SMED30008695

Overview
NameSMED30008695
Smed IDSMED30008695
Length (bp)4607
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30008695 (SMED30008695) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30008695 (SMED30008695) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30008695 (SMED30008695) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30008695 (SMED30008695) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008695

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30008695SMESG000053808.1 dd_Smed_v4_7928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008695SMESG000053808.1 dd_Smed_v4_7928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008695SMESG000053808.1 dd_Smed_v4_7928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008695SMESG000053808.1 dd_Smed_v4_7928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30008695SMESG000053808.1 dd_Smed_v4_7928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30008695SMESG000053808.1 dd_Smed_v4_7928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30008695SMESG000053808.1 dd_Smed_v4_7928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008695SMESG000066407.1 SMESG000053808.1 SMESG000046471.1 Contig49334newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008695SMESG000066407.1 SMESG000053808.1 SMESG000046471.1 Contig49334uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30008695 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005772:891..8131 -17155
Homology
BLAST of SMED30008695 vs. Ensembl Xenopus
Match: wdcp (WD repeat and coiled coil containing [Source:Xenbase;Acc:XB-GENE-5729803])

HSP 1 Score: 57.3806 bits (137), Expect = 2.963e-7
Identity = 64/275 (23.27%), Postives = 121/275 (44.00%), Query Frame = 2
Query: 1016 LLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEFERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNLQLKSSDVERIEKEKFE-------LENDFQQLMENNSEKESTIQNL-KENLSNLKASYDRVT------TERDQAFVGIEKFRQEIDQVVNQFELTRQDLTNKEQVLKLAEE-----LNDDLKEKLTKQTEESINRDKMISLLKSE 1783
            LL  QR  E +    ++ +  LV   +  LN    +  + EQ  K+   T+E  + LE    E ++ YD+ +   E     +++L++    L  ++D + A+L R              LR + +   D L+   + + R++K   E       L N+ ++ +    EK   + +L +E    +KA+ D  T      TE ++   G+EK ++E + V+   +    ++ N  Q++  AE      L + L EK+   T+E   RD    +L++E
Sbjct: 1594 LLSPQRAPERLLQLAQNNQDTLVIEMDELLNRAAKVTADGEQTGKDAERTNERAKQLEDFVKETLHIYDKAVKLNETLGIPNKTLDKSFQELQKDIDSMMAELRRK------------SLRNQKNTADDELKAAEALLNRVKKLFLEAHKKNEDLNNEVKEKLGLFEEKLDDVWDLLREARGKIKAADDLSTVNQKNMTELERKKQGVEKGKKETESVLGDGDSIMTEVNNLAQIINEAENVKLPPLTEQLNEKINNLTQEIARRDLPEQILQAE 1856          
BLAST of SMED30008695 vs. TrEMBL
Match: A0A2T7PDU0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06986 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.566e-11
Identity = 95/408 (23.28%), Postives = 206/408 (50.49%), Query Frame = 2
Query:  452 IKLESKLSRLCQENEDYLRERIQTKSELEIVKQKLFDXXXXXXXXXXXXXXX-----XXXXXXXXXXACELENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQNCVVSDLKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFENQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEFERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNLQLKSSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLKASYDRVTTERDQAFVGIEKFRQEIDQVVNQFELTRQDL 1660
            ++L+ +L  L QE +D L+ER + +++L  ++ KL      T+  E+             R + +R+A E++  L++K  EL+S       +S ++ + Q+ +++   +M+ + +DL  +   V  LK K++E + +++ T   K  ++ +A   + +LV + KA+ W++ QL    E + KLQ ++  +    +      E ++ ++  L  +L + QE  L E   L   LE +  +++  +   + ++ E   I + ++ +++ +E E+    SL QL  +L  +L++ +A   +    V  LE++ MEL KKL + QD L  K   +E + ++  E+E+     M+  + K++ +  L+E  ++ + + +    E+      +E  + ++ +V   F+  RQ+L
