Mindbomb E3 ubiquitin protein ligase 1

Overview
NameMindbomb E3 ubiquitin protein ligase 1
Smed IDSMED30008689
Length (bp)2835
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008689

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008689SMESG000017281.1 PL030007B10F07ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008689SMESG000017281.1 Contig5065GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermal cellSMED30008689SMESG000017279.1 dd_Smed_v4_6545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30008689SMESG000017281.1 Contig5065GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30008689SMESG000017279.1 dd_Smed_v4_6545_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008689SMESG000017279.1 dd_Smed_v4_6545_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Human
Match: MIB1 (mindbomb E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:21086])

HSP 1 Score: 288.5 bits (737), Expect = 3.295e-82
Identity = 216/730 (29.59%), Postives = 365/730 (50.00%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG---------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQ-DLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V    S   +  +      +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A+DKDGD A+H A   ++  + ++L    AD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +G +           I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D            PN  K      KE   G    R             P  I +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANIVRSG-DAAQGAEGGTSQ--------FQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASG--ERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPD------------PNLCKALAKCHKEKVSGQVGSR------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 65.855 bits (159), Expect = 3.722e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  946 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          

HSP 3 Score: 56.9954 bits (136), Expect = 1.614e-7
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQY------DTRQ-------DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L +       D  Q         ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 4 Score: 51.6026 bits (122), Expect = 8.757e-6
Identity = 40/176 (22.73%), Postives = 75/176 (42.61%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXK------VMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGK 751
            G+ YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++    +       +      V +  + E +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K
Sbjct:  224 GSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSK 399          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 256.529 bits (654), Expect = 2.684e-71
Identity = 201/745 (26.98%), Postives = 341/745 (45.77%), Query Frame = 2
Query:  623 GWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFK--------------------SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDR-LELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNS--VEILLD-AGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLM--------GILG--DMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2734
            GW    ++  G  V  V    DG   V R+G +  ++ KC+G+     +                     S+  + GD V+   D   ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +        + +GN    L+ +R+  + V T    +G   L +A   G +++++LL++ RA ++  D +G+TALH A   NQ +   +L++ G   +A N+ + T + +A   G +E+ R L   R  D+++ D+ +DT LH A+      S  VE+L +    D+ A N + F   H A+L+GHA  +   L R   ++VD++KED F A+HL ALNNH +  ++L+   + D+N+RN  LQ+ LH+AV Q H+  V +LV+    +N  D +GDT LH+A++  Q+      G     G L         G+ G  ++T G+     +A +L   GA +   N +G +P+++  +  +      L       Q   E++   G       AP  P + L  P  + +       L        +   C++C +  + V F  C H   C+ CA  + +C  C+  +  K+R
Sbjct:  203 GW----DVETGRSVASV-TWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------------------------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKN--QGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRALC-ERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAA----VACFLALEGADVSYTNHRGRSPLDLAAEGRV------LKALQGCAQRFRERQAGGGA------AP-GPRQTLGTPNTVTN-------LHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 889          

HSP 2 Score: 158.303 bits (399), Expect = 7.329e-39
Identity = 189/765 (24.71%), Postives = 324/765 (42.35%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVS-RLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLT--KCEGNQANPTAARGQRRRSS---ALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGT------STLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPK--NQIKICDLLIN-KGADVNAQNNNKITPIMLAASSG-SVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKAD--------INIRNNILQTALH-IAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMF-----GMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLL---KARILSLNIPNSTK-----QDLIEKEPNP-GTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            KV  + +++V++ +Q+ HGGW   M  FIG+   + +I   GD+ V       W  +P  + K +           GD+V++  D+  +K+LQ  HG W + M    G++ KV  +   G+++V V      ++P  L   + E +     A R +  +SS   AL+KL  +   P    RL+                   ++  LG     +++D+            L   PE V+ T +   +   +   + Q+  I          D PD D   T  +   +GN  E  +++ S G       ST    ++   +AV  G ++VV+ L E+  ++N  D   DT LH A+        I ++L      DV A N+   T +  A+  G ++ + ++LA +R   +     D  TALHLA   +     +IL+  G  D+N  N+KL +  HLA  Q H  ++ L +  +    V+++ E+   A+H VAL  H+     LL   AD        + + + +  + L   A L         L    A+++  +  G +PL +A + + ++A +   + F     G G+  G    +     TP+ +    L  GA    +  + L   E+    L    + R +        K     Q ++ K+  P G++         P RQL            +EEL+ R + ME+  TC IC D  I + F CGH AC  C + L  C ICR+ I ++I+++
Sbjct:  276 KVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLV-------------------VEVALGNA--ARALDL------------LRRRPEQVD-TKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPD-DEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALH---VAVQRGFLEVVRALCERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILARARQL-VDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLV--DAGCSVNAEDEEGDTALH-VALQRHQ-----LLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKALQGCAQRFRERQAGGGAAPGPRQTL----GTPNTVTN--LHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQL------------VEELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 968          

HSP 3 Score: 61.6178 bits (148), Expect = 7.096e-9
Identity = 36/144 (25.00%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQY--DTR-----------QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E +                 G +G V+R+    ++ +Q+  +TR               +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:  282 DTDVLREMQEGHGGWNPRMAEFI-----------------GQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVA 408          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 257.299 bits (656), Expect = 3.446e-71
Identity = 201/745 (26.98%), Postives = 341/745 (45.77%), Query Frame = 2
Query:  623 GWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFK--------------------SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDR-LELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNS--VEILLD-AGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLM--------GILG--DMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2734
            GW    ++  G  V  V    DG   V R+G +  ++ KC+G+     +                     S+  + GD V+   D   ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +        + +GN    L+ +R+  + V T    +G   L +A   G +++++LL++ RA ++  D +G+TALH A   NQ +   +L++ G   +A N+ + T + +A   G +E+ R L   R  D+++ D+ +DT LH A+      S  VE+L +    D+ A N + F   H A+L+GHA  +   L R   ++VD++KED F A+HL ALNNH +  ++L+   + D+N+RN  LQ+ LH+AV Q H+  V +LV+    +N  D +GDT LH+A++  Q+      G     G L         G+ G  ++T G+     +A +L   GA +   N +G +P+++  +  +      L       Q   E++   G       AP  P + L  P  + +       L        +   C++C +  + V F  C H   C+ CA  + +C  C+  +  K+R
Sbjct:  290 GW----DVETGRSVASV-TWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------------------------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKN--QGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRALC-ERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAA----VACFLALEGADVSYTNHRGRSPLDLAAEGRV------LKALQGCAQRFRERQAGGGA------AP-GPRQTLGTPNTVTN-------LHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 976          

HSP 2 Score: 158.688 bits (400), Expect = 5.780e-39
Identity = 189/765 (24.71%), Postives = 323/765 (42.22%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVS-RLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLT--KCEGNQANPTAARGQRRRSS---ALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGT------STLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPK--NQIKICDLLIN-KGADVNAQNNNKITPIMLAASSG-SVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKAD--------INIRNNILQTALH-IAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMF-----GMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKA---RILSLNIPNSTK-----QDLIEKEPNP-GTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            KV  + +++V++ +Q+ HGGW   M  FIG+   + +I   GD+ V       W  +P  + K +           GD+V++  D+  +K+LQ  HG W + M    G++ KV  +   G+++V V      ++P  L   + E +     A R +  +SS   AL+KL  +   P    RL+                   ++  LG     +++D+            L   PE V+ T +   +   +   + Q+  I          D PD D   T  +   +GN  E  +++ S G       ST    ++   +AV  G ++VV+ L E+  ++N  D   DT LH A+        I ++L      DV A N+   T +  A+  G ++ + ++LA +R   +     D  TALHLA   +     +IL+  G  D+N  N+KL +  HLA  Q H  ++ L +  +    V+++ E+   A+H VAL  H+     LL   AD        + + + +  + L   A L         L    A+++  +  G +PL +A + + ++A +   + F     G G+  G    +     TP+ +    L  GA    +  + L   E+    L      R +        K     Q ++ K+  P G++         P RQL            +EEL+ R + ME+  TC IC D  I + F CGH AC  C + L  C ICR+ I ++I+++
Sbjct:  363 KVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLV-------------------VEVALGNA--ARALDL------------LRRRPEQVD-TKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPD-DEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALH---VAVQRGFLEVVRALCERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILARARQL-VDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLV--DAGCSVNAEDEEGDTALH-VALQRHQ-----LLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKALQGCAQRFRERQAGGGAAPGPRQTL----GTPNTVTN--LHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQL------------VEELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1055          

HSP 3 Score: 61.6178 bits (148), Expect = 7.421e-9
Identity = 36/144 (25.00%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQY--DTR-----------QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E +                 G +G V+R+    ++ +Q+  +TR               +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:  369 DTDVLREMQEGHGGWNPRMAEFI-----------------GQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVA 495          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 257.299 bits (656), Expect = 4.394e-71
Identity = 201/745 (26.98%), Postives = 341/745 (45.77%), Query Frame = 2
Query:  623 GWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFK--------------------SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDR-LELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNS--VEILLD-AGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLM--------GILG--DMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2734
            GW    ++  G  V  V    DG   V R+G +  ++ KC+G+     +                     S+  + GD V+   D   ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +        + +GN    L+ +R+  + V T    +G   L +A   G +++++LL++ RA ++  D +G+TALH A   NQ +   +L++ G   +A N+ + T + +A   G +E+ R L   R  D+++ D+ +DT LH A+      S  VE+L +    D+ A N + F   H A+L+GHA  +   L R   ++VD++KED F A+HL ALNNH +  ++L+   + D+N+RN  LQ+ LH+AV Q H+  V +LV+    +N  D +GDT LH+A++  Q+      G     G L         G+ G  ++T G+     +A +L   GA +   N +G +P+++  +  +      L       Q   E++   G       AP  P + L  P  + +       L        +   C++C +  + V F  C H   C+ CA  + +C  C+  +  K+R
Sbjct:  304 GW----DVETGRSVASV-TWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------------------------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKN--QGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRAL-CERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAA----VACFLALEGADVSYTNHRGRSPLDLAAEGRV------LKALQGCAQRFRERQAGGGA------AP-GPRQTLGTPNTVTN-------LHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 990          

HSP 2 Score: 158.688 bits (400), Expect = 7.153e-39
Identity = 189/765 (24.71%), Postives = 323/765 (42.22%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVS-RLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLT--KCEGNQANPTAARGQRRRSS---ALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGT------STLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPK--NQIKICDLLIN-KGADVNAQNNNKITPIMLAASSG-SVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKAD--------INIRNNILQTALH-IAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMF-----GMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKA---RILSLNIPNSTK-----QDLIEKEPNP-GTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            KV  + +++V++ +Q+ HGGW   M  FIG+   + +I   GD+ V       W  +P  + K +           GD+V++  D+  +K+LQ  HG W + M    G++ KV  +   G+++V V      ++P  L   + E +     A R +  +SS   AL+KL  +   P    RL+                   ++  LG     +++D+            L   PE V+ T +   +   +   + Q+  I          D PD D   T  +   +GN  E  +++ S G       ST    ++   +AV  G ++VV+ L E+  ++N  D   DT LH A+        I ++L      DV A N+   T +  A+  G ++ + ++LA +R   +     D  TALHLA   +     +IL+  G  D+N  N+KL +  HLA  Q H  ++ L +  +    V+++ E+   A+H VAL  H+     LL   AD        + + + +  + L   A L         L    A+++  +  G +PL +A + + ++A +   + F     G G+  G    +     TP+ +    L  GA    +  + L   E+    L      R +        K     Q ++ K+  P G++         P RQL            +EEL+ R + ME+  TC IC D  I + F CGH AC  C + L  C ICR+ I ++I+++
Sbjct:  377 KVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLV-------------------VEVALGNA--ARALDL------------LRRRPEQVD-TKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPD-DEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALH---VAVQRGFLEVVRALCERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILARARQL-VDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLV--DAGCSVNAEDEEGDTALH-VALQRHQ-----LLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKALQGCAQRFRERQAGGGAAPGPRQTL----GTPNTVTN--LHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQL------------VEELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1069          

HSP 3 Score: 61.6178 bits (148), Expect = 7.201e-9
Identity = 36/144 (25.00%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQY--DTR-----------QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E +                 G +G V+R+    ++ +Q+  +TR               +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:  383 DTDVLREMQEGHGGWNPRMAEFI-----------------GQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVA 509          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 254.218 bits (648), Expect = 2.490e-70
Identity = 188/675 (27.85%), Postives = 319/675 (47.26%), Query Frame = 2
Query:  773 SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDR-LELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNS--VEILLD-AGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLM--------GILG--DMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2734
            S+  + GD V+   D   ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +        + +GN    L+ +R+  + V T    +G   L +A   G +++++LL++ RA ++  D +G+TALH A   NQ +   +L++ G   +A N+ + T + +A   G +E+ R L   R  D+++ D+ +DT LH A+      S  VE+L +    D+ A N + F   H A+L+GHA  +   L R   ++VD++KED F A+HL ALNNH +  ++L+   + D+N+RN  LQ+ LH+AV Q H+  V +LV+    +N  D +GDT LH+A++  Q+      G     G L         G+ G  ++T G+     +A +L   GA +   N +G +P+++  +  +      L       Q   E++   G       AP  P + L  P  + +       L        +   C++C +  + V F  C H   C+ CA  + +C  C+  +  K+R
Sbjct:  304 SQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------------------------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKN--QGRTALQVAAYLGQVELIRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQRGFLEVVRAL-CERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAA----VACFLALEGADVSYTNHRGRSPLDLAAEGRV------LKALQGCAQRFRERQAGGGA------AP-GPRQTLGTPNTVTN-------LHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLR 925          

