNC Symbol;Acc:HGNC:14103])

HSP 1 Score: 59.3066 bits (142), Expect = 3.963e-8
Identity = 79/379 (20.84%), Postives = 162/379 (42.74%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSR---KIMFKSSVYYLKPN------FNIPRKLIKLP----YIL---ILC---------DSEIIIYPK-----NYPLNEVPSEMIFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQ 1239
            +R   + ++  +E NY+  ++ +L       ++   K L  +     FY++   I   H    + L   + E+ S + IG V +    K  + + Y +YV+N           CA       ++  Q  S   P   TL S++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++R++  +       R  +KQI   I  R   K++   S Y ++ +      +N   +++K      ++L   ++C         DS ++   +     + PL  V  + I Y S A T    +++     E  +     K  +++          ++  +++ +L+D N+I +I   + NL   Y +++Q
Sbjct:  421 VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVK-EILQCHSLFQIALASRVSEWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKEQEAS---PDRTTLYSLMMKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQ------RCEVKQIAKAINERYLNKLLSSGSRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSVPLGHV--DAIEYGSSAGTGEHSRHLAVHPPESLAVVANAKPNKVY------MGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNLNQ 781          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Human
Match: ARHGEF10 (Rho guanine nucleotide exchange factor 10 [Source:HGNC Symbol;Acc:HGNC:14103])

HSP 1 Score: 56.9954 bits (136), Expect = 1.787e-7
Identity = 77/379 (20.32%), Postives = 165/379 (43.54%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSR---KIMFKSSVYYLKPN------FNIPRKLIKLP----YIL---ILC---------DSEIIIYPK-----NYPLNEVPSEMIFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQ 1239
            +R   + ++  +E NY+  ++ +L       ++   K L  +     FY++   I   H    + L   + E+ S + IG V +    K  + + Y +YV+N           CA       ++  +     +P   TL S++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++R++  ++++  E+    KQI   I  R   K++   S Y ++ +      +N   +++K      ++L   ++C         DS ++   +     + PL  V  + I Y S A T    +++     E  +     K  +++          ++  +++ +L+D N+I +I   + NL   Y +++Q
Sbjct:   69 VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRV-KEILQCHSLFQIALASRVSEWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKQE--QEASPDRTTLYSLMMKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKR--DADQRCEV----KQIAKAINERYLNKLLSSGSRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSVPLGHV--DAIEYGSSAGTGEHSRHLAVHPPESLAVVANAKPNKVY------MGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNLNQ 430          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Human
Match: ARHGEF10 (Rho guanine nucleotide exchange factor 10 [Source:HGNC Symbol;Acc:HGNC:14103])

HSP 1 Score: 56.9954 bits (136), Expect = 1.787e-7
Identity = 77/379 (20.32%), Postives = 165/379 (43.54%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSR---KIMFKSSVYYLKPN------FNIPRKLIKLP----YIL---ILC---------DSEIIIYPK-----NYPLNEVPSEMIFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQ 1239
            +R   + ++  +E NY+  ++ +L       ++   K L  +     FY++   I   H    + L   + E+ S + IG V +    K  + + Y +YV+N           CA       ++  +     +P   TL S++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++R++  ++++  E+    KQI   I  R   K++   S Y ++ +      +N   +++K      ++L   ++C         DS ++   +     + PL  V  + I Y S A T    +++     E  +     K  +++          ++  +++ +L+D N+I +I   + NL   Y +++Q
Sbjct:   69 VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRV-KEILQCHSLFQIALASRVSEWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKQE--QEASPDRTTLYSLMMKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKR--DADQRCEV----KQIAKAINERYLNKLLSSGSRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSVPLGHV--DAIEYGSSAGTGEHSRHLAVHPPESLAVVANAKPNKVY------MGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNLNQ 430          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Human
Match: ARHGEF10 (Rho guanine nucleotide exchange factor 10 [Source:HGNC Symbol;Acc:HGNC:14103])

HSP 1 Score: 56.9954 bits (136), Expect = 2.035e-7
Identity = 77/379 (20.32%), Postives = 162/379 (42.74%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSR---KIMFKSSVYYLKPN------FNIPRKLIKLP----YIL---ILC---------DSEIIIYPK-----NYPLNEVPSEMIFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQ 1239
            +R   + ++  +E NY+  ++ +L       ++   K L  +     FY++   I   H    + L   + E+ S + IG V +    K  + + Y +YV+N           CA       ++  +     +P   TL S++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++R++  +       R  +KQI   I  R   K++   S Y ++ +      +N   +++K      ++L   ++C         DS ++   +     + PL  V  + I Y S A T    +++     E  +     K  +++          ++  +++ +L+D N+I +I   + NL   Y +++Q
Sbjct:  421 VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVK-EILQCHSLFQIALASRVSEWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKQE--QEASPDRTTLYSLMMKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQ------RCEVKQIAKAINERYLNKLLSSGSRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSVPLGHV--DAIEYGSSAGTGEHSRHLAVHPPESLAVVANAKPNKVY------MGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNLNQ 782          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Zebrafish
Match: AL928723.3 (Rho guanine nucleotide exchange factor (GEF) 10 [Source:NCBI gene;Acc:334278])

HSP 1 Score: 54.6842 bits (130), Expect = 6.493e-7
Identity = 82/429 (19.11%), Postives = 184/429 (42.89%), Query Frame = 1
Query:  157 DWFERIKCIDFDEDFNELFSKISPSNIRLQCI-RTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSRKIMFKSSVYYLKPN------FNIPRKLIKLP--YILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNIF--RFSIEKN--SQYEFQKAKEL----FPLIKDSFINDKILI----------------EVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKEREL 1302
            D F  ++C + D         ++   +  +CI   + ++E +YL+ ++ +L        +   + L  +   + F+++   I   H    + L   + ++   + IG V +    K  + + Y +YV+N           CA      +++ ++  + K+   LTL  ++M PIQRFPQ   ++ D+ K T   + +R+ L   +  ++ ++  L++R++  E+++  EIR+  K +     + K++   S Y ++ +      +N   ++IK     + +L D  +   P     N  PS+           +     F  ++S+  +     EF  ++E+    FP    S   DK++I                +++ +++D  ++N+I   + +L   Y +++       +  LQ  + +KE E+
Sbjct:  431 DLFIEVECFNVDPVLGPAPDGLTQHQVMRRCILEKILESEKSYLEALKRILEQYEKPLAEIEPRLLSDRKRKVVFHRIR-EILQCHALFQMALASRVSDWDELEMIGDVFVASFSKSMVLDAYSEYVNNFSLAMGVVRKACAAKPCFLDFLKHRQETSKD--RLTLYGLMMKPIQRFPQFILLLQDMLKNTPVGHADRLPLQMALTELEVLAEKLNERKK--EADQRCEIRHIAKAMNEHYLN-KLLSSGSRYLIRSDDMVETVYNDRGEIIKTKERRVFLLNDVLMCATP-----NRRPSQDGVSVGAGGEGVPSGQRFLLKWSVPLSFVEVVEFGSSEEMVDSRFP---PSHSGDKVVINAKPNKLYMGPGQLYQDLQNLIHDLGLVNQISTMISSLKGNYQNVNGTVAQDWVSGLQRLILKKEEEI 845          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Zebrafish
Match: arhgef10 (Rho guanine nucleotide exchange factor (GEF) 10 [Source:ZFIN;Acc:ZDB-GENE-030131-6210])

HSP 1 Score: 54.6842 bits (130), Expect = 6.683e-7
Identity = 82/429 (19.11%), Postives = 184/429 (42.89%), Query Frame = 1
Query:  157 DWFERIKCIDFDEDFNELFSKISPSNIRLQCI-RTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSRKIMFKSSVYYLKPN------FNIPRKLIKLP--YILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNIF--RFSIEKN--SQYEFQKAKEL----FPLIKDSFINDKILI----------------EVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKEREL 1302
            D F  ++C + D         ++   +  +CI   + ++E +YL+ ++ +L        +   + L  +   + F+++   I   H    + L   + ++   + IG V +    K  + + Y +YV+N           CA      +++ ++  + K+   LTL  ++M PIQRFPQ   ++ D+ K T   + +R+ L   +  ++ ++  L++R++  E+++  EIR+  K +     + K++   S Y ++ +      +N   ++IK     + +L D  +   P     N  PS+           +     F  ++S+  +     EF  ++E+    FP    S   DK++I                +++ +++D  ++N+I   + +L   Y +++       +  LQ  + +KE E+
Sbjct:  451 DLFIEVECFNVDPVLGPAPDGLTQHQVMRRCILEKILESEKSYLEALKRILEQYENPLAEIEPRLLSDRKRKVVFHRIR-EILQCHALFQMALASRVSDWDELEMIGDVFVASFSKSMVLDAYSEYVNNFSLAMGVVRKACAAKPCFLDFLKHRQETSKD--RLTLYGLMMKPIQRFPQFILLLQDMLKNTPVGHADRLPLQMALTELEVLAEKLNERKK--EADQRCEIRHIAKAMNEHYLN-KLLSSGSRYLIRSDDMVETVYNDRGEIIKTKERRVFLLNDVLMCATP-----NRRPSQDGVSVGAGGEGVPSGQRFLLKWSVPLSFVEVVEFGSSEEMVDSRFP---PSHSGDKVVINAKPNKLYMGPGQLYQDLQNLIHDLGLVNQISTMISSLKGNYQNVNGTVAQDWVSGLQRLILKKEEEI 865          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Zebrafish
Match: arhgef10 (Rho guanine nucleotide exchange factor (GEF) 10 [Source:ZFIN;Acc:ZDB-GENE-030131-6210])