Sbjct:  553 VRLQGELEVLKQEAQDTLQERAELQAQLASLQLKLKSGHMATDYAEKASLRAELERLRSTRMDHEREALEVQRLLEEKMEELKS-------VSEDLYQSQDTVDKLQVRMKELRDDLQAKEVTVQALKSKIAELYVEVQTTLQNKMEADSEARTARNDLVVLVKAKEWYQEQLSVAHEVRAKLQQQLTHLQAQTMSQGSIVERLKLESTRLRQQLRESQERALREKEQLARHLETIQNDMMEREAAFQEIQRERLMIEDTFNTQVTTVEEEKSRISSLLQLTSDLEAQLEQAQASSKKKQMQVFSLENEQMELMKKLTLSQDALVEKDQILEELSQKLIEVESQLSAFMKTLAAKDAELHKLREEKASTEIALNSALQEKASVDHALETLKGDMGKVEKSFKQMRQEL 953          
BLAST of SMED30008695 vs. TrEMBL
Match: A0A3Q3MVS4 (Uncharacterized protein OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 9.288e-11
Identity = 103/470 (21.91%), Postives = 226/470 (48.09%), Query Frame = 2
Query:  428 EERLRVMN--IKLESKLSRLCQENEDYLRERIQTKSELEIVKQKLFDXXXXXXXXXXXXXXXXXXXXXXXXXACELENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQNCVVSDLKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFENQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEFERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNLQLKSSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLKASYDRVTTERDQ--------------AFVGIEKFRQEIDQVVNQFELTRQDLTN-KEQVLKLAEELNDDLKEKLTKQTEESINRDKMISLLKSEK 1786
            +E L+V+   ++LE +L  L  E    L+E+ + +++L  V  +L   K   ++ +E+  ++N E    ++   +LE ++ + +  L SK      +SN++   ++  N+   K+  + N +  ++  V +L+ ++   H QL+  +L +   + + +  Q E+  +++ R W++ QL   +E + +LQ E+  +    +      E ++ +N +L  +L + Q   + +   +  +L+ +  +++  +   + ++   S + +    K+ E E ER+    +      L  EL+++R  L + D  +  L+ + +EL ++L   Q+NLQ K   + ++E    ELE    +L  ++S K+  IQ L+     L+ +      ++ Q              A   +++ RQE+    NQ E  +Q+ ++ K+Q  KL E+     K  +     ++ ++D++IS LKS K
Sbjct:  328 DEMLQVLKEKMRLEGQLESLSSEANQALKEKTELQAQLATVNAQLQAKKEEAQVSQEKQSILNTEVGTLRKTCSQLEKAMVELQGSLESKNASLASVSNDLKVAEDQYNRLMGKVEEMQNTVTSRDTAVQELRLQMGGLHGQLQQVQLERSTLQSRLKTSQAEIDSLQQVRLWYQQQLALAQEARVRLQSEMANMQAGQMTQIGVLEHLKLENVTLSHQLNETQHRSIKDKERIAVQLQSIEADMLTQEAAYKQIQDAKSMVEDDLQLKLDEFEEERDRLIKMANTASTLERELEQVRLTLSQKDLQLQSLQKEHLELMRQLTTTQENLQTKEQSINQLEARYLELEAQLAELQTDSSAKDDNIQFLQNEKIVLEVALQAARADKSQLDENAERLGEDVLIASDVLDQLRQEVQVKANQIETLKQENSSLKKQAQKLKEQFQQQ-KVMVEAYRRDASSKDQLISELKSTK 796          
BLAST of SMED30008695 vs. TrEMBL
Match: A0A3Q3FWS1 (Uncharacterized protein OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.212e-10
Identity = 103/470 (21.91%), Postives = 226/470 (48.09%), Query Frame = 2
Query:  428 EERLRVMN--IKLESKLSRLCQENEDYLRERIQTKSELEIVKQKLFDXXXXXXXXXXXXXXXXXXXXXXXXXACELENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQNCVVSDLKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFENQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEFERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNLQLKSSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLKASYDRVTTERDQ--------------AFVGIEKFRQEIDQVVNQFELTRQDLTN-KEQVLKLAEELNDDLKEKLTKQTEESINRDKMISLLKSEK 1786
            +E L+V+   ++LE +L  L  E    L+E+ + +++L  V  +L   K   ++ +E+  ++N E    ++   +LE ++ + +  L SK      +SN++   ++  N+   K+  + N +  ++  V +L+ ++   H QL+  +L +   + + +  Q E+  +++ R W++ QL   +E + +LQ E+  +    +      E ++ +N +L  +L + Q   + +   +  +L+ +  +++  +   + ++   S + +    K+ E E ER+    +      L  EL+++R  L + D  +  L+ + +EL ++L   Q+NLQ K   + ++E    ELE    +L  ++S K+  IQ L+     L+ +      ++ Q              A   +++ RQE+    NQ E  +Q+ ++ K+Q  KL E+     K  +     ++ ++D++IS LKS K