HSP 2 Score: 158.688 bits (400), Expect = 5.150e-39
Identity = 189/765 (24.71%), Postives = 323/765 (42.22%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVS-RLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLT--KCEGNQANPTAARGQRRRSS---ALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGT------STLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPK--NQIKICDLLIN-KGADVNAQNNNKITPIMLAASSG-SVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKAD--------INIRNNILQTALH-IAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMF-----GMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKA---RILSLNIPNSTK-----QDLIEKEPNP-GTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            KV  + +++V++ +Q+ HGGW   M  FIG+   + +I   GD+ V       W  +P  + K +           GD+V++  D+  +K+LQ  HG W + M    G++ KV  +   G+++V V      ++P  L   + E +     A R +  +SS   AL+KL  +   P    RL+                   ++  LG     +++D+            L   PE V+ T +   +   +   + Q+  I          D PD D   T  +   +GN  E  +++ S G       ST    ++   +AV  G ++VV+ L E+  ++N  D   DT LH A+        I ++L      DV A N+   T +  A+  G ++ + ++LA +R   +     D  TALHLA   +     +IL+  G  D+N  N+KL +  HLA  Q H  ++ L +  +    V+++ E+   A+H VAL  H+     LL   AD        + + + +  + L   A L         L    A+++  +  G +PL +A + + ++A +   + F     G G+  G    +     TP+ +    L  GA    +  + L   E+    L      R +        K     Q ++ K+  P G++         P RQL            +EEL+ R + ME+  TC IC D  I + F CGH AC  C + L  C ICR+ I ++I+++
Sbjct:  312 KVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHS-------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRLV-------------------VEVALGNA--ARALDL------------LRRRPEQVD-TKNQGRTALQVAAYLGQVELIRLLLQARAGVDLPD-DEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALH---VAVQRGFLEVVRALCERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTLLHHASLKGHALAVRKILARARQL-VDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNVRNRKLQSPLHLAVQQAHVGLVPLLV--DAGCSVNAEDEEGDTALH-VALQRHQ-----LLPLVADGAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVLKALQGCAQRFRERQAGGGAAPGPRQTL----GTPNTVTN--LHVGAAPGPEAAECLVCSELALLVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQL------------VEELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIF 1004          

HSP 3 Score: 62.003 bits (149), Expect = 5.857e-9
Identity = 36/144 (25.00%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQY--DTR-----------QDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E +                 G +G V+R+    ++ +Q+  +TR               +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:  318 DTDVLREMQEGHGGWNPRMAEFI-----------------GQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVA 444          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 126.331 bits (316), Expect = 4.153e-29
Identity = 96/330 (29.09%), Postives = 161/330 (48.79%), Query Frame = 2
Query: 1415 NLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK---VKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            N  EV K +   G +  L   +G  PL +A+  GH  VV +L+E     ++K K    ALH+A  K+      LL+    + +  + +  TP+ +AA  G   + +LL   + A+++     N + LH+A +  R N   +LL  GA I++  K L    H AA  GH ++++L +  +G  I  ++ ++  A +H+ A  +H D  R LL ++A ++       T LH+A    H+   K+L++  A+ N R  +G TPLHIA K   +K +E   K        +  G+            +I IYLL+ GA  D++  +G TP+ + 
Sbjct:  143 NHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL-LEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPI-SAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 2 Score: 122.479 bits (306), Expect = 6.224e-28
Identity = 88/320 (27.50%), Postives = 152/320 (47.50%), Query Frame = 2
Query: 1430 RKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEIT-RLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            R  VD V    L     PL +A + GH+ V KLL+++ A+ N++  +G T LH+A  KN+IK+ +LL+   A + A   + +TP+ +AA  G++ I   LL    N D+       +T LHLA R ++ + V +L+  GA ++A  ++L    H+A+  G+  I+ L L+       ++   D ++ +H+ A    E+   +LL + AD  +      T LH+A    +L  V++L+E    +++   +  TPLH+A                                   D +A+ LL++GA      K G TP+ + 
Sbjct:  349 RAPVDDVTVDYLT----PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN------------------------------DKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 3 Score: 120.939 bits (302), Expect = 2.073e-27
Identity = 87/311 (27.97%), Postives = 148/311 (47.59%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTP---------DDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            PL IA   G+ D+V LL++  AN NA  +D  + LH+A  + Q ++  +L++  AD         TP+ LA+  G++E+ RLL   R   + I   +  T LH+A   +      +LL+ GA   A  K  +   H+AA +   +I    L+ +     +++    F  +HL A   H++   +L+   +D+  + N   TA+H+   + H+   +IL  N AEIN + + G TPLH+A    Q+   K +            +G+ T  S TP         ++   YLL++GA  + +   G TP+ + 
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL-LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVEN------GADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 115.931 bits (289), Expect = 6.614e-26
Identity = 89/303 (29.37%), Postives = 141/303 (46.53%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            PL  A   GH  VV LL+ + A ++AK K+G   LH+A   + +     L+   A V+    + +TP+ +AA  G V + +LL   R+AD +    +  T LH+A +K+R+  VE+LL   A I A  +      H+AA  G   I+   L++     V++ + +    +HL A  N  D +RVL+   A ++ +   LQT LHIA    + + V +L++  A  N    D  +PLHIA K  Q                              +++A  LL H A   +  KKG TP+ + +
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLL-LDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ------------------------------EEVAGILLDHNADKTLLTKKGFTPLHLAS 565          

HSP 5 Score: 112.079 bits (279), Expect = 1.110e-24
Identity = 89/291 (30.58%), Postives = 134/291 (46.05%), Query Frame = 2
Query: 1382 TKTFFNAL----KIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKM 2233
            TK  F  L    K GNL  VR L++  GT   +EG   V PL +A +  +  V  LL+E  A+  A  K+G T LH+A  KNQ++I   L+   AD NA++    TP+ L+A  G  EI+ LL     +D+    ++  TA+HL  ++  V   +IL + GA+IN+     +   H+A                                H   LN     ++ L+   AD+  +     T LH A  Q H NCV+ L+EN A  N + + G TPL IA ++  +   + +
Sbjct:  554 TKKGFTPLHLASKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL-IENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVAC-------------------------------HFGQLN----MVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 126.331 bits (316), Expect = 4.153e-29
Identity = 96/330 (29.09%), Postives = 161/330 (48.79%), Query Frame = 2
Query: 1415 NLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK---VKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            N  EV K +   G +  L   +G  PL +A+  GH  VV +L+E     ++K K    ALH+A  K+      LL+    + +  + +  TP+ +AA  G   + +LL   + A+++     N + LH+A +  R N   +LL  GA I++  K L    H AA  GH ++++L +  +G  I  ++ ++  A +H+ A  +H D  R LL ++A ++       T LH+A    H+   K+L++  A+ N R  +G TPLHIA K   +K +E   K        +  G+            +I IYLL+ GA  D++  +G TP+ + 
Sbjct:  143 NHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL-LEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPI-SAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 2 Score: 122.479 bits (306), Expect = 6.224e-28
Identity = 88/320 (27.50%), Postives = 152/320 (47.50%), Query Frame = 2
Query: 1430 RKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEIT-RLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            R  VD V    L     PL +A + GH+ V KLL+++ A+ N++  +G T LH+A  KN+IK+ +LL+   A + A   + +TP+ +AA  G++ I   LL    N D+       +T LHLA R ++ + V +L+  GA ++A  ++L    H+A+  G+  I+ L L+       ++   D ++ +H+ A    E+   +LL + AD  +      T LH+A    +L  V++L+E    +++   +  TPLH+A                                   D +A+ LL++GA      K G TP+ + 
Sbjct:  349 RAPVDDVTVDYLT----PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN------------------------------DKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 3 Score: 120.939 bits (302), Expect = 2.073e-27
Identity = 87/311 (27.97%), Postives = 148/311 (47.59%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTP---------DDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            PL IA   G+ D+V LL++  AN NA  +D  + LH+A  + Q ++  +L++  AD         TP+ LA+  G++E+ RLL   R   + I   +  T LH+A   +      +LL+ GA   A  K  +   H+AA +   +I    L+ +     +++    F  +HL A   H++   +L+   +D+  + N   TA+H+   + H+   +IL  N AEIN + + G TPLH+A    Q+   K +            +G+ T  S TP         ++   YLL++GA  + +   G TP+ + 
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL-LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVEN------GADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 115.931 bits (289), Expect = 6.614e-26
Identity = 89/303 (29.37%), Postives = 141/303 (46.53%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            PL  A   GH  VV LL+ + A ++AK K+G   LH+A   + +     L+   A V+    + +TP+ +AA  G V + +LL   R+AD +    +  T LH+A +K+R+  VE+LL   A I A  +      H+AA  G   I+   L++     V++ + +    +HL A  N  D +RVL+   A ++ +   LQT LHIA    + + V +L++  A  N    D  +PLHIA K  Q                              +++A  LL H A   +  KKG TP+ + +
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLL-LDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ------------------------------EEVAGILLDHNADKTLLTKKGFTPLHLAS 565          

HSP 5 Score: 112.079 bits (279), Expect = 1.110e-24
Identity = 89/291 (30.58%), Postives = 134/291 (46.05%), Query Frame = 2
Query: 1382 TKTFFNAL----KIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKM 2233
            TK  F  L    K GNL  VR L++  GT   +EG   V PL +A +  +  V  LL+E  A+  A  K+G T LH+A  KNQ++I   L+   AD NA++    TP+ L+A  G  EI+ LL     +D+    ++  TA+HL  ++  V   +IL + GA+IN+     +   H+A                                H   LN     ++ L+   AD+  +     T LH A  Q H NCV+ L+EN A  N + + G TPL IA ++  +   + +
Sbjct:  554 TKKGFTPLHLASKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL-IENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVAC-------------------------------HFGQLN----MVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 126.331 bits (316), Expect = 4.790e-29
Identity = 96/330 (29.09%), Postives = 161/330 (48.79%), Query Frame = 2
Query: 1415 NLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK---VKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            N  EV K +   G +  L   +G  PL +A+  GH  VV +L+E     ++K K    ALH+A  K+      LL+    + +  + +  TP+ +AA  G   + +LL   + A+++     N + LH+A +  R N   +LL  GA I++  K L    H AA  GH ++++L +  +G  I  ++ ++  A +H+ A  +H D  R LL ++A ++       T LH+A    H+   K+L++  A+ N R  +G TPLHIA K   +K +E   K        +  G+            +I IYLL+ GA  D++  +G TP+ + 
Sbjct:  143 NHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL-LEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPI-SAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 2 Score: 122.865 bits (307), Expect = 5.232e-28
Identity = 88/320 (27.50%), Postives = 152/320 (47.50%), Query Frame = 2
Query: 1430 RKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEIT-RLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            R  VD V    L     PL +A + GH+ V KLL+++ A+ N++  +G T LH+A  KN+IK+ +LL+   A + A   + +TP+ +AA  G++ I   LL    N D+       +T LHLA R ++ + V +L+  GA ++A  ++L    H+A+  G+  I+ L L+       ++   D ++ +H+ A    E+   +LL + AD  +      T LH+A    +L  V++L+E    +++   +  TPLH+A                                   D +A+ LL++GA      K G TP+ + 
Sbjct:  349 RAPVDDVTVDYLT----PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN------------------------------DKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 3 Score: 120.939 bits (302), Expect = 1.931e-27
Identity = 87/311 (27.97%), Postives = 148/311 (47.59%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTP---------DDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            PL IA   G+ D+V LL++  AN NA  +D  + LH+A  + Q ++  +L++  AD         TP+ LA+  G++E+ RLL   R   + I   +  T LH+A   +      +LL+ GA   A  K  +   H+AA +   +I    L+ +     +++    F  +HL A   H++   +L+   +D+  + N   TA+H+   + H+   +IL  N AEIN + + G TPLH+A    Q+   K +            +G+ T  S TP         ++   YLL++GA  + +   G TP+ + 
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL-LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVEN------GADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 115.931 bits (289), Expect = 6.371e-26
Identity = 89/303 (29.37%), Postives = 141/303 (46.53%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            PL  A   GH  VV LL+ + A ++AK K+G   LH+A   + +     L+   A V+    + +TP+ +AA  G V + +LL   R+AD +    +  T LH+A +K+R+  VE+LL   A I A  +      H+AA  G   I+   L++     V++ + +    +HL A  N  D +RVL+   A ++ +   LQT LHIA    + + V +L++  A  N    D  +PLHIA K  Q                              +++A  LL H A   +  KKG TP+ + +
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLL-LDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ------------------------------EEVAGILLDHNADKTLLTKKGFTPLHLAS 565          