HSP 1 Score: 54.6842 bits (130), Expect = 6.683e-7
Identity = 82/429 (19.11%), Postives = 184/429 (42.89%), Query Frame = 1
Query:  157 DWFERIKCIDFDEDFNELFSKISPSNIRLQCI-RTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSRKIMFKSSVYYLKPN------FNIPRKLIKLP--YILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNIF--RFSIEKN--SQYEFQKAKEL----FPLIKDSFINDKILI----------------EVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKEREL 1302
            D F  ++C + D         ++   +  +CI   + ++E +YL+ ++ +L        +   + L  +   + F+++   I   H    + L   + ++   + IG V +    K  + + Y +YV+N           CA      +++ ++  + K+   LTL  ++M PIQRFPQ   ++ D+ K T   + +R+ L   +  ++ ++  L++R++  E+++  EIR+  K +     + K++   S Y ++ +      +N   ++IK     + +L D  +   P     N  PS+           +     F  ++S+  +     EF  ++E+    FP    S   DK++I                +++ +++D  ++N+I   + +L   Y +++       +  LQ  + +KE E+
Sbjct:  451 DLFIEVECFNVDPVLGPAPDGLTQHQVMRRCILEKILESEKSYLEALKRILEQYENPLAEIEPRLLSDRKRKVVFHRIR-EILQCHALFQMALASRVSDWDELEMIGDVFVASFSKSMVLDAYSEYVNNFSLAMGVVRKACAAKPCFLDFLKHRQETSKD--RLTLYGLMMKPIQRFPQFILLLQDMLKNTPVGHADRLPLQMALTELEVLAEKLNERKK--EADQRCEIRHIAKAMNEHYLN-KLLSSGSRYLIRSDDMVETVYNDRGEIIKTKERRVFLLNDVLMCATP-----NRRPSQDGVSVGAGGEGVPSGQRFLLKWSVPLSFVEVVEFGSSEEMVDSRFP---PSHSGDKVVINAKPNKLYMGPGQLYQDLQNLIHDLGLVNQISTMISSLKGNYQNVNGTVAQDWVSGLQRLILKKEEEI 865          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Zebrafish
Match: ect2 (epithelial cell transforming 2 [Source:ZFIN;Acc:ZDB-GENE-040831-2])

HSP 1 Score: 52.373 bits (124), Expect = 2.721e-6
Identity = 49/220 (22.27%), Postives = 98/220 (44.55%), Query Frame = 1
Query:  232 NIRLQCIRTLFQTEINYLKKIRDLLSTINMLF------NKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHL---ELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            + R Q  + L+QTE NY+    D+L+T+  LF             +L + E    +   P I+++H  +     EL+  +   +S+G +++K+    EL + Y  +V+           C   K   H    IN         +L+ L   ++ P+QR P +  +++DI K T D N +++ L + +  +K +   +++ ++  E  +     + E+  C
Sbjct:  449 SARWQVSKELYQTESNYV----DILATVLQLFKYPLEKEGQVGGPILAQEEIKTIFGSIPDIYEVHTRIKADLEELVMNWSEERSVGDIILKY--SGELVKAYPPFVNFFEMSKETIVRCERQKPRFHAFLKINQSKPECGRQTLVEL---LIRPVQRLPSVALLLNDIKKHTSDDNPDKLTLEKAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVDGC 659          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Zebrafish
Match: ect2 (epithelial cell transforming 2 [Source:ZFIN;Acc:ZDB-GENE-040831-2])

HSP 1 Score: 52.373 bits (124), Expect = 3.026e-6
Identity = 49/220 (22.27%), Postives = 98/220 (44.55%), Query Frame = 1
Query:  232 NIRLQCIRTLFQTEINYLKKIRDLLSTINMLF------NKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHL---ELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            + R Q  + L+QTE NY+    D+L+T+  LF             +L + E    +   P I+++H  +     EL+  +   +S+G +++K+    EL + Y  +V+           C   K   H    IN         +L+ L   ++ P+QR P +  +++DI K T D N +++ L + +  +K +   +++ ++  E  +     + E+  C
Sbjct:  417 SARWQVSKELYQTESNYV----DILATVLQLFKYPLEKEGQVGGPILAQEEIKTIFGSIPDIYEVHTRIKADLEELVMNWSEERSVGDIILKY--SGELVKAYPPFVNFFEMSKETIVRCERQKPRFHAFLKINQSKPECGRQTLVEL---LIRPVQRLPSVALLLNDIKKHTSDDNPDKLTLEKAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVDGC 627          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Xenopus
Match: smn1 (survival of motor neuron 1 [Source:Xenbase;Acc:XB-GENE-489160])

HSP 1 Score: 53.1434 bits (126), Expect = 2.729e-6
Identity = 52/220 (23.64%), Postives = 99/220 (45.00%), Query Frame = 1
Query:  232 NIRLQCIRTLFQTEINYLKKIRDLLSTINMLFN------KFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLELIK---EFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            + R Q    L+QTE NY+    D+L+TI  LF             +L   E    +   P I D+H  +  +L K   ++  S+SIG +++ +    +L ++Y  +V+           C + K   H    IN         +L+ L   ++ P+QR P +  +++D+ K T D N ++V L + +  +K + M +++ ++  E  +     + E+  C
Sbjct:  448 SARWQVAMELYQTESNYV----DILTTIVQLFQLPLEKEGQLGGPILAPEEIKTIFGSIPDILDVHTNIKGDLEKLMIDWAESKSIGDIILTY--SKDLVKIYPPFVNFFEMSKEMIIKCEKQKPRFHAFLKINQSKPECGRQTLVEL---LIRPVQRLPSVALLLNDLKKHTADDNPDKVMLEKAIESLKEVMMHINEDKRKTEGQKQIFDVVYEVDGC 658          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Xenopus
Match: smn1 (survival of motor neuron 1 [Source:Xenbase;Acc:XB-GENE-489160])

HSP 1 Score: 52.7582 bits (125), Expect = 3.664e-6
Identity = 52/220 (23.64%), Postives = 99/220 (45.00%), Query Frame = 1
Query:  232 NIRLQCIRTLFQTEINYLKKIRDLLSTINMLFN------KFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLELIK---EFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            + R Q    L+QTE NY+    D+L+TI  LF             +L   E    +   P I D+H  +  +L K   ++  S+SIG +++ +    +L ++Y  +V+           C + K   H    IN         +L+ L   ++ P+QR P +  +++D+ K T D N ++V L + +  +K + M +++ ++  E  +     + E+  C
Sbjct:  450 SARWQVAMELYQTESNYV----DILTTIVQLFQLPLEKEGQLGGPILAPEEIKTIFGSIPDILDVHTNIKGDLEKLMIDWAESKSIGDIILTY--SKDLVKIYPPFVNFFEMSKEMIIKCEKQKPRFHAFLKINQSKPECGRQTLVEL---LIRPVQRLPSVALLLNDLKKHTADDNPDKVMLEKAIESLKEVMMHINEDKRKTEGQKQIFDVVYEVDGC 660          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Xenopus
Match: smn1 (survival of motor neuron 1 [Source:Xenbase;Acc:XB-GENE-489160])

HSP 1 Score: 52.373 bits (124), Expect = 4.163e-6
Identity = 52/220 (23.64%), Postives = 99/220 (45.00%), Query Frame = 1
Query:  232 NIRLQCIRTLFQTEINYLKKIRDLLSTINMLFN------KFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLELIK---EFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            + R Q    L+QTE NY+    D+L+TI  LF             +L   E    +   P I D+H  +  +L K   ++  S+SIG +++ +    +L ++Y  +V+           C + K   H    IN         +L+ L   ++ P+QR P +  +++D+ K T D N ++V L + +  +K + M +++ ++  E  +     + E+  C
Sbjct:  419 SARWQVAMELYQTESNYV----DILTTIVQLFQLPLEKEGQLGGPILAPEEIKTIFGSIPDILDVHTNIKGDLEKLMIDWAESKSIGDIILTY--SKDLVKIYPPFVNFFEMSKEMIIKCEKQKPRFHAFLKINQSKPECGRQTLVEL---LIRPVQRLPSVALLLNDLKKHTADDNPDKVMLEKAIESLKEVMMHINEDKRKTEGQKQIFDVVYEVDGC 629          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Mouse
Match: Arhgef10 (Rho guanine nucleotide exchange factor (GEF) 10 [Source:MGI Symbol;Acc:MGI:2444453])

HSP 1 Score: 55.4546 bits (132), Expect = 4.535e-7
Identity = 48/211 (22.75%), Postives = 101/211 (47.87%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSI-KNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQI 822
            +R   + ++ ++E NY+  +R +L       ++   + L  +   + FY++   I   H    + L   + E+   ++IG V +    K  + + Y +YV+N           CA       ++    LS   +P  +TL S++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++R++  ++++  EI+   K I
Sbjct:  358 VRRYILGSIVESEKNYVDALRRILEQYEKPLSEMEPRLLSDRKLRMVFYRVK-EILQCHSMFQIALASRVSEWDVVETIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLK---LSQDSSPDRVTLHSLMMRPIQRFPQFILLLQDMLKNTAKGHPDRLPLQMALTELETLAEKLNERKR--DADQRCEIKQIAKAI 562          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Mouse
Match: Arhgef10 (Rho guanine nucleotide exchange factor (GEF) 10 [Source:MGI Symbol;Acc:MGI:2444453])