Sbjct:  285 DEMLQVLKEKMRLEGQLESLSSEANQALKEKTELQAQLATVNAQLQAKKEEAQVSQEKQSILNTEVGTLRKTCSQLEKAMVELQGSLESKNASLASVSNDLKVAEDQYNRLMGKVEEMQNTVTSRDTAVQELRLQMGGLHGQLQQVQLERSTLQSRLKTSQAEIDSLQQVRLWYQQQLALAQEARVRLQSEMANMQAGQMTQIGVLEHLKLENVTLSHQLNETQHRSIKDKERIAVQLQSIEADMLTQEAAYKQIQDAKSMVEDDLQLKLDEFEEERDRLIKMANTASTLERELEQVRLTLSQKDLQLQSLQKEHLELMRQLTTTQENLQTKEQSINQLEARYLELEAQLAELQTDSSAKDDNIQFLQNEKIVLEVALQAARADKSQLDENAERLGEDVLIASDVLDQLRQEVQVKANQIETLKQENSSLKKQAQKLKEQFQQQ-KVMVEAYRRDASSKDQLISELKSTK 753          
BLAST of SMED30008695 vs. TrEMBL
Match: A0A3Q3GRV1 (Golgin A3 OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.005e-10
Identity = 103/470 (21.91%), Postives = 226/470 (48.09%), Query Frame = 2
Query:  428 EERLRVMN--IKLESKLSRLCQENEDYLRERIQTKSELEIVKQKLFDXXXXXXXXXXXXXXXXXXXXXXXXXACELENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQNCVVSDLKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFENQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEFERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNLQLKSSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLKASYDRVTTERDQ--------------AFVGIEKFRQEIDQVVNQFELTRQDLTN-KEQVLKLAEELNDDLKEKLTKQTEESINRDKMISLLKSEK 1786
            +E L+V+   ++LE +L  L  E    L+E+ + +++L  V  +L   K   ++ +E+  ++N E    ++   +LE ++ + +  L SK      +SN++   ++  N+   K+  + N +  ++  V +L+ ++   H QL+  +L +   + + +  Q E+  +++ R W++ QL   +E + +LQ E+  +    +      E ++ +N +L  +L + Q   + +   +  +L+ +  +++  +   + ++   S + +    K+ E E ER+    +      L  EL+++R  L + D  +  L+ + +EL ++L   Q+NLQ K   + ++E    ELE    +L  ++S K+  IQ L+     L+ +      ++ Q              A   +++ RQE+    NQ E  +Q+ ++ K+Q  KL E+     K  +     ++ ++D++IS LKS K
Sbjct:  395 DEMLQVLKEKMRLEGQLESLSSEANQALKEKTELQAQLATVNAQLQAKKEEAQVSQEKQSILNTEVGTLRKTCSQLEKAMVELQGSLESKNASLASVSNDLKVAEDQYNRLMGKVEEMQNTVTSRDTAVQELRLQMGGLHGQLQQVQLERSTLQSRLKTSQAEIDSLQQVRLWYQQQLALAQEARVRLQSEMANMQAGQMTQIGVLEHLKLENVTLSHQLNETQHRSIKDKERIAVQLQSIEADMLTQEAAYKQIQDAKSMVEDDLQLKLDEFEEERDRLIKMANTASTLERELEQVRLTLSQKDLQLQSLQKEHLELMRQLTTTQENLQTKEQSINQLEARYLELEAQLAELQTDSSAKDDNIQFLQNEKIVLEVALQAARADKSQLDENAERLGEDVLIASDVLDQLRQEVQVKANQIETLKQENSSLKKQAQKLKEQFQQQ-KVMVEAYRRDASSKDQLISELKSTK 863          
BLAST of SMED30008695 vs. TrEMBL
Match: A0A087W1C5 (UDP galactose transporter OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000209500 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.334e-10
Identity = 154/677 (22.75%), Postives = 294/677 (43.43%), Query Frame = 2
Query:  425 EEERLRVMNIKLESKLSRLCQENEDYLRERIQTKSELEIVKQKLFDXXXXXXXXXXXXXXXXXXXXXXXXXACELENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQNCVVSD-----LKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFENQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTA-LLFELEQLHKEIVITDEEKRVLESEYSE------IVNKYDEKISELEFERENSRSLNQLIDNLS---VELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNL---------QLK-----SSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLKASYDRVTTERDQAFVGIEKFRQEIDQVVNQFE---LTRQDLTNKEQVLKLAEELNDDLKEKLTKQTEESINRDKMISLLKSEKXXXXXXXXXXXXXXXXXXXXXDSLRANFNLANITIAGLEEELNSIKSDNRDLNDKVSISKTEVETFKIELLAAQEQIESLSRIQTAYGTLFENHKKLEFGYNELFGQHQTLTEQFKQVTGNLQAKLDEREGELERIVAIK-EEIVCATHKDLLLADQNRKE---LKSELETLKFNHTIEIATKDEQFREQL 2347