HSP 5 Score: 112.079 bits (279), Expect = 9.987e-25
Identity = 89/291 (30.58%), Postives = 134/291 (46.05%), Query Frame = 2
Query: 1382 TKTFFNAL----KIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKM 2233
            TK  F  L    K GNL  VR L++  GT   +EG   V PL +A +  +  V  LL+E  A+  A  K+G T LH+A  KNQ++I   L+   AD NA++    TP+ L+A  G  EI+ LL     +D+    ++  TA+HL  ++  V   +IL + GA+IN+     +   H+A                                H   LN     ++ L+   AD+  +     T LH A  Q H NCV+ L+EN A  N + + G TPL IA ++  +   + +
Sbjct:  554 TKKGFTPLHLASKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL-IENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVAC-------------------------------HFGQLN----MVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 126.331 bits (316), Expect = 4.790e-29
Identity = 96/330 (29.09%), Postives = 161/330 (48.79%), Query Frame = 2
Query: 1415 NLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK---VKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            N  EV K +   G +  L   +G  PL +A+  GH  VV +L+E     ++K K    ALH+A  K+      LL+    + +  + +  TP+ +AA  G   + +LL   + A+++     N + LH+A +  R N   +LL  GA I++  K L    H AA  GH ++++L +  +G  I  ++ ++  A +H+ A  +H D  R LL ++A ++       T LH+A    H+   K+L++  A+ N R  +G TPLHIA K   +K +E   K        +  G+            +I IYLL+ GA  D++  +G TP+ + 
Sbjct:  143 NHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL-LEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPI-SAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 2 Score: 122.865 bits (307), Expect = 5.232e-28
Identity = 88/320 (27.50%), Postives = 152/320 (47.50%), Query Frame = 2
Query: 1430 RKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEIT-RLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            R  VD V    L     PL +A + GH+ V KLL+++ A+ N++  +G T LH+A  KN+IK+ +LL+   A + A   + +TP+ +AA  G++ I   LL    N D+       +T LHLA R ++ + V +L+  GA ++A  ++L    H+A+  G+  I+ L L+       ++   D ++ +H+ A    E+   +LL + AD  +      T LH+A    +L  V++L+E    +++   +  TPLH+A                                   D +A+ LL++GA      K G TP+ + 
Sbjct:  349 RAPVDDVTVDYLT----PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN------------------------------DKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 3 Score: 120.939 bits (302), Expect = 1.931e-27
Identity = 87/311 (27.97%), Postives = 148/311 (47.59%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTP---------DDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            PL IA   G+ D+V LL++  AN NA  +D  + LH+A  + Q ++  +L++  AD         TP+ LA+  G++E+ RLL   R   + I   +  T LH+A   +      +LL+ GA   A  K  +   H+AA +   +I    L+ +     +++    F  +HL A   H++   +L+   +D+  + N   TA+H+   + H+   +IL  N AEIN + + G TPLH+A    Q+   K +            +G+ T  S TP         ++   YLL++GA  + +   G TP+ + 
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL-LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVEN------GADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 115.931 bits (289), Expect = 6.371e-26
Identity = 89/303 (29.37%), Postives = 141/303 (46.53%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            PL  A   GH  VV LL+ + A ++AK K+G   LH+A   + +     L+   A V+    + +TP+ +AA  G V + +LL   R+AD +    +  T LH+A +K+R+  VE+LL   A I A  +      H+AA  G   I+   L++     V++ + +    +HL A  N  D +RVL+   A ++ +   LQT LHIA    + + V +L++  A  N    D  +PLHIA K  Q                              +++A  LL H A   +  KKG TP+ + +
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLL-LDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ------------------------------EEVAGILLDHNADKTLLTKKGFTPLHLAS 565          

HSP 5 Score: 112.079 bits (279), Expect = 9.987e-25
Identity = 89/291 (30.58%), Postives = 134/291 (46.05%), Query Frame = 2
Query: 1382 TKTFFNAL----KIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKM 2233
            TK  F  L    K GNL  VR L++  GT   +EG   V PL +A +  +  V  LL+E  A+  A  K+G T LH+A  KNQ++I   L+   AD NA++    TP+ L+A  G  EI+ LL     +D+    ++  TA+HL  ++  V   +IL + GA+IN+     +   H+A                                H   LN     ++ L+   AD+  +     T LH A  Q H NCV+ L+EN A  N + + G TPL IA ++  +   + +
Sbjct:  554 TKKGFTPLHLASKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL-IENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVAC-------------------------------HFGQLN----MVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 125.946 bits (315), Expect = 5.247e-29
Identity = 96/330 (29.09%), Postives = 161/330 (48.79%), Query Frame = 2
Query: 1415 NLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK---VKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            N  EV K +   G +  L   +G  PL +A+  GH  VV +L+E     ++K K    ALH+A  K+      LL+    + +  + +  TP+ +AA  G   + +LL   + A+++     N + LH+A +  R N   +LL  GA I++  K L    H AA  GH ++++L +  +G  I  ++ ++  A +H+ A  +H D  R LL ++A ++       T LH+A    H+   K+L++  A+ N R  +G TPLHIA K   +K +E   K        +  G+            +I IYLL+ GA  D++  +G TP+ + 
Sbjct:  143 NHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLL-LEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVV-QGAPI-SAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLA 465          

HSP 2 Score: 122.479 bits (306), Expect = 6.031e-28
Identity = 88/320 (27.50%), Postives = 152/320 (47.50%), Query Frame = 2
Query: 1430 RKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEIT-RLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            R  VD V    L     PL +A + GH+ V KLL+++ A+ N++  +G T LH+A  KN+IK+ +LL+   A + A   + +TP+ +AA  G++ I   LL    N D+       +T LHLA R ++ + V +L+  GA ++A  ++L    H+A+  G+  I+ L L+       ++   D ++ +H+ A    E+   +LL + AD  +      T LH+A    +L  V++L+E    +++   +  TPLH+A                                   D +A+ LL++GA      K G TP+ + 
Sbjct:  349 RAPVDDVTVDYLT----PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVET--VRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNN------------------------------DKVAMLLLENGASAKAAAKNGYTPLHIA 630          

HSP 3 Score: 120.939 bits (302), Expect = 2.026e-27
Identity = 87/311 (27.97%), Postives = 148/311 (47.59%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTP---------DDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            PL IA   G+ D+V LL++  AN NA  +D  + LH+A  + Q ++  +L++  AD         TP+ LA+  G++E+ RLL   R   + I   +  T LH+A   +      +LL+ GA   A  K  +   H+AA +   +I    L+ +     +++    F  +HL A   H++   +L+   +D+  + N   TA+H+   + H+   +IL  N AEIN + + G TPLH+A    Q+   K +            +G+ T  S TP         ++   YLL++GA  + +   G TP+ + 
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL-LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADP--NAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVEN------GADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 4 Score: 115.931 bits (289), Expect = 7.530e-26
Identity = 89/303 (29.37%), Postives = 141/303 (46.53%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            PL  A   GH  VV LL+ + A ++AK K+G   LH+A   + +     L+   A V+    + +TP+ +AA  G V + +LL   R+AD +    +  T LH+A +K+R+  VE+LL   A I A  +      H+AA  G   I+   L++     V++ + +    +HL A  N  D +RVL+   A ++ +   LQT LHIA    + + V +L++  A  N    D  +PLHIA K  Q                              +++A  LL H A   +  KKG TP+ + +
Sbjct:  296 PLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLL-LDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ------------------------------EEVAGILLDHNADKTLLTKKGFTPLHLAS 565          

HSP 5 Score: 112.079 bits (279), Expect = 9.536e-25
Identity = 89/291 (30.58%), Postives = 134/291 (46.05%), Query Frame = 2
Query: 1382 TKTFFNAL----KIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKM 2233
            TK  F  L    K GNL  VR L++  GT   +EG   V PL +A +  +  V  LL+E  A+  A  K+G T LH+A  KNQ++I   L+   AD NA++    TP+ L+A  G  EI+ LL     +D+    ++  TA+HL  ++  V   +IL + GA+IN+     +   H+A                                H   LN     ++ L+   AD+  +     T LH A  Q H NCV+ L+EN A  N + + G TPL IA ++  +   + +
Sbjct:  554 TKKGFTPLHLASKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL-IENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVAC-------------------------------HFGQLN----MVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0333578)

HSP 1 Score: 275.018 bits (702), Expect = 2.789e-77
Identity = 212/750 (28.27%), Postives = 361/750 (48.13%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCIG-KRNENKFK--------------SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRL-ELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECV----EATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDS----------------VGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVK-IVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCND-DLLKARI------------LSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPP-----NIKSRDEELEELRQRIQDMEDEKT-----CIICYDRPINVTF-GCGHVA-CDVCANNLYECHICRESIENKIRL 2737
            I  +G   + R+G E M + K +   +  N ++                  + GD V +  D++ ++ LQ  HGGW + M  C      V  I    D+ V  +      +NP +LTK     ++PT A  +              F  GD V++ ++   IK LQ+GHGEW +AMQ  LGK+G+V+ V  + DLKV++       NP  V     +T SD    P I +   +L+ I+ +    + S     D T+ F  A   G      + +                  V  + +  G   L  A   GHI+V+++L+    ++  +DKDGD A+H A   ++  + ++L   GAD+NA+N  + T + +A + G + + + L T      S+ DS+ DT LH A+ K     + +LLD GADI   N   FN  H AAL+G+   +++ L +     IV+ +K+D + A+HL ALNNH +   +L+   KA+++ +N  LQTALH+AV ++H+  VK+LV++ A++N+ D DGDTPLH A++   +   K++  + G G L+  L +      +   IA +L  +GA L +KN+K  TP+++C D +L K  +            L  N+  ++             ++     P++ +   S  P     +I + +    E+ Q + +   + +     C++C D   +  F  CGHV+ C+ CA  + +C ICRE++ ++ ++
Sbjct:  179 IWDNGSKNLYRVGFEGMADLKVVNDAKGSNVYRDHLPLLGENGPGKGPHGFQIGDKVTVDLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKV----SSPTTAPPE--------------FQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSS-ERLSAILKKLFEPNVS----GDATEEFVKAAANGFAARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHAVDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVKTLLT-LGCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQTALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLHEALRHHTLSQLKQLQDVEGFGKLLMGLRNANNKKASA-SIACFLAANGADLTLKNRKQQTPLDLCPDPNLCKTLVKCYNERKTDDSELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAASSTFPAASSSSIFALNGIANEMSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSREKI 903          

HSP 2 Score: 147.517 bits (371), Expect = 9.824e-36
Identity = 186/762 (24.41%), Postives = 305/762 (40.03%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSR-LGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSP---GDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVN------GDLKVKIMGQKLNL--------NPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLI---NKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHA-------KILELFLK-REGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLN-IPNSTKQDLIEKEPNPGTKAE--------RFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGH-VACDVCANNLYECHICRESIE 2722
            KV +  + E++++LQ  HGGW + M   +     +V I +D D+ V+   G  W  NP  + K +       + + GDIV+IC D++ IK LQ+ HG W ++M+   GKI +VQ +    D+KV V      YNP+ + K   + A+  +       S  L  +  K+F P   GD               +       A Q            DVN      G   ++   Q  ++        +   VE  D D +         ++   I   +    + +  +  R  +   A+  G+LN V+ L+ ++G    L   EG  PL  A++  H +++ LL++  A++   + +G  ALH A  K       +L+   N+   V  + ++  T + LAA +  VEI  LL     A++   + +  TALHLAV +  V  V++L+  GAD+N  +K      H  AL+ H        + +E F K   G++  +++K     A  L              A  AD+ ++N   QT L    L    N  K LV+ Y E    DS  + P ++A       A    G +    S+   L  +   S  P   +                              + I +LN I N   Q L E  P      +        + +    P   +S       R ++    R+ +   E    C++C DR   V F  CGH VAC+ C+  + +C +CR  I+
Sbjct:  234 KVTVDLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSSERLSAILKKLFEPNVSGDATEEFVKAAANGFAARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHAVDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVKTLL-TLGCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQTALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLH-EALRHHTLSQLKQLQDVEGFGKLLMGLRNANNKKASASIACFLA-------------ANGADLTLKNRKQQTPLD---LCPDPNLCKTLVKCYNERKTDDS--ELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAASSTFPAASS------------------------------SSIFALNGIANEMSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSREKIDECLVCSDRRAAVFFRPCGHMVACEHCSALMKKCVLCRTQID 945          

HSP 3 Score: 64.3142 bits (155), Expect = 4.905e-10
Identity = 24/71 (33.80%), Postives = 50/71 (70.42%), Query Frame = 2
Query: 2531 PPNIKS-RDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            P N+ + + +++++L+Q++QD++++  C +C+DR  N+ F CGH  C +C + +  C ICR+++E +I L+
Sbjct: 1045 PSNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1115          

HSP 4 Score: 60.077 bits (144), Expect = 1.147e-8
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQ-SLGSCAIVKGPSGNVYRLNSELLIQYDTRQ----DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTS 532
            D+E ++  Q  HGGW   M ECL+    +V        +V   SGN +  N  +L +  +      + ++G  V +  + E  K LQ  +GEW+D M   LGK   + Q + D ++K++    ++  N  A+    CK  S
Sbjct:  240 DLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAV----CKVAS 376          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0075520)