HSP 1 Score: 55.0694 bits (131), Expect = 4.881e-7
Identity = 48/211 (22.75%), Postives = 101/211 (47.87%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSI-KNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQI 822
            +R   + ++ ++E NY+  +R +L       ++   + L  +   + FY++   I   H    + L   + E+   ++IG V +    K  + + Y +YV+N           CA       ++    LS   +P  +TL S++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++R++  ++++  EI+   K I
Sbjct:  397 VRRYILGSIVESEKNYVDALRRILEQYEKPLSEMEPRLLSDRKLRMVFYRVK-EILQCHSMFQIALASRVSEWDVVETIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLK---LSQDSSPDRVTLHSLMMRPIQRFPQFILLLQDMLKNTAKGHPDRLPLQMALTELETLAEKLNERKR--DADQRCEIKQIAKAI 601          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Mouse
Match: Arhgef10 (Rho guanine nucleotide exchange factor (GEF) 10 [Source:MGI Symbol;Acc:MGI:2444453])

HSP 1 Score: 54.6842 bits (130), Expect = 6.222e-7
Identity = 48/211 (22.75%), Postives = 101/211 (47.87%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSI-KNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQI 822
            +R   + ++ ++E NY+  +R +L       ++   + L  +   + FY++   I   H    + L   + E+   ++IG V +    K  + + Y +YV+N           CA       ++    LS   +P  +TL S++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++R++  ++++  EI+   K I
Sbjct:   69 VRRYILGSIVESEKNYVDALRRILEQYEKPLSEMEPRLLSDRKLRMVFYRV-KEILQCHSMFQIALASRVSEWDVVETIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLK---LSQDSSPDRVTLHSLMMRPIQRFPQFILLLQDMLKNTAKGHPDRLPLQMALTELETLAEKLNERKR--DADQRCEIKQIAKAI 273          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Mouse
Match: Ect2 (ect2 oncogene [Source:MGI Symbol;Acc:MGI:95281])

HSP 1 Score: 53.5286 bits (127), Expect = 1.388e-6
Identity = 52/220 (23.64%), Postives = 98/220 (44.55%), Query Frame = 1
Query:  232 NIRLQCIRTLFQTEINYLKKIRDLLSTINMLFN------KFTFKSLLTKSEFLFFYQLFPTIFDLHYALH---LELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            + R Q  + L+QTE NY+    ++L+TI  LF             +L   E    +   P IFD+H  +     +LI  +  S+SIG + +K+    +L + Y  +V+           C + K   H    IN         SL+ L   ++ P+QR P +  +++D+ K T D N ++  L + +  +K +   +++ ++  E+ +     + E+  C
Sbjct:  451 SARWQVAKELYQTESNYV----NILATIIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHMKIKDDLEDLIANWDESRSIGDIFLKYAK--DLVKTYPPFVNFFEMSKEMIIKCEKQKPRFHAFLKINQAKPECGRQSLVEL---LIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDGC 661          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Mouse
Match: Ect2 (ect2 oncogene [Source:MGI Symbol;Acc:MGI:95281])

HSP 1 Score: 53.5286 bits (127), Expect = 1.547e-6
Identity = 52/220 (23.64%), Postives = 98/220 (44.55%), Query Frame = 1
Query:  232 NIRLQCIRTLFQTEINYLKKIRDLLSTINMLFN------KFTFKSLLTKSEFLFFYQLFPTIFDLHYALH---LELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            + R Q  + L+QTE NY+    ++L+TI  LF             +L   E    +   P IFD+H  +     +LI  +  S+SIG + +K+    +L + Y  +V+           C + K   H    IN         SL+ L   ++ P+QR P +  +++D+ K T D N ++  L + +  +K +   +++ ++  E+ +     + E+  C
Sbjct:  420 SARWQVAKELYQTESNYV----NILATIIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHMKIKDDLEDLIANWDESRSIGDIFLKYAK--DLVKTYPPFVNFFEMSKEMIIKCEKQKPRFHAFLKINQAKPECGRQSLVEL---LIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDGC 630          
BLAST of Rho guanine nucleotide exchange factor 10 vs. UniProt/SwissProt
Match: sp|O15013|ARHGA_HUMAN (Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4)

HSP 1 Score: 56.9954 bits (136), Expect = 9.772e-7
Identity = 77/379 (20.32%), Postives = 162/379 (42.74%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSR---KIMFKSSVYYLKPN------FNIPRKLIKLP----YIL---ILC---------DSEIIIYPK-----NYPLNEVPSEMIFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQ 1239
            +R   + ++  +E NY+  ++ +L       ++   K L  +     FY++   I   H    + L   + E+ S + IG V +    K  + + Y +YV+N           CA       ++  +     +P   TL S++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++R++  +       R  +KQI   I  R   K++   S Y ++ +      +N   +++K      ++L   ++C         DS ++   +     + PL  V  + I Y S A T    +++     E  +     K  +++          ++  +++ +L+D N+I +I   + NL   Y +++Q
Sbjct:  421 VRRYILGSVVDSEKNYVDALKRILEQYEKPLSEMEPKVLSERKLKTVFYRVK-EILQCHSLFQIALASRVSEWDSVEMIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLKQE--QEASPDRTTLYSLMMKPIQRFPQFILLLQDMLKNTSKGHPDRLPLQMALTELETLAEKLNERKRDADQ------RCEVKQIAKAINERYLNKLLSSGSRYLIRSDDMIETVYNDRGEIVKTKERRVFMLNDVLMCATVSSRPSHDSRVMSSQRYLLKWSVPLGHV--DAIEYGSSAGTGEHSRHLAVHPPESLAVVANAKPNKVY------MGPGQLYQDLQNLLHDLNVIGQITQLIGNLKGNYQNLNQ 782          
BLAST of Rho guanine nucleotide exchange factor 10 vs. UniProt/SwissProt
Match: sp|Q8C033|ARHGA_MOUSE (Rho guanine nucleotide exchange factor 10 OS=Mus musculus OX=10090 GN=Arhgef10 PE=1 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 3.414e-6
Identity = 48/211 (22.75%), Postives = 101/211 (47.87%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSI-KNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQI 822
            +R   + ++ ++E NY+  +R +L       ++   + L  +   + FY++   I   H    + L   + E+   ++IG V +    K  + + Y +YV+N           CA       ++    LS   +P  +TL S++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++R++  ++++  EI+   K I
Sbjct:  397 VRRYILGSIVESEKNYVDALRRILEQYEKPLSEMEPRLLSDRKLRMVFYRVK-EILQCHSMFQIALASRVSEWDVVETIGDVFVASFSKSMVLDAYSEYVNNFSTAVAVLKKTCATKPAFLEFLK---LSQDSSPDRVTLHSLMMRPIQRFPQFILLLQDMLKNTAKGHPDRLPLQMALTELETLAEKLNERKR--DADQRCEIKQIAKAI 601          
BLAST of Rho guanine nucleotide exchange factor 10 vs. UniProt/SwissProt
Match: sp|Q07139|ECT2_MOUSE (Protein ECT2 OS=Mus musculus OX=10090 GN=Ect2 PE=1 SV=2)