            EE+RLR+    LE +LS   +E E +LRER +   E   ++++L                          K+CE +  L+  + +L  K ++ EQ+S  +   Q++      ++  +     QQN V  D     L+KK+SE ++ +E  ++    +      L  EL  +++++ W+  QL+  E  +D+L  +++ +  WL  S    + +  +N  LE K++   E+ L E    L  ELE +  +I+   E + + E   +E      +  +   +I+E +     SR ++ L  +LS   +E+ E+R+ LDR    +  +E++   LR  ++ L+  +         QL       S + R+E   +E   +  + +E  +  ES++  + +  + L A  +++  +  +        + E+D   ++     L R +L+N  +VL+ A      L EK  K  E    R+++                  Q  +L +  E + LR +      +IA   EE  S   +   L  ++    ++ E  + EL   +EQ+ SL   Q  Y  L   H+ L+  Y+ L   +    E+      +L+ +L + E    + +  K  EI   TH+     D+  K+   L+SE+ +LK +H   +A +D  + +QL
Sbjct:  168 EEDRLRLHAACLEGRLSVYGREAETWLRERAELSMEAASLRKRL----------------------EAMNKSCEAQELLRHVQEQLSLKTLENEQLSANLTAAQQDSIYLKSQLADV-----QQNSVAKDQALASLRKKISELYADMESIRMAHSQALDNKTDLTAELASLRRSQEWYREQLQLTEAARDRLMEQLNSMRKWLDQSGTSAQQLAQENARLETKVMSG-EVALAEAKRNLSHELEVIRADIL---EREAIFEKILAERADLEALCRQKSHQITECQ-----SR-ISTLQSDLSETEMEVSELRSSLDRLRHTLQCVETERDNLRATVNGLEAQMNQQNALMDQQLAQYKDVCSKLTRLEGSSYEQAGNLNRALEEKAALESSLTAIHKEKATLDACLNQLKEDMSRVESNFSALQCELDSKNSELSNVLLIRDELSNDLEVLQAA------LHEKGEKVKELESEREQL------------------QNASLSLQLENEGLRDDVKRLEASIAPACEEAASKARE--PLITEIERINSQSEALQTELKCVREQVASLLVDQERYCALLTTHQALQQQYDALSSAYTASMEEANAKQTDLRQRLQQVEASYSQALLTKSSEIDSLTHQ----LDEKAKDALALQSEIASLKVSHQQSLAQQDADWAQQL 777          
BLAST of SMED30008695 vs. Ensembl Medaka
Match: golga3 (golgin A3 [Source:NCBI gene;Acc:101163091])

HSP 1 Score: 64.3142 bits (155), Expect = 1.164e-9
Identity = 102/470 (21.70%), Postives = 227/470 (48.30%), Query Frame = 2
Query:  428 EERLRVMN--IKLESKLSRLCQENEDYLRERIQTKSELEIVKQKLFDXXXXXXXXXXXXXXXXXXXXXXXXXACELENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQNCVVSDLKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFENQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEFERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNLQLKSSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLKASYDRVTTERDQAFVGIEK--------------FRQEIDQVVNQFE-LTRQDLTNKEQVLKLAEELNDDLKEKLTKQTEESINRDKMISLLKSEK 1786
            +E L+V+   ++LE +L  L  E    L+E+ + +++L  V  +L   K   +  +E+   +  E    ++   +LE ++ + +A L SK      +SN++   ++  N+   K+  + N +N ++  V DL+++++  H QL+  +L +   + + +  Q E+  +++ R W++ QL   +E + +LQ E+  +    +      E ++ +N +L  +L + Q   + E   +  +L+ +  +++  +   + ++   + + +    K+ E E E+E    L     +L  EL++++  L + D  +  L+ + +EL +++   Q+NL  K   + ++E    ELE +  +L   N+ K+  I+ L+     L+ +      ++ Q   G E+               RQE+    +Q E L +++ + K+Q  KL E+ +   K  +     ++ ++D++IS LKS K
Sbjct:  419 DEMLQVLKEKMRLEGQLESLSSEATQALKEKTELQAQLATVNAQLEAKKGEAQASQEKQGALTVELGTLRQNCTQLEKAMVELQASLESKNAGLTSLSNDLKVSEDQYNRLMGKVEELQNAVNSRDNTVQDLRQQMAGLHGQLQQVQLERSTLQSRLKTSQAEIDSLQQVRQWYQQQLALAQEARVRLQSEMANMQAGQMTQIGVLEYLKLENVTLSNQLTETQHRSIKEKERIAVQLQSIETDMLTQEAAYKQIQDAKTMVEDDLQRKLDEFEEEQERLTKLANTASSLERELEQVKLALSQKDIQLQSLQKEHLELMRQMTATQENLHTKEQAIGQLEARYQELEAELSELQSENNAKDDNIRFLQNEKIVLEVALQAARADKSQLDEGAERLGEDILVASDVLDQLRQEVQVKASQIENLQQENSSLKKQAQKLKEQFHQQ-KVMVEAYRRDASSKDQLISELKSTK 887          
BLAST of SMED30008695 vs. Ensembl Medaka
Match: golga3 (golgin A3 [Source:NCBI gene;Acc:101163091])

HSP 1 Score: 63.5438 bits (153), Expect = 1.764e-9
Identity = 102/470 (21.70%), Postives = 227/470 (48.30%), Query Frame = 2
Query:  428 EERLRVMN--IKLESKLSRLCQENEDYLRERIQTKSELEIVKQKLFDXXXXXXXXXXXXXXXXXXXXXXXXXACELENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQNCVVSDLKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFENQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEFERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNLQLKSSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLKASYDRVTTERDQAFVGIEK--------------FRQEIDQVVNQFE-LTRQDLTNKEQVLKLAEELNDDLKEKLTKQTEESINRDKMISLLKSEK 1786