HSP 1 Score: 275.404 bits (703), Expect = 4.024e-77
Identity = 212/750 (28.27%), Postives = 361/750 (48.13%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCIG-KRNENKFK--------------SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRL-ELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECV----EATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDS----------------VGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVK-IVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCND-DLLKARI------------LSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPP-----NIKSRDEELEELRQRIQDMEDEKT-----CIICYDRPINVTF-GCGHVA-CDVCANNLYECHICRESIENKIRL 2737
            I  +G   + R+G E M + K +   +  N ++                  + GD V +  D++ ++ LQ  HGGW + M  C      V  I    D+ V  +      +NP +LTK     ++PT A  +              F  GD V++ ++   IK LQ+GHGEW +AMQ  LGK+G+V+ V  + DLKV++       NP  V     +T SD    P I +   +L+ I+ +    + S     D T+ F  A   G      + +                  V  + +  G   L  A   GHI+V+++L+    ++  +DKDGD A+H A   ++  + ++L   GAD+NA+N  + T + +A + G + + + L T      S+ DS+ DT LH A+ K     + +LLD GADI   N   FN  H AAL+G+   +++ L +     IV+ +K+D + A+HL ALNNH +   +L+   KA+++ +N  LQTALH+AV ++H+  VK+LV++ A++N+ D DGDTPLH A++   +   K++  + G G L+  L +      +   IA +L  +GA L +KN+K  TP+++C D +L K  +            L  N+  ++             ++     P++ +   S  P     +I + +    E+ Q + +   + +     C++C D   +  F  CGHV+ C+ CA  + +C ICRE++ ++ ++
Sbjct:  290 IWDNGSKNLYRVGFEGMADLKVVNDAKGSNVYRDHLPLLGENGPGKGPHGFQIGDKVTVDLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKV----SSPTTAPPE--------------FQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSS-ERLSAILKKLFEPNVS----GDATEEFVKAAANGFAARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHAVDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVKTLLT-LGCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQTALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLHEALRHHTLSQLKQLQDVEGFGKLLMGLRNANNKKASA-SIACFLAANGADLTLKNRKQQTPLDLCPDPNLCKTLVKCYNERKTDDSELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAASSTFPAASSSSIFALNGIANEMSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSREKI 1014          

HSP 2 Score: 147.517 bits (371), Expect = 1.048e-35
Identity = 187/766 (24.41%), Postives = 307/766 (40.08%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVS-RLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKV---------GKVKSVDVNGDLKVKIMGQKLNLNPEC------------VEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLI---NKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHA-------KILELFLK-REGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLN-IPNSTKQDLIEKEPNPGTKAE--------RFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGH-VACDVCANNLYECHICRESIE 2722
            KV +  + E++++LQ  HGGW + M   +     +V I +D D+ V+   G  W  NP  + K +       + + GDIV+IC D++ IK LQ+ HG W ++M+   GKI +VQ +    D+KV V      YNP+ + K   + A+  +       S  L  +  K+F P   V     +  +K    G        +++ G                V+VNG        Q  + N               VE  D D +         ++   I   +    + +  +  R  +   A+  G+LN V+ L+ ++G    L   EG  PL  A++  H +++ LL++  A++   + +G  ALH A  K       +L+   N+   V  + ++  T + LAA +  VEI  LL     A++   + +  TALHLAV +  V  V++L+  GAD+N  +K      H  AL+ H        + +E F K   G++  +++K     A  L              A  AD+ ++N   QT L    L    N  K LV+ Y E    DS  + P ++A       A    G +    S+   L  +   S  P   +                              + I +LN I N   Q L E  P      +        + +    P   +S       R ++    R+ +   E    C++C DR   V F  CGH VAC+ C+  + +C +CR  I+
Sbjct:  345 KVTVDLDLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAVCKVASSTASDGSCAPVIPSSERLSAILKKLFEP--NVSGDATEEFVKAAANGFA--ARCEEYLAGAAQPSTSSASPSSGPDVNVNGVFAGHTALQAASQNGHIEVIQVLLRHAVDVEIEDKDGDRAVHHAAFGDEAAVIEILAKAGADLNARNKRRQTSLHIAVNKGHLNVVKTLL-TLGCHPSLQDSEGDTPLHDAISKEHDEMLSLLLDFGADITLNNNNGFNALHHAALKGNPSAMKILLTKTNRPWIVEEKKDDGYTALHLAALNNHVEIAELLVHMGKANMDRQNVNLQTALHLAVERQHVQIVKLLVQDGADLNIPDKDGDTPLH-EALRHHTLSQLKQLQDVEGFGKLLMGLRNANNKKASASIACFLA-------------ANGADLTLKNRKQQTPLD---LCPDPNLCKTLVKCYNERKTDDS--ELPGNVAGTSSSARARAASGSLNQSSSVNMPLSSLAASSTFPAASS------------------------------SSIFALNGIANEMSQSLHEDPPKSSASLDECLVCSDAKRDTVFKPCGHVSCCETCAPRVKKCLICRETVSSREKIDECLVCSDRRAAVFFRPCGHMVACEHCSALMKKCVLCRTQID 1056          

HSP 3 Score: 64.6994 bits (156), Expect = 4.289e-10
Identity = 24/71 (33.80%), Postives = 50/71 (70.42%), Query Frame = 2
Query: 2531 PPNIKS-RDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            P N+ + + +++++L+Q++QD++++  C +C+DR  N+ F CGH  C +C + +  C ICR+++E +I L+
Sbjct: 1156 PSNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1226          

HSP 4 Score: 60.077 bits (144), Expect = 1.185e-8
Identity = 40/141 (28.37%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQ-SLGSCAIVKGPSGNVYRLNSELLIQYDTRQ----DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTS 532
            D+E ++  Q  HGGW   M ECL+    +V        +V   SGN +  N  +L +  +      + ++G  V +  + E  K LQ  +GEW+D M   LGK   + Q + D ++K++    ++  N  A+    CK  S
Sbjct:  351 DLEIVQSLQHGHGGWTDGMFECLSNAGMVVGIDEDHDIVVAYNSGNRWTFNPAVLTKVSSPTTAPPEFQVGDIVKICSDVESIKILQRGHGEWADAMQLTLGKIGRVQQVYHDNDLKVEVGNTSWTYNPLAV----CKVAS 487          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336840)

HSP 1 Score: 216.468 bits (550), Expect = 9.280e-58
Identity = 153/480 (31.87%), Postives = 241/480 (50.21%), Query Frame = 2
Query:  791 GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRL--ELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIM--GQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDA-GADINALNKKLFNGFHLAALQGH--AKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAM 2200
            GD V++C ++  + +LQQ HGGW   M     K+  V  I   GD++V  +       ++P  L K                         V  F  GD V +IN+ +K+++LQKGHGEW+  M+  LGK+ KV  V  +GDL+++ +  G +  LNP+CV+   S   +  +    +  L+        +  S    +            G+L+ VR+ +D        +  G   + +A + G++D+V  LI K AN+NA DK+GD+ALH A   NQ     +L+  GA+VN  N++  + + + A   +    R L    NA+++I DS  DTALH A+ K     VE+L +A   D    N + FN  H AAL+G+  A    L L R+   +V+ +K+D FAA+HL ALN H   +  L+   +A+++IRNN  QT   +AV Q H   ++ LV    ++N +D DGD  +H+ +
Sbjct:  256 GDRVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVK-------------------------VVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVREL-LQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQ---LVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCV 706          

HSP 2 Score: 111.309 bits (277), Expect = 1.654e-24
Identity = 122/523 (23.33%), Postives = 204/523 (39.01%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSR--LGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV--DRLELVYNPMLLTKCEGNQANPTAARGQRRRS--SALEKLEVKVFSPGDKVRLINNKHKIKR-LQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSV-EILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQK 2110
            +V +    + +  LQ+ HGGW   M   + +   + +I   GD+ V        W  +P  +        K    R GD+V I +D  K++QLQ+ HG W+  M    GKICKV  +   GD+++    D  E   NP    KC   + +P A   +R  S      +    V +P   +   +   K+ R   +GH ++V                            Q L++NP           S+ D+ +      Q+     + D             +   K  N+N V K           EG   L  A  G     +++L++  A +N  +    +ALH+   K        L+   A+VN Q++   T +  A    + E+  LL  + N D ++ ++     LH A  K  V +   ILL +   +N      F   HLAAL GHA+++E  +  EG   +D +   +     L     H   +  L+    D+N ++     A+H+ V++K
Sbjct:  258 RVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAAL-------VKVVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNP----KCVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVR---------------------------QYLDVNP-----------SQVDVMSGGKACIQVASHQGYVD----------LVSYLISKGANVNAVDK-----------EGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVT-EGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCVIKK 709          

HSP 3 Score: 64.3142 bits (155), Expect = 5.466e-10
Identity = 40/129 (31.01%), Postives = 70/129 (54.26%), Query Frame = 2
Query: 1847 DINALNKKLFNG----FHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIE 2218
            D+N     + +G      +A+ QG+  ++   + K   V  VD + +   +A+H  A  N    +RVLL + A++N  N+   +ALHI   +K  +CV+ L+++ A +N++DS GDT LH A+  +  E
Sbjct:  452 DVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGD---SALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTE 577          

HSP 4 Score: 60.4622 bits (145), Expect = 8.661e-9
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 2
Query: 2510 PIRQLSP--PPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            P    SP  P  + S D  L  L  ++ + E+   C IC +R  +V F CGH AC  CA  L  CH+CR++I  KI LY
Sbjct:  972 PTSTSSPSDPTRLPSGDL-LRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          

HSP 5 Score: 53.5286 bits (127), Expect = 1.053e-6
Identity = 33/123 (26.83%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  149 QREHGGWNANMNECLT--GPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY--RGRTFRINSKAI 505
            Q+ HGGWN  M E L+  G    +   G   +      N +  +   L++  +    ++G  VT+I +A + ++LQ  +GEW + M + LGK  ++++ + DG+++I+    G  + +N K +
Sbjct:  272 QQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVKVVS---FRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCV 391          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0081142)

HSP 1 Score: 216.468 bits (550), Expect = 9.280e-58
Identity = 153/480 (31.87%), Postives = 241/480 (50.21%), Query Frame = 2
Query:  791 GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRL--ELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIM--GQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDA-GADINALNKKLFNGFHLAALQGH--AKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAM 2200
            GD V++C ++  + +LQQ HGGW   M     K+  V  I   GD++V  +       ++P  L K                         V  F  GD V +IN+ +K+++LQKGHGEW+  M+  LGK+ KV  V  +GDL+++ +  G +  LNP+CV+   S   +  +    +  L+        +  S    +            G+L+ VR+ +D        +  G   + +A + G++D+V  LI K AN+NA DK+GD+ALH A   NQ     +L+  GA+VN  N++  + + + A   +    R L    NA+++I DS  DTALH A+ K     VE+L +A   D    N + FN  H AAL+G+  A    L L R+   +V+ +K+D FAA+HL ALN H   +  L+   +A+++IRNN  QT   +AV Q H   ++ LV    ++N +D DGD  +H+ +
Sbjct:  256 GDRVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVK-------------------------VVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVREL-LQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQ---LVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCV 706          

HSP 2 Score: 111.309 bits (277), Expect = 1.654e-24
Identity = 122/523 (23.33%), Postives = 204/523 (39.01%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSR--LGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV--DRLELVYNPMLLTKCEGNQANPTAARGQRRRS--SALEKLEVKVFSPGDKVRLINNKHKIKR-LQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSV-EILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQK 2110
            +V +    + +  LQ+ HGGW   M   + +   + +I   GD+ V        W  +P  +        K    R GD+V I +D  K++QLQ+ HG W+  M    GKICKV  +   GD+++    D  E   NP    KC   + +P A   +R  S      +    V +P   +   +   K+ R   +GH ++V                            Q L++NP           S+ D+ +      Q+     + D             +   K  N+N V K           EG   L  A  G     +++L++  A +N  +    +ALH+   K        L+   A+VN Q++   T +  A    + E+  LL  + N D ++ ++     LH A  K  V +   ILL +   +N      F   HLAAL GHA+++E  +  EG   +D +   +     L     H   +  L+    D+N ++     A+H+ V++K
Sbjct:  258 RVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAAL-------VKVVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNP----KCVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVR---------------------------QYLDVNP-----------SQVDVMSGGKACIQVASHQGYVD----------LVSYLISKGANVNAVDK-----------EGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVT-EGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCVIKK 709          

HSP 3 Score: 64.3142 bits (155), Expect = 5.466e-10
Identity = 40/129 (31.01%), Postives = 70/129 (54.26%), Query Frame = 2
Query: 1847 DINALNKKLFNG----FHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIE 2218
            D+N     + +G      +A+ QG+  ++   + K   V  VD + +   +A+H  A  N    +RVLL + A++N  N+   +ALHI   +K  +CV+ L+++ A +N++DS GDT LH A+  +  E
Sbjct:  452 DVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGD---SALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTE 577          

HSP 4 Score: 60.4622 bits (145), Expect = 8.661e-9
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 2
Query: 2510 PIRQLSP--PPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            P    SP  P  + S D  L  L  ++ + E+   C IC +R  +V F CGH AC  CA  L  CH+CR++I  KI LY
Sbjct:  972 PTSTSSPSDPTRLPSGDL-LRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          