HSP 1 Score: 53.5286 bits (127), Expect = 9.706e-6
Identity = 52/220 (23.64%), Postives = 98/220 (44.55%), Query Frame = 1
Query:  232 NIRLQCIRTLFQTEINYLKKIRDLLSTINMLFN------KFTFKSLLTKSEFLFFYQLFPTIFDLHYALH---LELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            + R Q  + L+QTE NY+    ++L+TI  LF             +L   E    +   P IFD+H  +     +LI  +  S+SIG + +K+    +L + Y  +V+           C + K   H    IN         SL+ L   ++ P+QR P +  +++D+ K T D N ++  L + +  +K +   +++ ++  E+ +     + E+  C
Sbjct:  451 SARWQVAKELYQTESNYV----NILATIIQLFQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHMKIKDDLEDLIANWDESRSIGDIFLKYAK--DLVKTYPPFVNFFEMSKEMIIKCEKQKPRFHAFLKINQAKPECGRQSLVEL---LIRPVQRLPSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDGC 661          
BLAST of Rho guanine nucleotide exchange factor 10 vs. TrEMBL
Match: A0A1B6GT71 (Uncharacterized protein OS=Cuerna arida OX=1464854 GN=g.36700 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.138e-13
Identity = 135/771 (17.51%), Postives = 312/771 (40.47%), Query Frame = 1
Query:  304 LSTINMLFNKF------TFKSLLTKSEFLFFYQLFPTIFDLHYALHL---ELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN--------CAEYKH---LCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSRKI-------MFKSSVYYLKPN-----FNIPRKLIKLPYILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLL-TLQIKLNEKERELNNYFASIINLTMTESGSVKDNKMFQFDSARFATEWKINFHRIKFSMGLDESINWLLTTKQDIFQLSSKEEAFPLLFPPYDLQNNGIINMKLNVINCQVITIVIGSKISRCLWLSMSDGYVVILHFNYKEWIVLESFPTKIDGPISNLCNYSIFDSCIADIKIDIEIWMMYK-NEIISHSLLHNQRSVEKYRISLRKEGAAICQVKEKMFIGLHPNEIAIYSKSSYSQWCLESLIFMNK---CLMSLEENIQNLIFDNELILYVVCDREI-ILVDVSDD--KNVPIKIFTANENITCFNYSSDGIWIATSKDMTLTLYDKNLNTVLQTLSIP---VSYFGKCTYDSIIAVILTDKYLWIGTEAGYIMIISTVNRLFCVDSI---ITTYLHSNFSCAPINILLPFQN 2478
            L+T++ L N +         ++L+ S+    +   P I   H    +   E +  +     IG V +    K  + ++Y  +++N         AE K    L  +   + +S  +   L+   +++ P+QRFPQ    + D+   T   + +R+ L   +  ++S++  L++R++  E+ +    R  ++ I   + ++ I       + +  V  ++ N          + + L   L++C   + +  K   +N  P  +   +S   ++I +       +E N+     +       +  + + + +  E+  ++ D+ ++++I +    L+  Y  +  V ++R LL ++Q ++  K+ ++    +  + L++       D   FQ DS     EW       + ++    S  W +  ++   +  +K   F    P Y  Q    +     V  C   T   G      LW+  +DG    +   +    VL+        P++      I  + +  I+    +W+  +  +++ +S+   +   + + ++L     +I Q  + +F+ +    + ++ +   S+   E ++  ++   CL+ +            L LY  C + + +L  ++ +  K+  I+      N+     S  G+W++ +   T+ LY       LQ +++    V   G     ++ A++     LW+GT+AG  + +  + RL  V  I   ++   H++    P  +LLP Q+
Sbjct:  312 LATLHRLVNDYKKPLEEASPAILSASKISTLFHRLPEILQCHTLFRIALAEAVSNWDRDHRIGDVFVASFSKAIVLDIYSGFINNFSVAMELARAETKRKAALAEFFKARQVSSHD--RLSFFGLMVKPVQRFPQFILFLQDLLHHTGHGHPDRMSLQLALTQLESLAELLNERKR--EAEQSQAFREMLRAISGKLSAKNIGDNNRCLLRQDDVTQMEVNQCGLISQYKSRRLLLLNDLLVC---VSVSNKQENVNSGPQRLNLKWSCPISDIQV-------VETNTSPTLSRLLPQNGSLSSNGVTENLCSEMSRLMQDYQVVSRIAELASKLHGSYPELS-VDVTRGLLNSIQCQIQHKDDQMAWVDSCCLQLSLRNK---DDTYTFQMDSPEARKEWITELRLARLALDPSNSPAWEVPDQE--ARPCTKMPLFVAAHPVYTSQQQSEV-----VCGC-YYTATCGKSY---LWVCTTDGTSSHISIAHAAQTVLK--------PLTQFTMPDIRVTAMEYIRGAEAVWIGTQCQQLLVYSVTEVEHPEQTHSLALSGNVVSIRQHCDSVFVSMTTGSLLVFRRQQLSE--PEEIVLGSEPVSCLLPI-----------NLSLYAACGKTVTVLRAITGEIQKSFTIQHEHVGGNVNLMATSGVGLWLSLTHSSTICLYHTETFKHLQDINVASNVVRLTGSQAPVAVTALMACKGLLWVGTDAGVSLTVP-LPRLEGVPIISGRVSVSYHAHV--GPTRLLLPLQD 1029          
BLAST of Rho guanine nucleotide exchange factor 10 vs. TrEMBL
Match: A0A267E992 (DH domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005772g1 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.744e-11
Identity = 135/680 (19.85%), Postives = 282/680 (41.47%), Query Frame = 1
Query:  601 LTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLD--KR--QQIVESNEISEIRNCMKQIKTPIK-SR-KIMFKSSVYYLKPNF---NIPRKLIKLPYILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNI---FRFSIEKNSQY---EFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKERELNNYFASIINLTM---------TESGSVKDNKMFQFDSARFATEWKINFHRIKFSMGLDESINWLLTTKQDIFQLSSKEEAFPLLFPPYDLQNNGIINMKLNVINCQVITIVIGSKISRCLWLSMSDGYVVILHFNYKEWIVLESFPTKIDGPISNLCNYSIFDSC-IADIKIDIEIWMMYKN-EIISHSLLHNQRSVEKYRISLRKEGAAICQVKEKMFIGLHPNEIAIYSKSSYSQWCLESLIFMN------KCLMSLEENIQNLIFDNELILYVVCD--REIILVDVS----DDKNVPIKIF-TANENITCFNYSSDGIWIATSKDMTLTLYDKNLNTVLQTLSIPVSY---------FGKCTYDSIIAVILTDKYLWIGTEAGYIMIISTVNRLFCVDSIITTYLHSNFSC-----APINILLPFQNV 2481
            L L  I++ P+QRFPQL  V+ D+ K T   + +R DL      I+ ++  L+  KR  +Q++ + ++  +R      K+ +K SR +I+ +  V  L+ +    +     I L    +LC                P E+++Y  L D  +S  ++    + ++E+ S Y     Q++ E+   +++      I   +  +L+D  ++ KI   V  LNF Y  + + +L   L  +Q+ + +K  EL     +++ LT+          E       K F   ++R   +W   F  ++ ++  + +  W+ T   D   L S +   PLL     ++   +      V     + ++ GS +   +W + SDG V +     +   + E+F   +D  ++     ++   C  +    + E+WM     EI  HS + ++R   + ++ +     ++    + ++ G     +  ++++    W L+     +      + L   ++  Q L+     I+ +  +  R++   D+S    DD +   K+  +   ++  F  + +G+W+       + LY +    ++QT  I  ++           + T  +  AV +T   LW+GT  G + ++ T      +D  +         C      PI  LL ++N+
Sbjct:  406 LPLLGILVRPVQRFPQLLLVVKDLLKYTEPDHPDRYDLLYAQTQIEHLASQLNDIKRDSEQLISARQM--LRALGVHSKSALKNSRIRIVREDDVSELRADRQQQHAGGMRIILTTYYVLC--------TGARRRGGPQELLWYTKLEDVRLSGTSLTPDMKVNLEEVSNYLRIVSQRSTEVPEELEE------IYNSLHSLLHDHAVLVKILSLVSTLNFIYPDVREDRLQALLGNMQVAIQQKNEELRVAQGTVLALTVRRGILGGGGGEVSQSISRKAFDMRNSRARDDWTSEFTILRLALQPENNAAWI-TEMLDDLGLQSHQRT-PLLV---GVKACDLSRSMFQVTCATPVCLLNGSILKTHIWCAASDGSVAVFSLYNQSLEMTETF-RPVDAYVTAA---AVVPGCPTSSQNKEDEVWMATDTAEIFLHSTVESKRREPRKKVDVPATVTSMLCWDKSIYCGDVSGNLLCFNQNLLGNWNLQDPEVQSIADWPLRNLTVSQDGQQLLMSSGPCIISLGLESLRQLSRTDLSLEDADDNDEATKMGGSGGGHVRSFLLAGEGLWVCFENRPYVRLYYRPDMRLVQTFDIRPAFAKVNAKTHRHPESTVPAATAVAVTRGLLWVGTSVGLLYLLRTPR----LDGGVPVAFGPPLICCHSHRGPITALLTYRNI 1056          
BLAST of Rho guanine nucleotide exchange factor 10 vs. TrEMBL
Match: A0A1I8HM43 (DH domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.827e-11
Identity = 135/681 (19.82%), Postives = 282/681 (41.41%), Query Frame = 1
Query:  601 LTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLD--KR--QQIVESNEISEIRNCMKQIKTPIK-SR-KIMFKSSVYYLKPNF---NIPRKLIKLPYILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNI---FRFSIEKNSQY---EFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKERELNNYFASIINLTM----------TESGSVKDNKMFQFDSARFATEWKINFHRIKFSMGLDESINWLLTTKQDIFQLSSKEEAFPLLFPPYDLQNNGIINMKLNVINCQVITIVIGSKISRCLWLSMSDGYVVILHFNYKEWIVLESFPTKIDGPISNLCNYSIFDSC-IADIKIDIEIWMMYKN-EIISHSLLHNQRSVEKYRISLRKEGAAICQVKEKMFIGLHPNEIAIYSKSSYSQWCLESLIFMN------KCLMSLEENIQNLIFDNELILYVVCD--REIILVDVS----DDKNVPIKIF-TANENITCFNYSSDGIWIATSKDMTLTLYDKNLNTVLQTLSIPVSY---------FGKCTYDSIIAVILTDKYLWIGTEAGYIMIISTVNRLFCVDSIITTYLHSNFSC-----APINILLPFQNV 2481