            +E L+V+   ++LE +L  L  E    L+E+ + +++L  V  +L   K   +  +E+   +  E    ++   +LE ++ + +A L SK      +SN++   ++  N+   K+  + N +N ++  V DL+++++  H QL+  +L +   + + +  Q E+  +++ R W++ QL   +E + +LQ E+  +    +      E ++ +N +L  +L + Q   + E   +  +L+ +  +++  +   + ++   + + +    K+ E E E+E    L     +L  EL++++  L + D  +  L+ + +EL +++   Q+NL  K   + ++E    ELE +  +L   N+ K+  I+ L+     L+ +      ++ Q   G E+               RQE+    +Q E L +++ + K+Q  KL E+ +   K  +     ++ ++D++IS LKS K
Sbjct:  378 DEMLQVLKEKMRLEGQLESLSSEATQALKEKTELQAQLATVNAQLEAKKGEAQASQEKQGALTVELGTLRQNCTQLEKAMVELQASLESKNAGLTSLSNDLKVSEDQYNRLMGKVEELQNAVNSRDNTVQDLRQQMAGLHGQLQQVQLERSTLQSRLKTSQAEIDSLQQVRQWYQQQLALAQEARVRLQSEMANMQAGQMTQIGVLEYLKLENVTLSNQLTETQHRSIKEKERIAVQLQSIETDMLTQEAAYKQIQDAKTMVEDDLQRKLDEFEEEQERLTKLANTASSLERELEQVKLALSQKDIQLQSLQKEHLELMRQMTATQENLHTKEQAIGQLEARYQELEAELSELQSENNAKDDNIRFLQNEKIVLEVALQAARADKSQLDEGAERLGEDILVASDVLDQLRQEVQVKASQIENLQQENSSLKKQAQKLKEQFHQQ-KVMVEAYRRDASSKDQLISELKSTK 846          
BLAST of SMED30008695 vs. Planmine SMEST
Match: SMESG000053808.1 (SMESG000053808.1)

HSP 1 Score: 1972.21 bits (5108), Expect = 0.000e+0
Identity = 1132/1154 (98.09%), Postives = 1141/1154 (98.87%), Query Frame = 2
Query:   47 MFKQKHSDQEIDYEKEFKVVIGSNSPNKDYLKVNQTQNXXXXXXXXXXXXXXXXXPITPLEXXXXXXXXXXXXXXXATRSSNKDEIKQTEIGDSSDFGVSRDQGESYMSKIMKNVTKESKILIGDCEEERLRVMNIKLESKLSRLCQENEDYLRERIQTKSELEIVKQKLFDXXXXXXXXXXXXXXXXXXXXXXXXXACELENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQNCVVSDLKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFENQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEFERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNLQLKSSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLKASYDRVTTERDQAFVGIEKFRQEIDQVVNQFELTRQDLTNKEQVLKLAEELNDDLKEKLTKQTEESINRDKMISLLKSEKXXXXXXXXXXXXXXXXXXXXXDSLRANFNLANITIAGLEEELNSIKSDNRDLNDKVSISKTEVETFKIELLAAQEQIESLSRIQTAYGTLFENHKKLEFGYNELFGQHQTLTEQFKQVTGNLQAKLDEREGELERIVAIKEEIVCATHKDLLLADQNRKELKSELETLKFNHTIEIATKDEQFREQLDKATRDFSEMCQEKIRCETAITSLQDHIKLIIDECNKKTNEYKTKLLRLEQKSTEYAEHENINRXXXXXXXXXXXXXXXXXXXWREMKHHCEIVENASVRRDAQMAHLINKHEESMLEKDAEIRTLKEALNNQHDRLKSEENIKNNFAGQLEERVSVIDRLRTKVANYERNEIEMQMNLSLLNCGLESVFQENKTLKETQQQLKNEIENQKSENQKLMIQNQSLLENVDQAILSRDAERKTVDALQQDLDWKCKEISTNDIVHQDLMNGSQHAISEISTVLKDVTEQNDALIRKVELSNQQDLVMTSILSQLXXXXXXXXXXXXXXXXXDKSIRLSSEQLDQLKKLLNNSKAPTASFRNRLLADISSPIKNLQVKIDLIYFTLLAKI 3508
            MFKQKHSDQEIDYEKEFKVVIGSNSPNKDYLKVNQTQNLLKSLESFSRSSESLALPITPLESKKKSKMKRKNKSRSATRSSNKDEIKQTEIGDSSDFGVSRDQGESYMSKIMKNVTKESKILIGDCEEERLRVMNIKLESKLSRLCQENEDYLRERIQTKSELEIVKQKLFDTKSTTEILEEEIEVINRERENEKRKACELENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQNCVVSDLKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFENQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEFERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNLQLKSSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLKASYDRVTTERDQAFVGIEKFRQEIDQVVNQFELTRQDLTNKEQVLKLAEELNDDLKEKLTKQTEESINRDKMISLLKSEKNQLLENCQQFQQNNLQILQELDSLRANFNLANITIAGLEEELNSIKSDNRDLNDKVSISKTEVETFKIELLAAQEQIESLSRIQTAYGTLFENHKKLEFGYNELFGQHQTLTEQFKQVTGNLQAKLDEREGELERIVAIKEEIVCATHKDLLLADQNRKELKSELETLKFNHTIEIATKDEQFREQLDKATRDFSEMCQEKIRCETAITSLQDHIKLIIDECNKKTNEYKTKLLRLEQKSTEYAEHENINRALLEELEKKKGEIEAILEIWREMKHHCEIVENASVRRDAQMAHLINKHEESMLEKDAEIRTLKEALNNQHDRLKSEENIKNNFAGQLEERVSVIDRLRTKVANYERNEIEMQMNLSLLNCGLESVFQENKTLKETQQQLKNEIENQKSENQKLMIQNQSLLENVDQAILSRDAERKTVDALQQDLDWKCKEISTNDIVHQDLMNGSQHAISEISTVLKDVTEQNDALIRKVELSNQQDLVMTSILSQLKSEIKKIIFQEKIQKSKDKSIRLSSEQLDQLKKLLNNSKAPTASFR ++   IS  I++L+ +ID +   +  +I