HSP 5 Score: 53.5286 bits (127), Expect = 1.053e-6
Identity = 33/123 (26.83%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  149 QREHGGWNANMNECLT--GPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY--RGRTFRINSKAI 505
            Q+ HGGWN  M E L+  G    +   G   +      N +  +   L++  +    ++G  VT+I +A + ++LQ  +GEW + M + LGK  ++++ + DG+++I+    G  + +N K +
Sbjct:  272 QQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVKVVS---FRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCV 391          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Fly
Match: mib2 (gene:FBgn0086442 transcript:FBtr0336841)

HSP 1 Score: 216.468 bits (550), Expect = 9.280e-58
Identity = 153/480 (31.87%), Postives = 241/480 (50.21%), Query Frame = 2
Query:  791 GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRL--ELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIM--GQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDA-GADINALNKKLFNGFHLAALQGH--AKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAM 2200
            GD V++C ++  + +LQQ HGGW   M     K+  V  I   GD++V  +       ++P  L K                         V  F  GD V +IN+ +K+++LQKGHGEW+  M+  LGK+ KV  V  +GDL+++ +  G +  LNP+CV+   S   +  +    +  L+        +  S    +            G+L+ VR+ +D        +  G   + +A + G++D+V  LI K AN+NA DK+GD+ALH A   NQ     +L+  GA+VN  N++  + + + A   +    R L    NA+++I DS  DTALH A+ K     VE+L +A   D    N + FN  H AAL+G+  A    L L R+   +V+ +K+D FAA+HL ALN H   +  L+   +A+++IRNN  QT   +AV Q H   ++ LV    ++N +D DGD  +H+ +
Sbjct:  256 GDRVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVK-------------------------VVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVRQYLDVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVREL-LQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQ---LVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCV 706          

HSP 2 Score: 111.309 bits (277), Expect = 1.654e-24
Identity = 122/523 (23.33%), Postives = 204/523 (39.01%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSR--LGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV--DRLELVYNPMLLTKCEGNQANPTAARGQRRRS--SALEKLEVKVFSPGDKVRLINNKHKIKR-LQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSV-EILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQK 2110
            +V +    + +  LQ+ HGGW   M   + +   + +I   GD+ V        W  +P  +        K    R GD+V I +D  K++QLQ+ HG W+  M    GKICKV  +   GD+++    D  E   NP    KC   + +P A   +R  S      +    V +P   +   +   K+ R   +GH ++V                            Q L++NP           S+ D+ +      Q+     + D             +   K  N+N V K           EG   L  A  G     +++L++  A +N  +    +ALH+   K        L+   A+VN Q++   T +  A    + E+  LL  + N D ++ ++     LH A  K  V +   ILL +   +N      F   HLAAL GHA+++E  +  EG   +D +   +     L     H   +  L+    D+N ++     A+H+ V++K
Sbjct:  258 RVKVCLEVDALMKLQQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAAL-------VKVVSFRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNP----KCVKLERSPLATAAERSNSMMDLSHRRADHVMTPLSGLSGSSVADKLVREAAQGHLDFVR---------------------------QYLDVNP-----------SQVDVMSGGKACIQVASHQGYVD----------LVSYLISKGANVNAVDK-----------EGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALKGNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVT-EGQAELDIRNNRQQTPFLLAVSQGHAGVIERLVRLSCDVNAKDEDGDNAMHLCVIKK 709          

HSP 3 Score: 64.3142 bits (155), Expect = 5.466e-10
Identity = 40/129 (31.01%), Postives = 70/129 (54.26%), Query Frame = 2
Query: 1847 DINALNKKLFNG----FHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIE 2218
            D+N     + +G      +A+ QG+  ++   + K   V  VD + +   +A+H  A  N    +RVLL + A++N  N+   +ALHI   +K  +CV+ L+++ A +N++DS GDT LH A+  +  E
Sbjct:  452 DVNPSQVDVMSGGKACIQVASHQGYVDLVSYLISKGANVNAVDKEGD---SALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKTPHCVRELLQHNANVNIQDSYGDTALHDAIGKENTE 577          

HSP 4 Score: 60.4622 bits (145), Expect = 8.661e-9
Identity = 32/79 (40.51%), Postives = 42/79 (53.16%), Query Frame = 2
Query: 2510 PIRQLSP--PPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            P    SP  P  + S D  L  L  ++ + E+   C IC +R  +V F CGH AC  CA  L  CH+CR++I  KI LY
Sbjct:  972 PTSTSSPSDPTRLPSGDL-LRYLENKVLEFEESHFCGICMERKRDVAFLCGHGACSHCAETLRTCHMCRKTILKKINLY 1049          

HSP 5 Score: 53.5286 bits (127), Expect = 1.053e-6
Identity = 33/123 (26.83%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  149 QREHGGWNANMNECLT--GPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY--RGRTFRINSKAI 505
            Q+ HGGWN  M E L+  G    +   G   +      N +  +   L++  +    ++G  VT+I +A + ++LQ  +GEW + M + LGK  ++++ + DG+++I+    G  + +N K +
Sbjct:  272 QQGHGGWNPRMVEHLSKLGTVHRITDKGDIRVQYENCPNRWTFHPAALVKVVS---FRVGDLVTIINDANKVQQLQKGHGEWIEIMRHALGKICKVVKVYSDGDLRIQQLDDGFEWTLNPKCV 391          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 292.352 bits (747), Expect = 9.178e-84
Identity = 215/732 (29.37%), Postives = 364/732 (49.73%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG--------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   +L A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++++N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +  +          I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +           KE   G    R              P++ S +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKV------APAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCH-----------KEKTSGQVGSR-------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 861          

HSP 2 Score: 66.2402 bits (160), Expect = 1.547e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  970 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          

HSP 3 Score: 55.4546 bits (132), Expect = 3.067e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 4 Score: 51.2174 bits (121), Expect = 6.987e-6
Identity = 53/241 (21.99%), Postives = 99/241 (41.08%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K               + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  224 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 459          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 291.197 bits (744), Expect = 3.273e-83
Identity = 215/739 (29.09%), Postives = 366/739 (49.53%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVE-----------ATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG--------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V            A+ +     P +     +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   +L A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++++N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +  +          I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +           KE   G    R              P++ S +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGAVLTESPSVP--AERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCH-----------KEKTSGQVGSR-------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 872          

HSP 2 Score: 66.2402 bits (160), Expect = 1.514e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  981 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1041          

HSP 3 Score: 55.8398 bits (133), Expect = 2.998e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 4 Score: 51.2174 bits (121), Expect = 7.064e-6
Identity = 39/176 (22.16%), Postives = 73/176 (41.48%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGK 751
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K
Sbjct:  224 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTK 399          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 290.041 bits (741), Expect = 7.932e-83
Identity = 216/740 (29.19%), Postives = 364/740 (49.19%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMG----------------SLMGILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   +L A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++++N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +                  L  I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +           KE   G    R              P++ S +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKV------APAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTVRTEKCLKLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCH-----------KEKTSGQVGSR-------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 869          

HSP 2 Score: 66.2402 bits (160), Expect = 1.661e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  978 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1038          

HSP 3 Score: 55.4546 bits (132), Expect = 3.262e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 4 Score: 51.2174 bits (121), Expect = 7.366e-6
Identity = 53/241 (21.99%), Postives = 99/241 (41.08%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K               + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  224 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 459          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Zebrafish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-050628-1])

HSP 1 Score: 200.29 bits (508), Expect = 1.111e-52
Identity = 189/677 (27.92%), Postives = 304/677 (44.90%), Query Frame = 2
Query:  773 SEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSM-EFCSGKICKVQSILPSGDVKVNVDRL-ELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCES--------EPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEIL-LDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGR-----MFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2734
            S   ++GD V+   ++  ++Q+Q+ HGGW   M E   G +     I   GDV+V    +    ++P  LTK      +           S L +           V LI                V A    LG+VGKV  V  +GDL+V   GQ    NP C+ A   + ++             T+++ L +++ QS    E D P     +    A   G+  +VR+L+    D V      +G   L +A + GH++VVK+L++  +++ AKD+DGD ALH         I D  +      + Q+   +  + +A +  +  I           + + DS  DT LH A+ K   + +EIL +    D    N + FN  H AAL+G+    E+ L R   ++ D +KED F+A+HL ALNNH D   +LL   + DINIRNN  QT L +AV Q H+  V +LV   A++N  D DGDT +H ++  +Q+             ++G     G++G+ TE  +    IA +L + GA +   N KG +P+++  D  ++  I S     + K  L       G+ +       + +R++   PN  +           +  +     C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  198 SHSFQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEIRDGAL-----ITDRGDVRVQYSNIIRWTFHPGALTKARRTHTHTHTHTHTHTHQSYLAQ-----------VCLIG---------------VGAELLALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPGEVDANLMTVENASESSSTVISVLEKLLSQST---EQDNPG----RLVIEAAH-GSAAKVRELLQKHPDKVDIKN--QGKTALQVAAHQGHVEVVKVLLQANSSIEAKDEDGDAALHYTA----FGIADSRVITLNKAHYQHLKGLCSLHMAENR-TEHIVFQCVHVCVCVVCVQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILLKEGRCDINIRNNRNQTPLQLAVTQGHMALVALLVMEGADVNAEDEDGDTAMHTSLSRQQLTTVISSAEGDGAVLYGRLCSSGLMGN-TE-LNVGAAIACFLAQEGADISYANHKGKSPLDLVTDSSVQTLIRSF----AEKHRLHAVSCGTGSSSSS-----SSLRRVHTTPNTMT--------NLAVPSVTGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIRCQVTITKKIR 808          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 142.124 bits (357), Expect = 1.170e-33
Identity = 107/346 (30.92%), Postives = 174/346 (50.29%), Query Frame = 2
Query: 1391 FFNALKIGNLNEVRKLVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK---VKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIY---------LLKHGAGLDMKNKKGLTPMEMC 2386
             + A +  +L+ VR L+++ G  ++   +G  PL IA+  GH  VV +L+E     + K K    ALH+A  K+  K   LL+    + + Q+ +  TP+ +AA  G+V +  LL  +R A +     +  T LH+A ++   N V +LLD GA I+A  +      H AA  GH   +EL L+R G  ++ ++ ++  + +H+ A  +H +C++ LL +KA ++       TALH+A    H    K+L++  A  N R  +G TPLHIA K   VK +E   K G           +  +TE   TP  +A +         LL++GA  D+ N +G T + M 
Sbjct:  135 LYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLL-LNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLER-GAPML-ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYG---------AFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMA 464          

HSP 2 Score: 125.946 bits (315), Expect = 1.157e-28
Identity = 97/349 (27.79%), Postives = 168/349 (48.14%), Query Frame = 2
Query: 1379 RTKTFFNALKI----GNLNEVRKLVDSVGTS---TLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNA--DLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFG---MGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            ++K+ F  L I    GN+N V  L+ + G +   T   G+ PL +A   G+ ++V LL+++ A ++AK +DG T LH A         +LL+ +GA + A+  N ++P+ +AA    VE  + L   +    D+++   D  TALH+A         ++LLD  A+ NA     F   H+A  +   K++EL +K      + +  E     IH+ A   H + + +LL   A  ++ N   +TALH+A     +  V+ L+ N A ++ R  +  TPLHIA ++ + E  + + +        +  G         +   D+   LL+ GA   +  KKG TP+ + +
Sbjct:  222 QSKSGFTPLHIAAHYGNVN-VATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGA--FIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVAS 564          

HSP 3 Score: 122.865 bits (307), Expect = 1.068e-27
Identity = 96/344 (27.91%), Postives = 160/344 (46.51%), Query Frame = 2
Query: 1466 LEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVE---------------------NY-------------AEINLRDSDGDTPLHIAMKVKQIE---AFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            L+ +  L +A + GH  V KLL++KRAN NA+  +G T LH+A  KN++K+ +LLI  GA + A   + +TPI +AA  G + I  LL     A   + +   +TALH+A R  ++  V  LL  GA ++A  ++     H+A+  G  +I++L L+   +   D+   + +  +H+ A   H D   VLL   A  ++      T LH+A     L   K+L++                     +Y             A  +    +G TPLHIA K  Q+E      + G    + +  G++       +   ++A  LL+ GA +++  K GLT + + 
Sbjct:  356 LDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIV-LLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQH--MAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKQNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLA 696          

HSP 4 Score: 117.472 bits (293), Expect = 4.290e-26
Identity = 85/318 (26.73%), Postives = 151/318 (47.48%), Query Frame = 2
Query: 1373 NDRTKTFFNALKIGNLNEVRKLVDS---VGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITR-LLATSRNADLSIGDS--------------------DNDT-------ALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKM 2233
            +D   +F  A + GN+++V + +     +GTS    G+  L +A   GH+D+V+ L+ + +++++  K G+TALH+A    Q  +  +L  +GA++NAQ+ N  TP+ +A+    +++ R LL    N  ++  D                     +NDT       ALH+A RK    S  +LL    + +  +K  F   H+AA  G+  +  L L R     VD    +    +H+ +   + + + +LL   A I+ +     T LH A    H   V++L+E  A +  R  +G +PLH+A +   +E  K +
Sbjct:   30 SDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQ-NGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAA--VDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHL 344          