            L L  I++ P+QRFPQL  V+ D+ K T   + +R DL      I+ ++  L+  KR  +Q++ + ++  +R      K+ +K SR +I+ +  V  L+ +    +     I L    +LC                P E+++Y  L D  +S  ++    + ++E+ S Y     Q++ E+   +++      I   +  +L+D  ++ KI   V  LNF Y  + + +L   L  +Q+ + +K  EL     +++ LT+           E       K F   ++R   +W   F  ++ ++  + +  W+ T   D   L S +   PLL     ++   +      V     + ++ GS +   +W + SDG V +     +   + E+F   +D  ++     ++   C  +    + E+WM     EI  HS + ++R   + ++ +     ++    + ++ G     +  ++++    W L+     +      + L   ++  Q L+     I+ +  +  R++   D+S    DD +   K+  +   ++  F  + +G+W+       + LY +    ++QT  I  ++           + T  +  AV +T   LW+GT  G + ++ T      +D  +         C      PI  LL ++N+
Sbjct:  250 LPLLGILVRPVQRFPQLLLVVKDLLKYTEPDHPDRYDLLYAQTQIEHLASQLNDIKRDSEQLISARQM--LRALGVHSKSALKNSRIRIVREDDVSELRADRQQQHAGGMRIILTTYYVLC--------TGARRRGGPQELLWYTKLEDVRLSGTSLTPDMKVNLEEVSNYLRIVSQRSTEVPEELEE------IYNSLHSLLHDHAVLVKILSLVSTLNFIYPDVREDRLQALLGNMQVAIQQKNEELRVAQGTVLALTVRRGILGGGGGGEVSQSISRKAFDMRNSRARDDWTSEFTILRLALQPENNAAWI-TEMLDDLGLQSHQRT-PLLV---GVKACDLSRSMFQVTCATPVCLLNGSILKTHIWCAASDGSVAVFSLYNQSLEMTETF-RPVDAYVTA---AAVVPGCPTSSQNKEDEVWMATDTAEIFLHSTVESKRREPRKKVDVPATVTSMLCWDKSIYCGDVSGNLLCFNQNLLGNWNLQDPEVQSIADWPLRNLTVSQDGQQLLMSSGPCIISLGLESLRQLSRTDLSLEDADDNDEATKMGGSGGGHVRSFLLAGEGLWVCFENRPYVRLYYRPDMRLVQTFDIRPAFAKVNAKTHRHPESTVPAATAVAVTRGLLWVGTSVGLLYLLRTPR----LDGGVPVAFGPPLICCHSHRGPITALLTYRNI 901          
BLAST of Rho guanine nucleotide exchange factor 10 vs. TrEMBL
Match: A0A267DEA6 (DH domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005772g3 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.954e-11
Identity = 135/681 (19.82%), Postives = 282/681 (41.41%), Query Frame = 1
Query:  601 LTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLD--KR--QQIVESNEISEIRNCMKQIKTPIK-SR-KIMFKSSVYYLKPNF---NIPRKLIKLPYILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNI---FRFSIEKNSQY---EFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKERELNNYFASIINLTM----------TESGSVKDNKMFQFDSARFATEWKINFHRIKFSMGLDESINWLLTTKQDIFQLSSKEEAFPLLFPPYDLQNNGIINMKLNVINCQVITIVIGSKISRCLWLSMSDGYVVILHFNYKEWIVLESFPTKIDGPISNLCNYSIFDSC-IADIKIDIEIWMMYKN-EIISHSLLHNQRSVEKYRISLRKEGAAICQVKEKMFIGLHPNEIAIYSKSSYSQWCLESLIFMN------KCLMSLEENIQNLIFDNELILYVVCD--REIILVDVS----DDKNVPIKIF-TANENITCFNYSSDGIWIATSKDMTLTLYDKNLNTVLQTLSIPVSY---------FGKCTYDSIIAVILTDKYLWIGTEAGYIMIISTVNRLFCVDSIITTYLHSNFSC-----APINILLPFQNV 2481
            L L  I++ P+QRFPQL  V+ D+ K T   + +R DL      I+ ++  L+  KR  +Q++ + ++  +R      K+ +K SR +I+ +  V  L+ +    +     I L    +LC                P E+++Y  L D  +S  ++    + ++E+ S Y     Q++ E+   +++      I   +  +L+D  ++ KI   V  LNF Y  + + +L   L  +Q+ + +K  EL     +++ LT+           E       K F   ++R   +W   F  ++ ++  + +  W+ T   D   L S +   PLL     ++   +      V     + ++ GS +   +W + SDG V +     +   + E+F   +D  ++     ++   C  +    + E+WM     EI  HS + ++R   + ++ +     ++    + ++ G     +  ++++    W L+     +      + L   ++  Q L+     I+ +  +  R++   D+S    DD +   K+  +   ++  F  + +G+W+       + LY +    ++QT  I  ++           + T  +  AV +T   LW+GT  G + ++ T      +D  +         C      PI  LL ++N+
Sbjct:  404 LPLLGILVRPVQRFPQLLLVVKDLLKYTEPDHPDRYDLLYAQTQIEHLASQLNDIKRDSEQLISARQM--LRALGVHSKSALKNSRIRIVREDDVSELRADRQQQHAGGMRIILTTYYVLC--------TGARRRGGPHELLWYTKLEDVRLSGTSLTPDMKVNLEEVSNYLRIVSQRSTEVPEELEE------IYNSLHSLLHDHAVLVKILSLVSTLNFIYPDVREDRLQALLGNMQVAIQQKNEELRVAQGTVLALTVRRGILGGGGGGEVSQSISRKAFDMRNSRARDDWTSEFTILRLALQPENNAAWI-TEMLDDLGLQSHQRT-PLLV---GVKACDLSRSMFQVTCATPVCLLNGSILKTHIWCAASDGSVAVFSLYNQSLEMTETF-RPVDAYVTAA---AVVPGCPTSSQNKEDEVWMATDTAEIFLHSTVESKRREPRKKVDVPATVTSMLCWDKSIYCGDVSGNLLCFNQNLLGNWNLQDPEVQSIADWPLRNLTVSQDGQQLLMSSGPCIISLGLESLRQLSRTDLSLEDADDNDEATKMGGSGGGHVRSFLLAGEGLWVCFENRPYVRLYYRPDMRLVQTFDIRPAFAKVNAKTHRHPESTVPAATAVAVTRGLLWVGTSVGLLYLLRTPR----LDGGVPVAFGPPLICCHSHRGPITALLTYRNI 1055          
BLAST of Rho guanine nucleotide exchange factor 10 vs. TrEMBL
Match: A0A267GCH4 (DH domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005772g2 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 4.162e-11
Identity = 135/681 (19.82%), Postives = 282/681 (41.41%), Query Frame = 1
Query:  601 LTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLD--KR--QQIVESNEISEIRNCMKQIKTPIK-SR-KIMFKSSVYYLKPNF---NIPRKLIKLPYILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNI---FRFSIEKNSQY---EFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKERELNNYFASIINLTM----------TESGSVKDNKMFQFDSARFATEWKINFHRIKFSMGLDESINWLLTTKQDIFQLSSKEEAFPLLFPPYDLQNNGIINMKLNVINCQVITIVIGSKISRCLWLSMSDGYVVILHFNYKEWIVLESFPTKIDGPISNLCNYSIFDSC-IADIKIDIEIWMMYKN-EIISHSLLHNQRSVEKYRISLRKEGAAICQVKEKMFIGLHPNEIAIYSKSSYSQWCLESLIFMN------KCLMSLEENIQNLIFDNELILYVVCD--REIILVDVS----DDKNVPIKIF-TANENITCFNYSSDGIWIATSKDMTLTLYDKNLNTVLQTLSIPVSY---------FGKCTYDSIIAVILTDKYLWIGTEAGYIMIISTVNRLFCVDSIITTYLHSNFSC-----APINILLPFQNV 2481
            L L  I++ P+QRFPQL  V+ D+ K T   + +R DL      I+ ++  L+  KR  +Q++ + ++  +R      K+ +K SR +I+ +  V  L+ +    +     I L    +LC                P E+++Y  L D  +S  ++    + ++E+ S Y     Q++ E+   +++      I   +  +L+D  ++ KI   V  LNF Y  + + +L   L  +Q+ + +K  EL     +++ LT+           E       K F   ++R   +W   F  ++ ++  + +  W+ T   D   L S +   PLL     ++   +      V     + ++ GS +   +W + SDG V +     +   + E+F   +D  ++     ++   C  +    + E+WM     EI  HS + ++R   + ++ +     ++    + ++ G     +  ++++    W L+     +      + L   ++  Q L+     I+ +  +  R++   D+S    DD +   K+  +   ++  F  + +G+W+       + LY +    ++QT  I  ++           + T  +  AV +T   LW+GT  G + ++ T      +D  +         C      PI  LL ++N+
Sbjct:  405 LPLLGILVRPVQRFPQLLLVVKDLLKYTEPDHPDRYDLLYAQTQIEHLASQLNDIKRDSEQLISARQM--LRALGVHSKSALKNSRIRIVREDDVSELRADRQQQHAGGMRIILTTYYVLC--------TGARRRGGPQELLWYTKLEDVRLSGTSLTPDMKVNLEEVSNYLRIVSQRSTEVPEELEE------IYNSLHSLLHDHAVLVKILSLVSTLNFIYPDVREDRLQALLGNMQVAIQQKNEELRVAQGTVLALTVRRGILGGGGGGEVSQSISRKAFDMRNSRARDDWTSEFTILRLALQPENNAAWI-TEMLDDLGLQSHQRT-PLLV---GVKACDLSRSMFQVTCATPVCLLNGSILKTHIWCAASDGSVAVFSLYNQSLEMTETF-RPVDAYVTAA---AVVPGCPTSSQNKEDEVWMATDTAEIFLHSTVESKRREPRKKVDVPATVTSMLCWDKSIYCGDVSGNLLCFNQNLLGNWNLQDPEVQSIADWPLRNLTVSQDGQQLLMSSGPCIISLGLESLRQLSRTDLSLEDADDNDEATKMGGSGGGHVRSFLLAGEGLWVCFENRPYVRLYYRPDMRLVQTFDIRPAFAKVNAKTHRHPESTVPAATAVAVTRGLLWVGTSVGLLYLLRTPR----LDGGVPVAFGPPLICCHSHRGPITALLTYRNI 1056          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Cavefish
Match: ect2 (epithelial cell transforming 2 [Source:ZFIN;Acc:ZDB-GENE-040831-2])