Sbjct:    1 MFKQKHSDQEIDYEKEFKVVIGSNSPNKDYLKVNQTQNLLKSLESFSRSSESLALPITPLESKKKSKMKRKNKSRSATRSSNKDEIKQTEIGDSSDFGVSRDQGESYMSKIMKNVTKESKILIGDCEEERLRVMNIKLESKLSRLCQENEDYLRERIQTKSELEIVKQKLFDTKSTTEILEEEIEVINRERENEKRKACELENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQNCVVSDLKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFENQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQEIRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEFERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVLQDNLQLKSSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLKASYDRVTTERDQAFVGIEKFRQEIDQVVNQFELTRQDLTNKEQVLKLAEELNDDLKEKLTKQTEESINRDKMISLLKSEKNQLLENCQQFQQNNLQILQELDSLRANFNLANITIAGLEEELNSIKSDNRDLNDKVSISKTEVETFKIELLAAQEQIESLSRIQTAYGTLFENHKKLEFGYNELFGQHQTLTEQFKQVTGNLQAKLDEREGELERIVAIKEEIVCATHKDLLLADQNRKELKSELETLKFNHTIEIATKDEQFREQLDKATRDFSEMCQEKIRCETAITSLQDHIKLIIDECNKKTNEYKTKLLRLEQKSTEYAEHENINRALLEELEKKKGEIEAILEIWREMKHHCEIVENASVRRDAQMAHLINKHEESMLEKDAEIRTLKEALNNQHDRLKSEENIKNNFAGQLEERVSVIDRLRTKVANYERNEIEMQMNLSLLNCGLESVFQENKTLKETQQQLKNEIENQKSENQKLMIQNQSLLENVDQAILSRDAERKTVDALQQDLDWKCKEISTNDIVHQDLMNGSQHAISEISTVLKDVTEQNDALIRKVELSNQQDLVMTSILSQLKSEIKKIIFQEKIQKSKDKSIRLSSEQLDQLKKLLNNSKAPTASFRPQM--RISKCIEDLRTQIDSMQIEITRQI 1152          
The following BLAST results are available for this feature:
BLAST of SMED30008695 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008695 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008695 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008695 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008695 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wdcp2.963e-723.27WD repeat and coiled coil containing [Source:Xenba... [more]
back to top
BLAST of SMED30008695 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008695 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008695 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PDU03.566e-1123.28Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A3Q3MVS49.288e-1121.91Uncharacterized protein OS=Labrus bergylta OX=5672... [more]
A0A3Q3FWS11.212e-1021.91Uncharacterized protein OS=Labrus bergylta OX=5672... [more]
A0A3Q3GRV12.005e-1021.91Golgin A3 OS=Labrus bergylta OX=56723 PE=4 SV=1[more]
A0A087W1C53.334e-1022.75UDP galactose transporter OS=Echinococcus multiloc... [more]
back to top
BLAST of SMED30008695 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008695 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008695 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008695 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008695 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
golga31.164e-921.70golgin A3 [Source:NCBI gene;Acc:101163091][more]
golga31.764e-921.70golgin A3 [Source:NCBI gene;Acc:101163091][more]
back to top
BLAST of SMED30008695 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000053808.10.000e+098.09SMESG000053808.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008695 ID=SMED30008695|Name=SMED30008695|organism=Schmidtea mediterranea sexual|type=transcript|length=4607bp
AATAATTTAACATTATAATGTATTTATATGAATTTAGATAATTTAAATGT
TTAAACAAAAGCACTCGGATCAAGAAATTGATTACGAAAAAGAATTCAAA
GTTGTAATAGGATCTAATTCGCCCAATAAAGATTACTTGAAAGTTAACCA
GACTCAGAATCTCCTTAAAAGCTTAGAAAGTTTTTCTCGTTCTTCTGAAA
GTCTTGCATTACCAATCACACCTCTAGAGTCTAAGAAAAAATCAAAAATG
AAGCGCAAAAATAAGTCTCGTAGTGCTACAAGAAGTTCTAATAAAGATGA
AATTAAACAAACCGAAATAGGTGATTCTTCTGACTTTGGAGTTTCCCGAG
ATCAAGGTGAATCCTATATGTCAAAAATAATGAAAAATGTAACTAAAGAA
TCAAAAATACTTATTGGTGATTGCGAAGAAGAAAGGCTAAGAGTCATGAA