HSP 5 Score: 116.701 bits (291), Expect = 7.085e-26
Identity = 86/337 (25.52%), Postives = 154/337 (45.70%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREG----------------VKIVDSQK----------------EDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQI---EAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPM 2377
            G+ P+ +A   GH+++V LL++  A+ +  +  G+TALH+A    Q+++   L+  GA V+A+     TP+ +A+  G  EI +LL     A      ++  T LH+A R+  ++   +LL+AGA  +   KK F   H+A+  G  ++ +L L+R                      D+QK                ++ +  +H+ A  N  +    LL Y A+ NI+       +H+A  + H     +L++  A++N+    G T LH+A +  ++   E   K G      + +G    +         +  +LLK GA ++ K K G TP+
Sbjct:  424 GLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLL-LQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKQNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPL 759          

HSP 6 Score: 81.2629 bits (199), Expect = 5.595e-15
Identity = 67/276 (24.28%), Postives = 119/276 (43.12%), Query Frame = 2
Query: 1559 KDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKM---GRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPM 2377
            K  D +T+   A     I      +  G D+   N N +  + LAA  G V++ + L   R + +       +TALH+A    + + V+IL   GA+INA ++  F   ++A+ + H  ++   L+  G + + +  ED F  + +     H   + +LL    + + +  +   ALHIA  +       +L++N    +++   G TPLHIA     +     +   G      +  GI            ++   LL  GA +D K + GLTP+
Sbjct:   28 KKSDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQEL-LGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIAT--EDGFTPLAIALQQGHNQVVSILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPL 296          

HSP 7 Score: 72.0182 bits (175), Expect = 3.581e-12
Identity = 38/132 (28.79%), Postives = 75/132 (56.82%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALN 1864
            +GV P+ +A   GH ++  LL+++ A +N   K G T+LHLA  ++++ + ++L+ +GA+++ Q     TP+++A   G+ ++   L  S  A ++    +  T LH A ++   + + +LL  GA  NA+ 
Sbjct:  655 QGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKS-GASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAIT 785          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 290.041 bits (741), Expect = 2.981e-83
Identity = 223/779 (28.63%), Postives = 363/779 (46.60%), Query Frame = 2
Query:  686 DGDMYVSRLGMEWMINPKCI----------------GKRNE--NKFKSEK--LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVD-RLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEAT----DSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDA-GADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDI--------AIYLLKHGAGLDMKNKKGLTPMEMC---NDDLL----KARILSLNIPN-STKQDLIEKEPN------PGTKAERFEAPIAP-------------------------------------IRQ------LSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            DG   V R+G +  ++ KCI                GK  E   K  SE+   + GD V+   D++ ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+++N   +K+LQ GHGEW + M   LG++GKV  V  +GD++V + GQ    NP C+ +     D++  +  + +   N L  I+ +      S + D +   +       GN  +VR+++        +  +G   L +A + G+++VVK+L++  AN++ +D +GDTALH A   NQ  +  +L++KGA+    NN K T + +A + G  E+ ++L    N  +++ DS  DT LH A+     + +EIL +    D    N + FN  H +AL+G+   +   L+R   ++VDS+KED F A+HL  LNNH++ + +L+   + D+N+RNN  QT LH+AV Q H++ V +LV   A++N  D DGDTP+HI    + +++        G   L  +     E S  P +I        A +L   GA ++  N +G +P+++      DLL       I+SL+ P  S     +   PN      P + A   E  +                                       +RQ       SP   +  + + +EEL+ R + ME+  TC IC D  I + F CGH +C  C+ +L  C ICR+ I  +I+++
Sbjct:  205 DGTTNVYRVGHKGKVDLKCITDAPGGHYYRDHLPKLGKPAELQRKESSERHPFQHGDKVKCLLDVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQYNSETRWTFHPGALTK-------------------------QNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKL----LSQKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQGRTALQVASHLGYMEVVKVLLQANANIDLRDDEGDTALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNP-NCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILER-ARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKL-----EASGLPGNIELNVGSAMACFLALSGADINYANHRGKSPLDLIVFPVQDLLCFHVSHAIISLDSPTVSCSLRRVHTTPNTMTNLSPCSAASPAECLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARKLRQDSTEVECSPSLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 947          

HSP 2 Score: 65.4698 bits (158), Expect = 4.370e-10
Identity = 39/144 (27.08%), Postives = 74/144 (51.39%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQYD------------TRQD-HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D+E ++  Q  HGGWN  M E +                 G +G V+R+    ++ +QY+            T+Q+   +G  V +++N +  K+LQV +GEW+DDM + LG+  ++I+ F DG++++   G+++  N   + +
Sbjct:  268 DVEILREMQEGHGGWNPKMAEFI-----------------GQTGTVHRITERGDVRVQYNSETRWTFHPGALTKQNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTS 394          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 286.189 bits (731), Expect = 7.373e-82
Identity = 215/766 (28.07%), Postives = 360/766 (47.00%), Query Frame = 2
Query:  686 DGDMYVSRLGMEWMINPKCI----------------GKRNE--NKFKSEK--LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVD-RLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEAT----DSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDA-GADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDI--------AIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDL---IEKEPN------PGTKAERFE----APIAPIRQLSPPPN-------------------------------IKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            DG   V R+G +  ++ KCI                GK  E   K  SE+   + GD V+   D++ ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+++N   +K+LQ GHGEW + M   LG++GKV  V  +GD++V + GQ    NP C+ +     D++  +  + +   N L  I+ +      S + D +   +       GN  +VR+++        +  +G   L +A + G+++VVK+L++  AN++ +D +GDTALH A   NQ  +  +L++KGA+    NN K T + +A + G  E+ ++L    N  +++ DS  DT LH A+     + +EIL +    D    N + FN  H +AL+G+   +   L+R   ++VDS+KED F A+HL  LNNH++ + +L+   + D+N+RNN  QT LH+AV Q H++ V +LV   A++N  D DGDTP+HI    + +++        G   L  +     E S  P +I        A +L   GA ++  N +G +P+++  D  +   + +       ++ +   I   PN      P + A   E    + +A +    P  +                               +  + + +EEL+ R + ME+  TC IC D  I + F CGH +C  C+ +L  C ICR+ I  +I+++
Sbjct:  222 DGTTNVYRVGHKGKVDLKCITDAPGGHYYRDHLPKLGKPAELQRKESSERHPFQHGDKVKCLLDVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQYNSETRWTFHPGALTK-------------------------QNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKL----LSQKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQGRTALQVASHLGYMEVVKVLLQANANIDLRDDEGDTALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNP-NCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILER-ARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKL-----EASGLPGNIELNVGSAMACFLALSGADINYANHRGKSPLDLIADGRITHLVKNFAQKFRYQRAILPYIHTTPNTMTNLSPCSAASPAECLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARKLRQGGLEVSDQKKVMEELQNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIF 951          

HSP 2 Score: 127.872 bits (320), Expect = 1.870e-29
Identity = 133/493 (26.98%), Postives = 210/493 (42.60%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLG-MEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQ-ANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAM--QFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLIN-KGADVNAQNNNKITPIMLAASSGSV-EITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNH 2014
            KV  + + E+++ +Q+ HGGW   M  FIG+   + +I + GD+ V       W  +P  + K+N           GD+V++ D++  +K+LQ  HG W + M    G+I KV  +   GD++V+V      +NP  LT  +  + AN       +   + L  +  K+ S                 QK   E   ++  +   G   KV+ +      KV I  Q           T     S      +V  L Q     D  D  DE D     T  +    GN   V +++ S G +  L        L IAVN G  +VV++L      +N +D  GDT LH A+  +   I ++L      D   QNN     +  +A  G+V  ++++L  +R   +     D  TALHLA   +    VEIL+  G  D+N  N +     HLA  QGH  ++ L +  EG   V+++ ED    +H+V +  H
Sbjct:  279 KVKCLLDVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQYNSETRWTFHPGALTKQNS-------FWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKLLS-----------------QKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQG---------RTALQVASHLGYMEVVKVLLQANANIDLRD--DEGD-----TALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNPNCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILERARQL-VDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVT-EGAD-VNAEDEDGDTPMHIVFVRQH 728          

HSP 3 Score: 65.0846 bits (157), Expect = 5.749e-10
Identity = 39/144 (27.08%), Postives = 74/144 (51.39%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQYD------------TRQD-HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D+E ++  Q  HGGWN  M E +                 G +G V+R+    ++ +QY+            T+Q+   +G  V +++N +  K+LQV +GEW+DDM + LG+  ++I+ F DG++++   G+++  N   + +
Sbjct:  285 DVEILREMQEGHGGWNPKMAEFI-----------------GQTGTVHRITERGDVRVQYNSETRWTFHPGALTKQNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTS 411          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 285.419 bits (729), Expect = 5.905e-81
Identity = 216/740 (29.19%), Postives = 366/740 (49.46%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQ----------TMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSL---------MGILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQ-DLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L  GD+V I  +++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V    S   +  +             +V +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL++   ++ A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +G +           I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D            PN  K      KE + G                  P  I +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLLIGDLVNIDLELEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSG-DAAQGAEGGTSP--------FQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATGGKLDYNLSFKLVERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRQDVDVNGQCAGHTAMQAASQNGHVDILKLLLKHSVDVEAEDKDGDRAVHHAAFGDEGTVVEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKKL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPD------------PNLCKALAKCHKEKSSGQVGSH------------SPSMISNDSETLEE-------------CMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 875          

HSP 2 Score: 66.2402 bits (160), Expect = 2.179e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  986 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1046          

HSP 3 Score: 55.4546 bits (132), Expect = 4.697e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQD-------------HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            ++E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +               ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 ELEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAV 397          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 284.263 bits (726), Expect = 8.368e-81
Identity = 215/730 (29.45%), Postives = 364/730 (49.86%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSL---------MGILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQ-DLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L  GD+V I  +++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V    S   +  +      +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL++   ++ A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +G +           I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D            PN  K      KE + G                  P  I +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLLIGDLVNIDLELEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSG-DAAQGAEGGTSP--------FQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATG--ERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRQDVDVNGQCAGHTAMQAASQNGHVDILKLLLKHSVDVEAEDKDGDRAVHHAAFGDEGTVVEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKKL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPD------------PNLCKALAKCHKEKSSGQVGSH------------SPSMISNDSETLEE-------------CMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 66.2402 bits (160), Expect = 2.595e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  946 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          

HSP 3 Score: 55.4546 bits (132), Expect = 5.241e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQD-------------HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            ++E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +               ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 ELEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAV 397          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 266.929 bits (681), Expect = 5.886e-75
Identity = 204/724 (28.18%), Postives = 339/724 (46.82%), Query Frame = 2
Query:  686 DGDMYVSRLGMEWMINPKCI----------------GKRNE--NKFKSEK--LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVD-RLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEAT----DSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDA-GADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDI--------AIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSL--NIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVT-FGCGH-VACDVCANNLYECHICRESIENKIR 2734
            DG   V R+G +  ++ KCI                GK  E   K  SE+   + GD V+   D++ ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                            F  GD VR+++N   +K+LQ GHGEW + M   LG++GKV  V  +GD++V + GQ    NP C+ +     D++  +  + +   N L  I+ +      S + D +   +       GN  +VR+++        +  +G   L +A + G+++VVK+L++  AN++ +D +GDTALH A   NQ  +  +L++KGA+    NN K T + +A + G  E+ ++L    N  +++ DS  DT LH A+     + +EIL +    D    N + FN  H +AL+G+   +   L+R   ++VDS+KED F A+HL  LNNH++ + +L+   + D+N+RNN  QT LH+AV Q H++ V +LV   A++N  D DGDTP+HI    + +++        G   L  +     E S  P +I        A +L   GA ++  N +G +P+++  D     RI  L  N     ++ +    P       R       +  LSP       +                  C++C +  + V+ F C H + C+ C+  + +C  C+  I  K+R
Sbjct:  205 DGTTNVYRVGHKGKVDLKCITDAPGGHYYRDHLPKLGKPAELQRKESSERHPFQHGDKVKCLLDVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQYNSETRWTFHPGALTK-------------------------QNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKL----LSQKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQGRTALQVASHLGYMEVVKVLLQANANIDLRDDEGDTALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNP-NCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILER-ARQLVDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVTEGADVNAEDEDGDTPMHIVFVRQHLKSIDSQQEGNGSSLLTKL-----EASGLPGNIELNVGSAMACFLALSGADINYANHRGKSPLDLIAD----GRITHLVKNFAQKFREQVELDSPTVSCSLRRVHTTPNTMTNLSPCSAASPAE------------------CLVCSELAVLVSFFPCQHSIVCEECSRRMKKCIKCQVCIARKLR 870          