HSP 1 Score: 53.5286 bits (127), Expect = 1.036e-6
Identity = 50/220 (22.73%), Postives = 100/220 (45.45%), Query Frame = 1
Query:  232 NIRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFK------SLLTKSEFLFFYQLFPTIFDLHYALHL---ELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            + R Q  + L+QTE NY+    D+L+T+  LF     K       +L + E    +   P I+++H  +     EL+  +   +S+G +++K+    EL + Y  +V+           C + K   H    IN         +L+ L   ++ P+QR P +  +++DI K T D N +++ L + +  +K +   +++ ++  E  +     + E+  C
Sbjct:  382 SARWQVSKELYQTESNYV----DILATVLQLFKDPLEKEGQVGGPILAQEEIKTIFGSIPDIYEVHTRIKADLEELVMNWSEDKSVGDIILKY--SGELVKAYPPFVNFFEMSKETIVRCEKQKPRFHAFLKINQAKPECGRQTLVEL---LIRPVQRLPSVALLLNDIKKHTADHNPDKITLEKAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVDGC 592          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Cavefish
Match: arhgef10lb (Rho guanine nucleotide exchange factor (GEF) 10-like b [Source:ZFIN;Acc:ZDB-GENE-090313-222])

HSP 1 Score: 52.373 bits (124), Expect = 1.613e-6
Identity = 44/208 (21.15%), Postives = 99/208 (47.60%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMK 816
            +R   + ++ Q+EI+YL  ++ +L        +   + L +K     FY+L   I   H    + L   + E+  +++IG + +    K  + +VY  YV+N           C        ++  +  +  +   +TL  +++ PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++++++ E  ++SEI+   +
Sbjct:  141 VRRHILGSIVQSEISYLDSLKRILQDYQKPLLEAEPRILSSKKIQPIFYRL-KEILQCHAMFQIALASRVAEWDRTETIGDLFVASFSKSMVLDVYSDYVNNFTNAMALIKKACMSKPAFLEFLKKKQAASTD--RITLYGLMVKPIQRFPQFILLLQDMLKNTPAGHSDRLPLQLALTELETLAEKLNEQKRLAE--QLSEIQQLAR 343          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Cavefish
Match: arhgef10lb (Rho guanine nucleotide exchange factor (GEF) 10-like b [Source:ZFIN;Acc:ZDB-GENE-090313-222])

HSP 1 Score: 50.8322 bits (120), Expect = 7.431e-6
Identity = 44/204 (21.57%), Postives = 97/204 (47.55%), Query Frame = 1
Query:  235 IRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIR 804
            +R   + ++ Q+EI+YL  ++ +L        +   + L +K     FY+L   I   H    + L   + E+  +++IG + +    K  + +VY  YV+N           C        ++  +     +   +TL  +++ PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L++++++ E  ++SEI+
Sbjct:   49 VRRHILGSIVQSEISYLDSLKRILQDYQKPLLEAEPRILSSKKIQPIFYRL-KEILQCHAMFQIALASRVAEWDRTETIGDLFVASFSKSMVLDVYSDYVNNFTNAMALIKKACMSKPAFLEFLKKK--QAASTDRITLYGLMVKPIQRFPQFILLLQDMLKNTPAGHSDRLPLQLALTELETLAEKLNEQKRLAE--QLSEIQ 247          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Medaka
Match: ect2 (epithelial cell transforming 2 [Source:NCBI gene;Acc:101157762])

HSP 1 Score: 59.3066 bits (142), Expect = 1.720e-8
Identity = 59/238 (24.79%), Postives = 107/238 (44.96%), Query Frame = 1
Query:  178 CIDFDEDFNELFSKISPSNIRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFK------SLLTKSEFLFFYQLFPTIFDLHYALH---LELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            C    E    + SK S    R Q  R L+QTE NY+    D+LSTI  LF     K      ++L + E    +   P IF++H  +     EL+ ++  ++S+G + +K+    EL + Y  +V+           C + K   H    IN         +L+ L   ++ P+QR P +  +++DI K T D N +++ L + +  +K +   +++ ++  E  +     + E+  C
Sbjct:  361 CKGLTESSTPVLSKQS---ARWQVSRELYQTESNYV----DILSTILQLFKHPLEKEGQVGGAILAQEEVKTIFGNIPDIFEVHTQIKNDLEELLSDWSENRSVGNIFLKY--SKELVKAYPPFVNFFEMSKETIVRCEKQKPRFHAFLKINQAKPECGRQTLVEL---LIRPVQRLPSVALLLNDIRKHTSDDNPDKITLEKAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVDGC 586          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Medaka
Match: ect2 (epithelial cell transforming 2 [Source:NCBI gene;Acc:101157762])

HSP 1 Score: 58.5362 bits (140), Expect = 3.004e-8
Identity = 59/238 (24.79%), Postives = 107/238 (44.96%), Query Frame = 1
Query:  178 CIDFDEDFNELFSKISPSNIRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFK------SLLTKSEFLFFYQLFPTIFDLHYALH---LELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            C    E    + SK S    R Q  R L+QTE NY+    D+LSTI  LF     K      ++L + E    +   P IF++H  +     EL+ ++  ++S+G + +K+    EL + Y  +V+           C + K   H    IN         +L+ L   ++ P+QR P +  +++DI K T D N +++ L + +  +K +   +++ ++  E  +     + E+  C
Sbjct:  427 CKGLTESSTPVLSKQS---ARWQVSRELYQTESNYV----DILSTILQLFKHPLEKEGQVGGAILAQEEVKTIFGNIPDIFEVHTQIKNDLEELLSDWSENRSVGNIFLKY--SKELVKAYPPFVNFFEMSKETIVRCEKQKPRFHAFLKINQAKPECGRQTLVEL---LIRPVQRLPSVALLLNDIRKHTSDDNPDKITLEKAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVDGC 652          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Medaka
Match: arhgef10 (Rho guanine nucleotide exchange factor 10 [Source:NCBI gene;Acc:101157408])

HSP 1 Score: 58.5362 bits (140), Expect = 3.526e-8
Identity = 47/235 (20.00%), Postives = 109/235 (46.38%), Query Frame = 1
Query:  163 FERIKCIDFDEDFNELFSKISPSNIRLQCI-RTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQI 822
            F  + C + +         +S   +  +CI  ++ ++E NYL  ++ +L       ++   + L  +   + FY++   I   H+   + L   + E+   + IG V +    K  + + Y +YV+N           C       +++ ++  +  +   +TL  ++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L+++++  E+++  EIR+  K +
Sbjct:  448 FIEVDCFNVEPVLCPAPEGLSQQQLVRRCILESILESEKNYLNALKRILEHYEKPLSQIEPRLLSDRKLKMIFYRV-REILQCHFLFQIALASRVAEWDGLEMIGDVFVASFCKSMVLDAYSEYVNNFSTAMAVVRKTCISKPGFLDFLKHRQET--SSDRMTLYGLMMKPIQRFPQFILLLQDMLKNTPVGHADRLPLQMALTELETLAEKLNEKKR--EADQRCEIRHISKAM 677          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Medaka
Match: arhgef10 (Rho guanine nucleotide exchange factor 10 [Source:NCBI gene;Acc:101157408])

HSP 1 Score: 58.5362 bits (140), Expect = 3.544e-8
Identity = 47/235 (20.00%), Postives = 109/235 (46.38%), Query Frame = 1
Query:  163 FERIKCIDFDEDFNELFSKISPSNIRLQCI-RTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLEL---IKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDN-----------CAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQI 822
            F  + C + +         +S   +  +CI  ++ ++E NYL  ++ +L       ++   + L  +   + FY++   I   H+   + L   + E+   + IG V +    K  + + Y +YV+N           C       +++ ++  +  +   +TL  ++M PIQRFPQ   ++ D+ K T   + +R+ L   +  +++++  L+++++  E+++  EIR+  K +
Sbjct:  487 FIEVDCFNVEPVLCPAPEGLSQQQLVRRCILESILESEKNYLNALKRILEHYEKPLSQIEPRLLSDRKLKMIFYRV-REILQCHFLFQIALASRVAEWDGLEMIGDVFVASFCKSMVLDAYSEYVNNFSTAMAVVRKTCISKPGFLDFLKHRQET--SSDRMTLYGLMMKPIQRFPQFILLLQDMLKNTPVGHADRLPLQMALTELETLAEKLNEKKR--EADQRCEIRHISKAM 716          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Medaka
Match: ect2 (epithelial cell transforming 2 [Source:NCBI gene;Acc:101157762])