TATAAAATTGGAAAGTAAATTATCTCGATTATGTCAAGAAAATGAAGATT
ATTTACGAGAGAGAATACAAACGAAAAGTGAATTAGAAATTGTTAAACAA
AAGCTTTTTGACACCAAATCAACCACTGAAATCCTAGAAGAAGAAATTGA
AGTGATTAATAGAGAAAGGGAAAATGAAAAGCGTAAAGCCTGTGAATTAG
AGAATTCTTTGCAACAAAAAGAAGCGGAATTGCGAAGTAAATTGATTGAT
TTCGAGCAAATATCTAATGAAATGAATGAATATCAAGAAAATATCAATCA
AACAAATGAAAAAATGCGCCACATTGTCAATGACTTAAATCAACAGAATT
GCGTCGTATCAGATTTAAAGAAAAAACTTTCGGAATATCACTCTCAGCTG
GAATTGACAAAATTATACAAAGAAAATTCCGAATATCAAGCTGAACAATT
ACAATTAGAGTTGGTGGGAATGAAAAAAGCGAGAAATTGGTTCGAAAACC
AACTGGAAACAGTGGAAGAAACAAAAGATAAATTACAAGTAGAAGTTCAT
CGAATCGGGAATTGGTTGCTCGACAGTCAGCGAGAAACCGAAGCAGTTCG
TCACAAAAATAAATCTCTCGAATTGAAGTTAGTGAAATTTCAAGAGATTC
GTCTCAATGAAACGACAGCATTGTTATTCGAATTGGAGCAATTGCACAAA
GAAATCGTCATTACTGATGAAGAAAAACGCGTATTAGAAAGCGAATATTC
AGAAATCGTTAACAAATATGATGAGAAAATATCAGAATTAGAGTTTGAAC
GTGAAAACAGTCGATCGTTAAATCAATTGATCGATAATCTGAGTGTTGAA
TTGGATGAAATCCGAGCTAAATTAGATCGTGCCGATGAAAATGTCAATCA
ATTGGAATCGGATGGAATGGAATTGCGAAAGAAATTAGACGTTTTGCAGG
ACAATTTACAATTGAAATCGTCGGATGTCGAACGAATTGAAAAGGAAAAA
TTCGAATTGGAAAACGATTTTCAACAATTAATGGAAAATAATTCTGAAAA
AGAATCTACGATTCAAAATCTTAAAGAAAATTTGAGTAACTTAAAAGCGT
CTTACGATCGCGTTACTACCGAACGAGATCAGGCGTTCGTTGGAATTGAA
AAATTTCGCCAGGAAATCGATCAAGTTGTCAATCAGTTTGAATTGACGAG
ACAAGATCTCACTAACAAAGAGCAGGTTTTGAAGTTAGCTGAGGAATTAA
ATGACGATTTGAAAGAGAAACTCACAAAACAAACTGAAGAATCAATAAAT
CGCGATAAAATGATTTCTCTGTTAAAATCAGAAAAAAATCAATTGTTGGA
GAATTGTCAACAATTCCAGCAGAACAATTTGCAAATTCTCCAAGAATTGG
ACTCGTTGCGAGCGAATTTCAATTTGGCCAACATCACAATTGCCGGACTC
GAAGAAGAACTAAATTCAATCAAATCAGATAATCGAGACTTAAACGATAA
AGTTTCGATTTCGAAAACCGAAGTCGAGACTTTTAAAATAGAGTTGTTGG
CAGCTCAAGAACAAATCGAAAGTTTGAGTCGGATTCAGACTGCTTATGGG
ACTTTGTTTGAGAATCACAAGAAATTGGAGTTTGGTTACAACGAGTTGTT
CGGTCAACATCAAACATTGACCGAACAATTCAAACAAGTTACTGGAAATC
TCCAAGCAAAACTCGACGAACGTGAAGGAGAATTAGAACGAATTGTTGCG
ATAAAAGAAGAAATCGTCTGTGCAACTCATAAAGACCTGCTGTTAGCCGA
TCAAAATCGTAAGGAGTTGAAAAGTGAGCTGGAAACGTTGAAATTCAATC
ACACTATTGAAATTGCAACGAAAGACGAACAGTTTCGAGAACAACTAGAC
AAAGCGACGAGAGATTTTTCGGAAATGTGTCAGGAAAAAATTCGCTGTGA
AACTGCCATAACAAGCCTTCAAGATCACATAAAGTTGATAATTGATGAAT
GCAACAAAAAGACAAATGAATACAAAACAAAACTGTTGCGATTGGAACAA
AAATCGACTGAGTATGCAGAACATGAAAATATCAATCGGGCTTTATTGGA
AGAACTCGAGAAAAAGAAAGGAGAAATCGAAGCGATTCTTGAAATTTGGA
GGGAAATGAAGCATCATTGTGAAATTGTCGAAAACGCTTCGGTACGAAGA
GATGCTCAAATGGCTCATTTGATTAATAAACATGAGGAATCTATGCTCGA
AAAGGATGCGGAGATTAGAACTTTAAAAGAGGCACTTAATAATCAGCACG
ATCGATTGAAATCCGAAGAAAATATCAAGAATAATTTCGCTGGACAGCTG
GAAGAGAGAGTCAGTGTAATCGATCGATTGAGAACTAAGGTTGCCAATTA
TGAAAGAAATGAAATAGAAATGCAAATGAATTTGAGCTTGTTAAATTGTG
GCCTGGAATCCGTCTTTCAGGAAAATAAAACCCTAAAAGAAACTCAGCAA
CAATTAAAGAATGAAATCGAAAATCAAAAATCGGAAAATCAGAAATTAAT
GATCCAAAATCAATCTCTGTTGGAAAATGTCGATCAGGCTATTCTATCAA
GAGACGCTGAAAGAAAAACTGTTGATGCGCTACAGCAAGATCTCGATTGG
AAATGCAAAGAAATTTCCACCAATGATATTGTCCATCAAGATTTAATGAA
TGGCAGTCAACACGCGATCAGTGAAATATCTACCGTATTAAAGGATGTTA
CTGAGCAGAATGATGCATTAATAAGAAAAGTTGAGTTATCCAATCAACAA
GATCTCGTAATGACCTCTATTCTAAGTCAGTTGAAAAGTGAAATTAAGAA
AATAATTTTCCAAGAAAAAATTCAGAAAAGCAAGGATAAATCTATAAGAT
TGTCTTCAGAGCAGTTAGATCAATTGAAAAAATTATTGAATAATTCAAAG
GCACCAACTGCTTCATTCAGAAATAGACTACTAGCGGATATTTCTTCACC
AATTAAAAATCTTCAGGTAAAGATCGATTTAATTTATTTCACATTGCTTG
CAAAAATTTTTAACATTAACTTTTATAACCGCACCGTTGCATTTTAATCT
ACCAAGCTATTGAACACTTAATTGTGCTCCAACAGGGAATTTATGCACAC
TAGATTTATGCCTTCCTTCCTATTAGAATATTTATCTACTGTGAATAATA
ATGCCACTGAATTATGCGTTGCAATAAGTGCCATATTGATCAACAGATGC
TAACATCAACTATGTAGAGATTGGCGTCCTTTTAAAGCACAATACCTATC
AGAACATATCGCTATCAGAATGCAATATCCAACTCAATTTCAAATAAAGC
TTTTTGAATTTAATATACAATTGCTCCAACTACTCAAAGACTTCCAACAA