HSP 2 Score: 128.642 bits (322), Expect = 1.300e-29
Identity = 133/493 (26.98%), Postives = 210/493 (42.60%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLG-MEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQ-ANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAM--QFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLIN-KGADVNAQNNNKITPIMLAASSGSV-EITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNH 2014
            KV  + + E+++ +Q+ HGGW   M  FIG+   + +I + GD+ V       W  +P  + K+N           GD+V++ D++  +K+LQ  HG W + M    G+I KV  +   GD++V+V      +NP  LT  +  + AN       +   + L  +  K+ S                 QK   E   ++  +   G   KV+ +      KV I  Q           T     S      +V  L Q     D  D  DE D     T  +    GN   V +++ S G +  L        L IAVN G  +VV++L      +N +D  GDT LH A+  +   I ++L      D   QNN     +  +A  G+V  ++++L  +R   +     D  TALHLA   +    VEIL+  G  D+N  N +     HLA  QGH  ++ L +  EG   V+++ ED    +H+V +  H
Sbjct:  262 KVKCLLDVEILREMQEGHGGWNPKMAEFIGQTGTVHRITERGDVRVQYNSETRWTFHPGALTKQN-------SFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTSYQREEDANLMTTENAKESKNTLVSILEKLLS-----------------QKTDCESPTSLVIEAAQGNTAKVREMLQKYPDKVDIKNQG---------RTALQVASHLGYMEVVKVLLQANANIDLRD--DEGD-----TALHYAAYGNQAGVVRVLLSKGANAELLNNAKCTALYIAVNKGFTEVVQVLCNPNCAINMQDSFGDTPLHYAITADFRSIIEILTEVPNIDFTVQNNQGFNLLHHSALKGNVLAVSKILERARQL-VDSKKEDGFTALHLATLNNHQEVVEILIKEGRCDVNLRNNRNQTPLHLAVAQGHISLVHLLVT-EGAD-VNAEDEDGDTPMHIVFVRQH 711          

HSP 3 Score: 65.4698 bits (158), Expect = 4.229e-10
Identity = 39/144 (27.08%), Postives = 74/144 (51.39%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQYD------------TRQD-HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D+E ++  Q  HGGWN  M E +                 G +G V+R+    ++ +QY+            T+Q+   +G  V +++N +  K+LQV +GEW+DDM + LG+  ++I+ F DG++++   G+++  N   + +
Sbjct:  268 DVEILREMQEGHGGWNPKMAEFI-----------------GQTGTVHRITERGDVRVQYNSETRWTFHPGALTKQNSFWVGDVVRVMDNMDAVKKLQVGHGEWTDDMVSALGQIGKVIKVFGDGDMRVSVGGQSWTFNPACLTS 394          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 286.96 bits (733), Expect = 6.543e-82
Identity = 215/733 (29.33%), Postives = 365/733 (49.80%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG---------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A+DKDGD A+H A   ++  + ++L    AD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +G +           I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +           KE   G    R             P  I +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANIVRSG-DAAQGAEGGTSQ--------FQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKV------APAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCH-----------KEKVSGQVGSR------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 65.855 bits (159), Expect = 2.555e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  946 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          

HSP 3 Score: 57.3806 bits (137), Expect = 1.044e-7
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQY------DTRQ-------DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L +       D  Q         ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 4 Score: 51.6026 bits (122), Expect = 5.476e-6
Identity = 40/176 (22.73%), Postives = 75/176 (42.61%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXK------VMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGK 751
            G+ YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++    +       +      V +  + E +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K
Sbjct:  224 GSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSK 399          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 286.96 bits (733), Expect = 6.543e-82
Identity = 215/733 (29.33%), Postives = 365/733 (49.80%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG---------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A+DKDGD A+H A   ++  + ++L    AD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +G +           I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +           KE   G    R             P  I +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANIVRSG-DAAQGAEGGTSQ--------FQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKV------APAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCH-----------KEKVSGQVGSR------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 65.855 bits (159), Expect = 2.555e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  946 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          

HSP 3 Score: 57.3806 bits (137), Expect = 1.044e-7
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQY------DTRQ-------DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L +       D  Q         ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 4 Score: 51.6026 bits (122), Expect = 5.476e-6
Identity = 40/176 (22.73%), Postives = 75/176 (42.61%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXK------VMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGK 751
            G+ YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++    +       +      V +  + E +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K
Sbjct:  224 GSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSK 399          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 228.409 bits (581), Expect = 1.001e-63
Identity = 162/544 (29.78%), Postives = 281/544 (51.65%), Query Frame = 2
Query: 1169 GKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG---------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            GKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A+DKDGD A+H A   ++  + ++L    AD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +G +           I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +           KE   G    R             P  I +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:    2 GKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKV------APAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCH-----------KEKVSGQVGSR------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 498          

HSP 2 Score: 100.908 bits (250), Expect = 2.388e-21
Identity = 150/631 (23.77%), Postives = 254/631 (40.25%), Query Frame = 2
Query:  884 GKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDND--TALHLAVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIH----------LVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGHV-ACDVCANNLYECHICRESIENKI 2731
            GK+ +VQ I    D+KV V      YNP  ++K     +  + A G+R     L +L  K+F   +   L  N+  +K    G    V  ++ +L    K   VDVNG        Q  + N                    V+ L  ++ Q +   E+++ D DR          G + EV     +   +       PL IAVN GH+ VVK L++   + + +D +GDT LH A+ K +  I  +L+  GADV   NNN    +  AA  G+    R+L +       + +  +D  TALHLA   + V   E+L+  G A+++  N       HLA  + H +I+ L + R G K+ D Q +D    +H          L  L + +D  +V  A++   N    I+      A  +   +    L  N A++++R+  G +PL +       +A  K  +    G +         GS +P  I+             + + L    +C+D                K+D +                  P   ++       R ++    ++++Q     + C++C D+   V F  CGH+ AC+ CA+ + +C  CR  +E ++
Sbjct:    2 GKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVAPAGSAISNASGER-----LSQLLKKLFETQESGDL--NEELVKAAANGD---VAKVEDLL----KRPDVDVNGQCAGHTAMQAASQNGH------------------VDILKLLLKQ-NVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLV-RAGAKL-DIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTL--IMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQV---------GSRSPSMIS------------NDSETLEECMVCSD---------------MKRDTL----------------FGPCGHIATCSLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQCRAVVERRV 543          

HSP 3 Score: 65.855 bits (159), Expect = 1.865e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  581 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 641          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Mouse
Match: Mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2679684])

HSP 1 Score: 228.409 bits (581), Expect = 5.767e-62
Identity = 165/576 (28.65%), Postives = 282/576 (48.96%), Query Frame = 2
Query: 1067 FSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNS--VEILLDA-GADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAF--KKMGRMFGMGSLM------GILG--DMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2734
            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +          +GN    L+ +R+  + V T    +G   L +A   G +++V+LL++ RA+++  D +G+T LH     NQ +   +L++ G  V+A+N  + T + +A   G +E+ ++L   R  D+++ D+  DT LH A+      S  VE+L +  G D+ A N + F   H A+L+GH   +   L R   ++VD++KED F A+HL ALNNH +  +VL+   + D+N+RN  LQ+ LH+AV Q HL  V +LV+    +N  D +GDT LH+A++  Q+      + G   G   L+      G+ G  ++T G+     +A +L   GA +   N +G +P+++  +  +      L       Q   E++      A          R +   PN       +  L        +   C++C +  + + F  C H   C+ CA  + +C  C+  I  K+R
Sbjct:  292 FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRTQKSDPEHPGRLVVEAALGNVARALDLLRRHPEQVDTKN--QGRTALQVAAYLGQVELVRLLLQARASMDLPDDEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKILC-ERGCDVNLPDAHADTPLHSAISAGAGASSIVEVLTEVPGIDVTATNSQGFTLLHHASLKGHVLAVRKILAR-ARQLVDAKKEDGFTALHLAALNNHREVAQVLIREGRCDVNVRNRKLQSPLHLAVQQAHLGLVPLLVDAGCSVNTEDEEGDTALHVALQRHQLLPLVADRAGGDPGPLQLLSRLQASGLPGCTELTVGA----AVACFLALEGADVSYANHRGRSPLDLATEGRV------LKALQGCAQRFRERQ------AGGGGGVPPGPRHVLSTPNT------VTNLHVSGTAGPEAAECLVCSELALLILFSPCQHRTVCEECARRMKKCIRCQVVISKKLR 841          

HSP 2 Score: 130.183 bits (326), Expect = 2.572e-30
Identity = 181/767 (23.60%), Postives = 314/767 (40.94%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLT--KCEGNQANPTAARGQRRRSS---ALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQ--LTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVP--KNQIKICDLLIN-KGADVNAQNNNKITPIMLAASSGSV-EITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENY---------AEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFG-----------------MGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNK-KGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            KV  + +++V++++Q+ HGGW                                  NP+       N F       GD+V++  D+  +K+LQ  HG W + M    G++ KV  +   G+++V V      ++P  L   + E +     A R +  +SS   AL+KL  +   P    RL+                   ++  LG V   +++D+            L  +PE V+ T +   +   +   + Q  L +++ Q+  S   D PD D   T  +   +GN  E  +++ S G +           L +AV  G ++VVK+L E+  ++N  D   DT LH A+        I ++L    G DV A N+   T +  A+  G V  + ++LA +R   +     D  TALHLA   +     ++L+  G  D+N  N+KL +  HLA  Q H  ++ L +  +    V+++ E+   A+H VAL  H+  L  L+A +A  +     L + L  + L     C ++ V            A+++  +  G +PL +A + + ++A +   + F                  + +   +      G+  P+     +    A L + +  +  T  E C   + K     + I    +       P+        + P  P RQL     ++SR  ++EE   RI       TC IC D  I + F CGH AC  C   L  C ICR+ I ++I+++
Sbjct:  262 KVKCLLDTDVLRDMQEGHGGW----------------------------------NPRMA---EHNSFWV-----GDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRTQKSDPEHPGRLV-------------------VEAALGNV--ARALDL------------LRRHPEQVD-TKNQGRTALQVAAYLGQVELVRLLLQARAS--MDLPD-DEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKILCERGCDVNLPDAHADTPLHSAISAGAGASSIVEVLTEVPGIDVTATNSQGFTLLHHASLKGHVLAVRKILARARQL-VDAKKEDGFTALHLAALNNHREVAQVLIREGRCDVNVRNRKLQSPLHLAVQQAHLGLVPLLV--DAGCSVNTEDEEGDTALH-VALQRHQ--LLPLVADRAGGDPGPLQLLSRLQASGLP---GCTELTVGAAVACFLALEGADVSYANHRGRSPLDLATEGRVLKALQGCAQRFRERQAGGGGGVPPGPRHVLSTPNTVTNLHVSGTAGPEAAECLVCSELALLILFSPCQHRTVCEECARRMKKCIRCQVVISKKLR-------PDGSEVVNAIQVPGPP-RQLV--EELQSRYRQMEE---RI-------TCPICIDSHIRLVFQCGHGACAPCGAALNACPICRQPIRDRIQIF 920          

HSP 3 Score: 51.9878 bits (123), Expect = 4.326e-6
Identity = 29/129 (22.48%), Postives = 51/129 (39.53%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E                                           +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:  268 DTDVLRDMQEGHGGWNPRMAE--------------------------------------HNSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVA 358          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Mouse
Match: Mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2679684])

HSP 1 Score: 134.42 bits (337), Expect = 1.559e-33
Identity = 95/373 (25.47%), Postives = 169/373 (45.31%), Query Frame = 2
Query:  686 DGDMYVSRLGMEWMINPKCIGKRNENKFKSEKL--------------------RKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDR-LELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN----LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLL 1729
            DG   V R+G +  ++ +C+G+     +  E L                    ++GD V+   D   ++ +Q+ HGGW   M    G++  V  I   GDV+V  +      ++P  LTK                            F  GD VR+I +   +KRLQ GHGEW + M   LG+VGKV  V  +G+L+V + GQ+   +P C+ A   + ++  D+     +    +  +     + + D +          +GN    L+ +R+  + V T    +G   L +A   G +++V+LL++ RA+++  D +G+T LH     NQ +   +L++ G  V+A+N  + T + +A   G +E+ ++L
Sbjct:   30 DGTTNVYRVGHKGKVDLRCVGEAAGGFYYKEHLPKLGKPAELQRRVSADGQPFQRGDKVKCLLDTDVLRDMQEGHGGWNPRMAEFIGQMGTVHRITDRGDVRVQFNHETRWTFHPGALTKHNS-------------------------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRTQKSDPEHPGRLVVEAALGNVARALDLLRRHPEQVDTKN--QGRTALQVAAYLGQVELVRLLLQARASMDLPDDEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKIL 375          

HSP 2 Score: 79.7221 bits (195), Expect = 2.862e-15
Identity = 82/333 (24.62%), Postives = 145/333 (43.54%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVS-RLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLT--KCEGNQANPTAARGQRRRSS---ALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQ--LTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEG---VYPLMIAVNGGHIDVVKLL 1531
            KV  + +++V++++Q+ HGGW   M  FIG+   + +I   GD+ V       W  +P  + K N           GD+V++  D+  +K+LQ  HG W + M    G++ KV  +   G+++V V      ++P  L   + E +     A R +  +SS   AL+KL  +   P    RL+                   ++  LG V   +++D+            L  +PE V+ T +   +   +   + Q  L +++ Q+  S   D PD D   T  +   +GN  E  +++ S G +           L +AV  G ++VVK+L
Sbjct:   87 KVKCLLDTDVLRDMQEGHGGWNPRMAEFIGQMGTVHRITDRGDVRVQFNHETRWTFHPGALTKHNS-------FWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRTQKSDPEHPGRLV-------------------VEAALGNV--ARALDL------------LRRHPEQVD-TKNQGRTALQVAAYLGQVELVRLLLQARAS--MDLPD-DEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKIL 375          