HSP 1 Score: 58.151 bits (139), Expect = 3.762e-8
Identity = 55/224 (24.55%), Postives = 104/224 (46.43%), Query Frame = 1
Query:  220 ISPSNIRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFK------SLLTKSEFLFFYQLFPTIFDLHYALH---LELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVD----------NCAEYK---HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNE-----ISEIRNC 810
            +S  + R Q  R L+QTE NY+    D+LSTI  LF     K      ++L + E    +   P IF++H  +     EL+ ++  ++S+G + +K+    EL + Y  +V+           C + K   H    IN         +L+ L   ++ P+QR P +  +++DI K T D N +++ L + +  +K +   +++ ++  E  +     + E+  C
Sbjct:  501 LSKQSARWQVSRELYQTESNYV----DILSTILQLFKHPLEKEGQVGGAILAQEEVKTIFGNIPDIFEVHTQIKNDLEELLSDWSENRSVGNIFLKY--SKELVKAYPPFVNFFEMSKETIVRCEKQKPRFHAFLKINQAKPECGRQTLVEL---LIRPVQRLPSVALLLNDIRKHTSDDNPDKITLEKAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVDGC 715          
BLAST of Rho guanine nucleotide exchange factor 10 vs. Planmine SMEST
Match: SMESG000022298.1 (SMESG000022298.1)

HSP 1 Score: 1791.93 bits (4640), Expect = 0.000e+0
Identity = 887/890 (99.66%), Postives = 888/890 (99.78%), Query Frame = 1
Query:  145 MSIRDWFERIKCIDFDEDFNELFSKISPSNIRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDNCAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSRKIMFKSSVYYLKPNFNIPRKLIKLPYILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKERELNNYFASIINLTMTESGSVKDNKMFQFDSARFATEWKINFHRIKFSMGLDESINWLLTTKQDIFQLSSKEEAFPLLFPPYDLQNNGIINMKLNVINCQVITIVIGSKISRCLWLSMSDGYVVILHFNYKEWIVLESFPTKIDGPISNLCNYSIFDSCIADIKIDIEIWMMYKNEIISHSLLHNQRSVEKYRISLRKEGAAICQVKEKMFIGLHPNEIAIYSKSSYSQWCLESLIFMNKCLMSLEENIQNLIFDNELILYVVCDREIILVDVSDDKNVPIKIFTANENITCFNYSSDGIWIATSKDMTLTLYDKNLNTVLQTLSIPVSYFGKCTYDSIIAVILTDKYLWIGTEAGYIMIISTVNRLFCVDSIITTYLHSNFSCAPINILLPFQNVHGYRLKNKYQIDFSKRNISDIPNVQLKRSNSSPCSVETTKLANISLSDEEQLQELRDEVDSKNNYTFDYIKNNTPLFIITFGNGLLKFSDFAKFGCEHPRKNELILLTFLE 2814
            MSIRDWFERIKCIDFDEDFNELFSKISPSNIRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDNCAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSRKIMFKSSVYYLKPNFNIPRKLIKLPYILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKERELNNYFASIINLTMTESGSVKDNKMFQFDSARFATEWKINFHRIKFSMGLDESINWLLTTKQDIFQLSSKEEAFPLLFPPYDLQNNGIINMKLNVINC+VITIVIGSKISRCLWLSMSDGYVVILHFNYKEWIVLESFPTKIDGPISNLCNYSIFDSCIADIKIDIEIWMMYKNEIISHSLLHNQRSVEKYRISLRKEGAAICQVKEKMFIGLHPNEIAIYSKSSYSQWCLESLIFMNKCLMSLEENIQNLIFDNELILYVVCDREIILVDVSDDKNVPIKIFTANENITCFNYSSDGIWIATSKDMTLTLYDKNLNTVLQTLSIPVSYFGKCTYDSIIAVILTDKYLWIGTEAGYIMIISTVNRLFCVDSIITTYLHSNFSCAPINILLPFQNVHGYRLKNKYQIDFSKRNISDIPNVQLKRSNSSPCSVETTKLANIS SDEEQLQELRDEVDSKNNYTFDYIKNNTPLFIITFGNGLLKFSDFAKFGCEHPRK ELILLTFLE
Sbjct:    1 MSIRDWFERIKCIDFDEDFNELFSKISPSNIRLQCIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPTIFDLHYALHLELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDNCAEYKHLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTNHERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSRKIMFKSSVYYLKPNFNIPRKLIKLPYILILCDSEIIIYPKNYPLNEVPSEMIFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILIEVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKERELNNYFASIINLTMTESGSVKDNKMFQFDSARFATEWKINFHRIKFSMGLDESINWLLTTKQDIFQLSSKEEAFPLLFPPYDLQNNGIINMKLNVINCRVITIVIGSKISRCLWLSMSDGYVVILHFNYKEWIVLESFPTKIDGPISNLCNYSIFDSCIADIKIDIEIWMMYKNEIISHSLLHNQRSVEKYRISLRKEGAAICQVKEKMFIGLHPNEIAIYSKSSYSQWCLESLIFMNKCLMSLEENIQNLIFDNELILYVVCDREIILVDVSDDKNVPIKIFTANENITCFNYSSDGIWIATSKDMTLTLYDKNLNTVLQTLSIPVSYFGKCTYDSIIAVILTDKYLWIGTEAGYIMIISTVNRLFCVDSIITTYLHSNFSCAPINILLPFQNVHGYRLKNKYQIDFSKRNISDIPNVQLKRSNSSPCSVETTKLANISSSDEEQLQELRDEVDSKNNYTFDYIKNNTPLFIITFGNGLLKFSDFAKFGCEHPRKKELILLTFLE 890          
The following BLAST results are available for this feature:
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGEF103.963e-820.84Rho guanine nucleotide exchange factor 10 [Source:... [more]
ARHGEF103.963e-820.84Rho guanine nucleotide exchange factor 10 [Source:... [more]
ARHGEF101.787e-720.32Rho guanine nucleotide exchange factor 10 [Source:... [more]
ARHGEF101.787e-720.32Rho guanine nucleotide exchange factor 10 [Source:... [more]
ARHGEF102.035e-720.32Rho guanine nucleotide exchange factor 10 [Source:... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL928723.36.493e-719.11Rho guanine nucleotide exchange factor (GEF) 10 [S... [more]
arhgef106.683e-719.11Rho guanine nucleotide exchange factor (GEF) 10 [S... [more]
arhgef106.683e-719.11Rho guanine nucleotide exchange factor (GEF) 10 [S... [more]
ect22.721e-622.27epithelial cell transforming 2 [Source:ZFIN;Acc:ZD... [more]
ect23.026e-622.27epithelial cell transforming 2 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
smn12.729e-623.64survival of motor neuron 1 [Source:Xenbase;Acc:XB-... [more]
smn13.664e-623.64survival of motor neuron 1 [Source:Xenbase;Acc:XB-... [more]
smn14.163e-623.64survival of motor neuron 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arhgef104.535e-722.75Rho guanine nucleotide exchange factor (GEF) 10 [S... [more]
Arhgef104.881e-722.75Rho guanine nucleotide exchange factor (GEF) 10 [S... [more]
Arhgef106.222e-722.75Rho guanine nucleotide exchange factor (GEF) 10 [S... [more]
Ect21.388e-623.64ect2 oncogene [Source:MGI Symbol;Acc:MGI:95281][more]
Ect21.547e-623.64ect2 oncogene [Source:MGI Symbol;Acc:MGI:95281][more]
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|O15013|ARHGA_HUMAN9.772e-720.32Rho guanine nucleotide exchange factor 10 OS=Homo ... [more]
sp|Q8C033|ARHGA_MOUSE3.414e-622.75Rho guanine nucleotide exchange factor 10 OS=Mus m... [more]
sp|Q07139|ECT2_MOUSE9.706e-623.64Protein ECT2 OS=Mus musculus OX=10090 GN=Ect2 PE=1... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6GT716.138e-1317.51Uncharacterized protein OS=Cuerna arida OX=1464854... [more]
A0A267E9922.744e-1119.85DH domain-containing protein (Fragment) OS=Macrost... [more]
A0A1I8HM433.827e-1119.82DH domain-containing protein OS=Macrostomum lignan... [more]
A0A267DEA63.954e-1119.82DH domain-containing protein (Fragment) OS=Macrost... [more]
A0A267GCH44.162e-1119.82DH domain-containing protein (Fragment) OS=Macrost... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ect21.036e-622.73epithelial cell transforming 2 [Source:ZFIN;Acc:ZD... [more]
arhgef10lb1.613e-621.15Rho guanine nucleotide exchange factor (GEF) 10-li... [more]
arhgef10lb7.431e-621.57Rho guanine nucleotide exchange factor (GEF) 10-li... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ect21.720e-824.79epithelial cell transforming 2 [Source:NCBI gene;A... [more]
ect23.004e-824.79epithelial cell transforming 2 [Source:NCBI gene;A... [more]
arhgef103.526e-820.00Rho guanine nucleotide exchange factor 10 [Source:... [more]
arhgef103.544e-820.00Rho guanine nucleotide exchange factor 10 [Source:... [more]
ect23.762e-824.55epithelial cell transforming 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022298.10.000e+099.66SMESG000022298.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008699 ID=SMED30008699|Name=Rho guanine nucleotide exchange factor 10|organism=Schmidtea mediterranea sexual|type=transcript|length=2862bp
CGATCTTAAAAATTATGATGCAAGTTTCAAATGTGGTTATAGTGCTTAAT
AATTGCACACATTGAACTTTAACAAATCAATAATGGTACCTATGGAATGA
TTGTTTTGATGTCAGTTATTCTCAATAATAAATTAATTTTAGACATGAGC
ATTCGTGACTGGTTTGAAAGAATAAAATGTATTGATTTTGACGAAGACTT
CAATGAACTATTTTCCAAAATTAGTCCTTCCAATATAAGGTTGCAATGCA
TAAGGACTTTGTTTCAAACGGAAATAAATTATTTGAAAAAAATCCGAGAC
CTCTTATCTACAATAAATATGTTGTTTAACAAGTTCACCTTTAAATCATT
ACTAACTAAAAGCGAATTTCTATTTTTCTATCAATTGTTTCCAACTATTT
TCGATTTGCATTATGCCTTGCATCTTGAATTGATTAAAGAATTCAAGTCT
TCGCAATCAATTGGAAAAGTTTTAATCAAACATTTAGTGAAGCCGGAATT
ATCTGAAGTCTACTTGAAGTATGTTGATAATTGTGCTGAATATAAGCATT
TATGTAACTACATTAACAATCAAGGTTTAAGCATTAAAAATCCATCATTA
CTTACTCTAGAATCAATAGTTATGATGCCAATTCAGAGATTTCCTCAACT
ACACTGTGTTATATCGGATATTTATAAGAAAACATTTGACACAAATCACG
AAAGAGTTGATTTATACAGAGTTATGTGTATTATAAAATCGATTTCAATG
AGTCTTGATAAACGCCAACAAATTGTAGAATCAAATGAGATCAGTGAAAT
ACGAAACTGTATGAAACAAATCAAAACTCCCATAAAATCCCGAAAAATAA
TGTTCAAAAGCTCAGTCTATTATTTAAAACCCAACTTTAATATTCCTAGA
AAACTTATAAAGCTGCCTTATATTTTGATTTTATGTGACAGTGAAATTAT
TATTTATCCGAAAAACTATCCTTTGAATGAAGTTCCTTCAGAAATGATTT
TTTATTATTCACTAGCAGATACGAATATCAGTATTAAGAATATCTTTCGT
TTTAGTATTGAAAAAAATTCCCAATATGAATTTCAGAAAGCCAAAGAACT
TTTCCCGCTGATTAAAGATTCTTTCATAAACGATAAAATATTAATTGAAG
TAGAAGAGATTTTAAATGATTTTAATATAATAAATAAGATTTTTGATGAA
GTAAAAAATTTGAATTTTCGCTATAATTCAATAGACCAAGTTAAACTTTC
AAGATCTCTATTGACATTGCAAATAAAATTAAATGAAAAAGAACGGGAAT
TGAATAATTATTTTGCGTCAATAATAAATTTAACAATGACTGAATCTGGT
TCAGTAAAGGATAATAAAATGTTTCAATTCGATTCTGCCAGATTTGCAAC
TGAATGGAAAATTAATTTCCATCGTATTAAATTTTCTATGGGTTTAGATG
AATCTATTAATTGGCTGCTTACAACAAAACAAGACATATTTCAATTGTCA
TCCAAAGAAGAAGCTTTTCCTTTACTTTTTCCGCCGTATGATTTACAGAA
TAATGGCATCATCAATATGAAATTAAATGTTATTAATTGTCAAGTTATAA
CGATTGTGATTGGCTCAAAAATATCTCGTTGCTTATGGCTGTCTATGAGC
GATGGTTACGTTGTTATTCTTCATTTCAACTATAAAGAATGGATCGTGTT
AGAGAGTTTTCCCACGAAAATTGATGGTCCCATTAGTAATTTGTGTAATT
ACAGTATTTTTGATTCATGTATTGCCGATATTAAAATTGATATTGAAATA
TGGATGATGTATAAAAACGAAATCATATCACATTCCCTGTTACATAATCA
GAGATCAGTCGAAAAGTATCGCATTTCTCTACGTAAAGAGGGAGCTGCAA
TTTGCCAAGTAAAAGAAAAAATGTTTATTGGTTTACATCCAAATGAAATA
GCAATTTATTCAAAAAGTTCTTATTCGCAATGGTGCCTTGAGTCGTTAAT
ATTTATGAATAAATGCCTTATGTCTTTGGAAGAAAATATTCAGAATTTAA
TTTTTGATAATGAACTCATACTTTATGTTGTATGCGATCGTGAAATAATT
CTTGTTGACGTTTCTGATGATAAAAATGTTCCTATAAAAATATTTACTGC
CAACGAAAACATAACATGCTTCAATTACTCTTCAGATGGAATATGGATTG
CTACTTCCAAAGATATGACTTTGACATTGTATGATAAGAATTTAAATACA
GTTTTGCAAACATTAAGCATTCCAGTCTCATATTTTGGAAAATGTACATA
TGATTCTATAATAGCTGTTATTTTAACTGATAAATACTTATGGATAGGAA
CTGAAGCTGGCTACATAATGATTATTTCAACTGTCAATAGATTGTTTTGC
GTCGATTCTATAATCACAACATATTTACATTCTAATTTCTCTTGTGCTCC
CATTAATATTCTTTTGCCATTTCAAAATGTTCATGGATATCGCTTGAAAA
ATAAATACCAAATAGATTTTAGTAAAAGAAACATTTCGGATATACCAAAT
GTGCAGTTAAAAAGATCTAATTCTTCTCCTTGTTCTGTTGAAACAACAAA
ACTTGCAAATATCAGTTTATCCGATGAAGAACAATTGCAAGAACTCAGAG
ATGAAGTGGATTCTAAAAATAATTATACATTTGATTATATAAAAAATAAC
ACACCTCTGTTTATAATAACGTTTGGAAATGGATTGCTTAAGTTTTCAGA
TTTTGCTAAATTTGGTTGTGAACATCCTCGAAAGAATGAACTGATTTTAT
TAACTTTTTTAGAATAAAATTTTAATAAACATTAATCTATTACACACTTT
TCTAATGAATGC
back to top