GTTCTTGAATCGAGGATAAGATTCTTTGTGAAATCTGTCATCACATTTTA
TTTTTAAAGTCATCACAGAGAGTTTCATTCATTATTTCTGATACTTTAAG
CTCTTTTCCCATGAAGCACTCAAATCAAGTTTTTTTTAAAATTAAATGAA
CAATGACATGAAACTACATAAAATATAGTGTCAACCAGGCGCATCATTTT
ACAGTTGGGTTTCGCAATTTTTCACAAACTTTCGTAGTAAAAACAATAGC
GGCCAGTAACTTAATATTATCAATTGCATTATTGTATATTCTTAAGTATC
AATCTGAGGCTACATTTATTATTGAGACATCCAAAACATGTCCGTATGCA
ATGCGGAATGCTTTAATTTTTTTGAGATCAACGATAGTTTAATTTTCCTC
TATGGTTTCCGCGGTTAAGTTAAAATGTGCTTGCTTTGTTTATCTCTATA
GTAACTAAGATTTTGTCTTCCGTCATCACTTGATGCATGCTTCGATTTTT
ATCTTTCCTGGAATTGCAACTACTTATTCTTCTTTCACATTACTCAACAC
ATTCGAATCGTATCAGCTATTTATTTGATTGAACCGAAAGTTGAAACATT
TTTTGCTCCAAATTTAATTTAAAATTTATTTATTATCAATCTACTTTTTG
AAGCTTCTGTATCATTAAACATTTAACATTTTCCACAGTAAATTTTTTAT
TTATTTTTCTTTAATATCATTTCAAATTCATGATATTTGCGAATAATTTT
CATGCCT
back to top

protein sequence of SMED30008695-orf-1

>SMED30008695-orf-1 ID=SMED30008695-orf-1|Name=SMED30008695-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1167bp
MFKQKHSDQEIDYEKEFKVVIGSNSPNKDYLKVNQTQNLLKSLESFSRSS
ESLALPITPLESKKKSKMKRKNKSRSATRSSNKDEIKQTEIGDSSDFGVS
RDQGESYMSKIMKNVTKESKILIGDCEEERLRVMNIKLESKLSRLCQENE
DYLRERIQTKSELEIVKQKLFDTKSTTEILEEEIEVINRERENEKRKACE
LENSLQQKEAELRSKLIDFEQISNEMNEYQENINQTNEKMRHIVNDLNQQ
NCVVSDLKKKLSEYHSQLELTKLYKENSEYQAEQLQLELVGMKKARNWFE
NQLETVEETKDKLQVEVHRIGNWLLDSQRETEAVRHKNKSLELKLVKFQE
IRLNETTALLFELEQLHKEIVITDEEKRVLESEYSEIVNKYDEKISELEF
ERENSRSLNQLIDNLSVELDEIRAKLDRADENVNQLESDGMELRKKLDVL
QDNLQLKSSDVERIEKEKFELENDFQQLMENNSEKESTIQNLKENLSNLK
ASYDRVTTERDQAFVGIEKFRQEIDQVVNQFELTRQDLTNKEQVLKLAEE
LNDDLKEKLTKQTEESINRDKMISLLKSEKNQLLENCQQFQQNNLQILQE
LDSLRANFNLANITIAGLEEELNSIKSDNRDLNDKVSISKTEVETFKIEL
LAAQEQIESLSRIQTAYGTLFENHKKLEFGYNELFGQHQTLTEQFKQVTG
NLQAKLDEREGELERIVAIKEEIVCATHKDLLLADQNRKELKSELETLKF
NHTIEIATKDEQFREQLDKATRDFSEMCQEKIRCETAITSLQDHIKLIID
ECNKKTNEYKTKLLRLEQKSTEYAEHENINRALLEELEKKKGEIEAILEI
WREMKHHCEIVENASVRRDAQMAHLINKHEESMLEKDAEIRTLKEALNNQ
HDRLKSEENIKNNFAGQLEERVSVIDRLRTKVANYERNEIEMQMNLSLLN
CGLESVFQENKTLKETQQQLKNEIENQKSENQKLMIQNQSLLENVDQAIL
SRDAERKTVDALQQDLDWKCKEISTNDIVHQDLMNGSQHAISEISTVLKD
VTEQNDALIRKVELSNQQDLVMTSILSQLKSEIKKIIFQEKIQKSKDKSI
RLSSEQLDQLKKLLNNSKAPTASFRNRLLADISSPIKNLQVKIDLIYFTL
LAKIFNINFYNRTVAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: biological process
TermDefinition
GO:0007283spermatogenesis
Vocabulary: cellular component
TermDefinition
GO:0090498extrinsic component of Golgi membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 363..383
NoneNo IPR availableCOILSCoilCoilcoord: 517..565
NoneNo IPR availableCOILSCoilCoilcoord: 953..994
NoneNo IPR availableCOILSCoilCoilcoord: 398..509
NoneNo IPR availableCOILSCoilCoilcoord: 573..635
NoneNo IPR availableCOILSCoilCoilcoord: 918..945
NoneNo IPR availableCOILSCoilCoilcoord: 731..751
NoneNo IPR availableCOILSCoilCoilcoord: 275..316
NoneNo IPR availableCOILSCoilCoilcoord: 135..169
NoneNo IPR availableCOILSCoilCoilcoord: 643..663
NoneNo IPR availableCOILSCoilCoilcoord: 177..197
NoneNo IPR availableCOILSCoilCoilcoord: 799..854
NoneNo IPR availableCOILSCoilCoilcoord: 205..250
NoneNo IPR availableCOILSCoilCoilcoord: 876..910
NoneNo IPR availableCOILSCoilCoilcoord: 1048..1068
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 77..91
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 57..102
NoneNo IPR availablePANTHERPTHR34491:SF3HOLOCENTRIC CHROMOSOME BINDING PROTEIN-RELATEDcoord: 40..451
NoneNo IPR availablePANTHERPTHR34491FAMILY NOT NAMEDcoord: 362..1084
coord: 40..451
NoneNo IPR availablePANTHERPTHR34491:SF3HOLOCENTRIC CHROMOSOME BINDING PROTEIN-RELATEDcoord: 362..1084