protein sequence of SMED30008699-orf-1

>SMED30008699-orf-1 ID=SMED30008699-orf-1|Name=SMED30008699-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=907bp
MIVLMSVILNNKLILDMSIRDWFERIKCIDFDEDFNELFSKISPSNIRLQ
CIRTLFQTEINYLKKIRDLLSTINMLFNKFTFKSLLTKSEFLFFYQLFPT
IFDLHYALHLELIKEFKSSQSIGKVLIKHLVKPELSEVYLKYVDNCAEYK
HLCNYINNQGLSIKNPSLLTLESIVMMPIQRFPQLHCVISDIYKKTFDTN
HERVDLYRVMCIIKSISMSLDKRQQIVESNEISEIRNCMKQIKTPIKSRK
IMFKSSVYYLKPNFNIPRKLIKLPYILILCDSEIIIYPKNYPLNEVPSEM
IFYYSLADTNISIKNIFRFSIEKNSQYEFQKAKELFPLIKDSFINDKILI
EVEEILNDFNIINKIFDEVKNLNFRYNSIDQVKLSRSLLTLQIKLNEKER
ELNNYFASIINLTMTESGSVKDNKMFQFDSARFATEWKINFHRIKFSMGL
DESINWLLTTKQDIFQLSSKEEAFPLLFPPYDLQNNGIINMKLNVINCQV
ITIVIGSKISRCLWLSMSDGYVVILHFNYKEWIVLESFPTKIDGPISNLC
NYSIFDSCIADIKIDIEIWMMYKNEIISHSLLHNQRSVEKYRISLRKEGA
AICQVKEKMFIGLHPNEIAIYSKSSYSQWCLESLIFMNKCLMSLEENIQN
LIFDNELILYVVCDREIILVDVSDDKNVPIKIFTANENITCFNYSSDGIW
IATSKDMTLTLYDKNLNTVLQTLSIPVSYFGKCTYDSIIAVILTDKYLWI
GTEAGYIMIISTVNRLFCVDSIITTYLHSNFSCAPINILLPFQNVHGYRL
KNKYQIDFSKRNISDIPNVQLKRSNSSPCSVETTKLANISLSDEEQLQEL
RDEVDSKNNYTFDYIKNNTPLFIITFGNGLLKFSDFAKFGCEHPRKNELI
LLTFLE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0019894kinesin binding
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
GO:0005829cytosol
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0022011myelination in peripheral nervous system
GO:0051298centrosome duplication
GO:0051496positive regulation of stress fiber assembly
GO:0090307mitotic spindle assembly
GO:0090630activation of GTPase activity
GO:0035023regulation of Rho protein signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035899DBL_dom_sf
IPR039919ARHGEF10/ARHGEF17
IPR036322WD40_repeat_dom_sf
IPR000219DH-domain
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000219Dbl homology (DH) domainSMARTSM00325RhoGEF_3coord: 51..222
e-value: 0.0017
score: 17.5
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 51..218
e-value: 2.2E-10
score: 41.1
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 47..223
score: 15.255
IPR035899Dbl homology (DH) domain superfamilyGENE3DG3DSA:1.20.900.10coord: 36..239
e-value: 1.4E-12
score: 49.5
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 41..224
IPR039919Rho guanine nucleotide exchange factor 10/17PANTHERPTHR12877RHO GUANINE NUCLEOTIDE EXCHANGE FACTORcoord: 348..827
coord: 46..201
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 608..768