HSP 3 Score: 68.1662 bits (165), Expect = 1.887e-11
Identity = 76/316 (24.05%), Postives = 141/316 (44.62%), Query Frame = 2
Query: 1025 RRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQ-KLNLNPECVEATDSDCESEPDIQTMVNQLTQIMG-QSDHSDESDE--PDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLN-AKDK------DGDTALHLAVPK---NQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELF 1930
            +RR SA    + + F  GDKV+ + +   ++ +Q+GHG W   M   +G++G V  +   GD++V+   + +   +P  +   +S      D+  ++  L  +   Q+ H + +D+  P   R          GNL           + + L    P   A    ++DV +   E +++L+ A DK      D +    L V     N  +  DLL      V+ +N  + T + +AA  G VE+ RLL  +R A + + D + +T LH     ++  +  +LL AG  ++A N       H+A  +G  +++++ 
Sbjct:   72 QRRVSA----DGQPFQRGDKVKCLLDTDVLRDMQEGHGGWNPRMAEFIGQMGTVHRITDRGDVRVQFNHETRWTFHPGALTKHNSFWVG--DVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRPEEDA----NLDVAERARENKSSLSVALDKLRTQKSDPEHPGRLVVEAALGNVARALDLLRRHPEQVDTKNQGR-TALQVAAYLGQVELVRLLLQAR-ASMDLPDDEGNTVLHYTAMGNQPEATRVLLSAGCAVDARNGTRSTALHVAVQRGFLEVVKIL 375          

HSP 4 Score: 58.151 bits (139), Expect = 2.798e-8
Identity = 36/144 (25.00%), Postives = 66/144 (45.83%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLN--SELLIQY--DTRQDHK-----------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT 511
            D + ++  Q  HGGWN  M E +                 G  G V+R+    ++ +Q+  +TR               +G  V +I + +  KRLQ  +GEW+DDM   LG+  ++++ F DGN+++   G+ +  +   ++ 
Sbjct:   93 DTDVLRDMQEGHGGWNPRMAEFI-----------------GQMGTVHRITDRGDVRVQFNHETRWTFHPGALTKHNSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVA 219          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. UniProt/SwissProt
Match: sp|Q804S5|MIB1_DANRE (E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 6.929e-83
Identity = 215/732 (29.37%), Postives = 364/732 (49.73%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG--------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   +L A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++++N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +  +          I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +           KE   G    R              P++ S +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKV------APAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCH-----------KEKTSGQVGSR-------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 861          

HSP 2 Score: 66.2402 bits (160), Expect = 1.168e-9
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  970 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          

HSP 3 Score: 55.4546 bits (132), Expect = 2.315e-6
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. UniProt/SwissProt
Match: sp|Q86YT6|MIB1_HUMAN (E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.582e-81
Identity = 216/730 (29.59%), Postives = 365/730 (50.00%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG---------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQ-DLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V    S   +  +      +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A+DKDGD A+H A   ++  + ++L    AD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +G +           I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D            PN  K      KE   G    R             P  I +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANIVRSG-DAAQGAEGGTSQ--------FQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASG--ERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPD------------PNLCKALAKCHKEKVSGQVGSR------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 65.855 bits (159), Expect = 1.787e-9
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  946 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          

HSP 3 Score: 56.9954 bits (136), Expect = 7.751e-7
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQY------DTRQ-------DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L +       D  Q         ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. UniProt/SwissProt
Match: sp|Q80SY4|MIB1_MOUSE (E3 ubiquitin-protein ligase MIB1 OS=Mus musculus OX=10090 GN=Mib1 PE=1 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.577e-81
Identity = 215/733 (29.33%), Postives = 365/733 (49.80%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG---------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G++ +V  L+    V  +    G   +  A   GH+D++KLL+++  ++ A+DKDGD A+H A   ++  + ++L    AD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +G +           I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +           KE   G    R             P  I +  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANIVRSG-DAAQGAEGGTSQ--------FQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKV------APAGSAISNASGERLSQLLKKLFETQESGDLNEELVKAAAN----GDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCH-----------KEKVSGQVGSR------------SPSMISNDSETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 65.855 bits (159), Expect = 1.787e-9
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  946 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          

HSP 3 Score: 57.3806 bits (137), Expect = 7.303e-7
Identity = 42/148 (28.38%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQY------DTRQ-------DHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L +       D  Q         ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. UniProt/SwissProt
Match: sp|Q6GNY1|MIB1_XENLA (E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis OX=8355 GN=mib1 PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.319e-79
Identity = 213/729 (29.22%), Postives = 365/729 (50.07%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSL----------MGILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQ-DLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L  GD+V I  +++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA+G    +S         F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V    S   +  +      +L+Q++ +   + ES + + +  K   N   +  ++++ K  D V  +    G   +  A   GH+D++KLL++   ++ A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L    +   S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A+++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +G +            I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D            PN  K      KE + G                  P  I +  E LEE             C++C D   +  FG CGH+A C +C+  + +C +C+E ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLLIGDLVNIDLELEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSG-DAAQGAEGGTSP--------FQVGDLVQICYDIERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAVSRVASVGSAISNATG--ERLSQLLKKLFETQESGDLNEELVKAAANG-DVAKVDDLLKRQD-VDVNGQCAGHTAMQAASQNGHVDILKLLLKHSVDVEAEDKDGDRAVHHAAFGDEGTVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKKL-LDFSCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSANLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLAVRNKKGQSPLDLCPD------------PNLCKTLAKCHKEKSSGQVGSH------------SPSMINNDSETLEE-------------CMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLLCKEQVQSRTKI 864          

HSP 2 Score: 66.2402 bits (160), Expect = 1.387e-9
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  947 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1007          

HSP 3 Score: 55.4546 bits (132), Expect = 2.487e-6
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQD-------------HKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            ++E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +               ++G  V +  + E  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 ELEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGDAAQGAEGGTSPFQVGDLVQICYDIERIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDNDLKVEVCGTSWTYNPAAV 397          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. UniProt/SwissProt
Match: sp|Q5ZIJ9|MIB2_CHICK (E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus OX=9031 GN=MIB2 PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.564e-79
Identity = 213/727 (29.30%), Postives = 345/727 (47.46%), Query Frame = 2
Query:  686 DGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRK--------------------GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVD-RLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCES--------EPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDA-GADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLM-------GILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINV-TFGCGH-VACDVCANNLYECHICRESIENKIR 2734
            DG   V R+G +  ++ KC  + +   +  E L K                    GD V+   DI  ++++Q+ HGGW   M    G+   V  I   GDV+V  +      ++P  LTK                         +  F  GD VR+I++   +KR Q GHGEW + M   LG +GKV  V  +GDL+V +  Q    NP C+ A   D E+        +    T++  L +++ Q   SD +           + AL   N  +VR+L+    D V      +G   L IA   GH+DVVK+L++  A +N +D++GDTALH A   NQ  +  +L+ KGA  +  NN K T + +A S G  E+ + L    N D+++ DS  DT LH A+       +EIL +    D    N + FN  H +AL+G+   ++  L R   ++VDS+KED F A+HL ALNNH++   +L+   + D+N++NN  QT LH+A++Q H+  V++LV   +++N  D DGDT +HIA++ +Q+ +     R   MGS +       G LG++     T   IA YL + GA ++  N +G +P+++  D     RI  + I     Q   E++ +         A    +R++   PN  +           +  +     C++C +  + +  F C H + C+ C+  + +C  C+ +I  K++
Sbjct:  205 DGTTNVYRVGHKGKVDLKCTVEASGGFYYKEHLPKLGKPAELQRKESTDRHPFQHGDKVKCLLDIDILREMQEGHGGWNPKMAEFIGQTGTVHRITDRGDVRVQFNSETRWTFHPGALTK-------------------------LNTFWVGDVVRVIDDMETVKRFQPGHGEWTDEMAPTLGHIGKVIKVYGDGDLRVSVGDQSWTFNPACLTAYQRDEEANLMTTENAKESKSTLITVLEKLLSQKTESDHAG------CLVIWAALN--NAAKVRELLQKYPDKVDNKN--QGRTALQIASYQGHLDVVKILLQAHATVNLRDEEGDTALHYAAFGNQADVARVLMAKGAGADLLNNAKCTALYVAVSQGFTEVVQALC-ELNCDVNLPDSHGDTPLHYAITADYKVIIEILTEVPNIDFTVQNCQGFNLLHYSALKGNKLAIKKILAR-ARQLVDSKKEDGFTALHLAALNNHKEVAEILIKEGRCDVNVKNNRNQTPLHLAIIQGHVGLVQLLVSEGSDVNAEDEDGDTAMHIALERQQLMSVLMEKREGEMGSSLFSKLQASGFLGNVELNVGTA--IACYLAQEGADINYANHRGKSPLDLITD----GRI--VQIIKDFSQKFREQQVSSDC-----SAITCSLRRVHTTPNTMT--------NLSVSSVAVPTECLVCSELALLIHFFPCQHSIVCEECSRRMKKCIKCQVTITKKLK 873          

HSP 2 Score: 56.6102 bits (135), Expect = 1.167e-6
Identity = 34/129 (26.36%), Postives = 64/129 (49.61%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECL--TGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D++ ++  Q  HGGWN  M E +  TG    +   G    V+  S   +  +   L + +T     +G  V +I++ E  KR Q  +GEW+D+M   LG   ++I+ + DG++++    +++  N   +
Sbjct:  268 DIDILREMQEGHGGWNPKMAEFIGQTGTVHRITDRGDVR-VQFNSETRWTFHPGALTKLNT---FWVGDVVRVIDDMETVKRFQPGHGEWTDEMAPTLGHIGKVIKVYGDGDLRVSVGDQSWTFNPACL 392          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. TrEMBL
Match: A0A3B5A8W5 (Mindbomb E3 ubiquitin protein ligase 2 OS=Stegastes partitus OX=144197 PE=4 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 5.928e-90
Identity = 226/716 (31.56%), Postives = 350/716 (48.88%), Query Frame = 2
Query:  776 EKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESE--------PDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDA-GADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLN-----------IPNSTKQDLIEKEPNPG------------------------TKAERFEAPI-------APIRQ------LSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
               ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F  G+ VR++ +   +KRLQ GHGEW ++M  VLG+VGKV  V  +GDL+V   GQ    NP C+ A   + ++             T+++ L +++ QS    E D P    ++    A + G+ N+VR+LV        +  +G   L +A + GH++VVK L++  +++  KD+DGD ALH     NQ +I  LL++KGA+VN  NN+  T + +A + G  ++ R+L T  +AD+++ DS  DT LH A+ K   N +EIL+     D    N + FN  H AAL+G+    E  L R   ++VD +KED F+A+HL ALNNH D   +L+   + DINIRNN  QT L +AV+Q H + V++LV   A++N+ D DGDT +H+A+   Q+        +    +  G+LG       T   IA +L + GA ++  N KG +P+++  D  +   I S +            PN+    ++   P P                           A R +  I         IRQ       SP      +   LE+L+ R + ME+  TC IC D  I + F CGH +C  C+  L  C ICR++I  +I+L+
Sbjct:  257 HSFQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFGVGELVRVLEDMESVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVEVDANLMTAENPNESGSTVISVLEKLLSQST---EQDNP----SRLVIEAAQ-GSANKVRELVQKYPDKVDIKNQGKTALQVAAHQGHMEVVKALLQANSSIEVKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDLVRVL-TEHSADINLQDSYGDTPLHDAIAKDFRNIIEILVVVPNIDFTQQNHRGFNLLHHAALKGNKLATEKILGR-ARQLVDVKKEDGFSALHLAALNNHRDVAEILIKEGRCDINIRNNRNQTPLQLAVMQGHTDLVQLLVAEGADVNMEDEDGDTAMHVALLRPQLANV-----VLSPLNSSGLLGSTELNVGTA--IACFLAQEGADINYANHKGKSPLDLVADGAMLQVIKSFSENSASLRRVHTTPNTMTNLVLPTPPGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIRQDQTEVDCSPGTENSEQHNLLEQLQSRYRQMEERITCPICIDNHIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 930          

HSP 2 Score: 65.0846 bits (157), Expect = 9.103e-7
Identity = 35/130 (26.92%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V ++E+ E  KRLQ  +GEW+D M  +LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  270 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FGVGELVRVLEDMESVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 394          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. TrEMBL
Match: A0A3Q3WPX3 (Mindbomb E3 ubiquitin protein ligase 2 OS=Mola mola OX=94237 PE=4 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 2.114e-89
Identity = 230/721 (31.90%), Postives = 352/721 (48.82%), Query Frame = 2
Query:  776 EKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESE--------PDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFF-NALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEIL-LDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLN-----------------IPNSTKQDLIEKEPNPG------------------------TKAERFEAPI-------APIRQ------LSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
               ++GD V+   D+  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F  G+ VR++ +   +KRLQ GHGEW ++M  VLG+VGKV  V  +GDL+V   GQ    NP C+ A   + ++             T+++ L +++ QS    E D P     +    +A+K+  L  V+K  D V      +G   L +A + GH++VVK L++   ++  KD+DGDTALH +   NQ +I  LL++KGA+VN  NN+  T + +A + G  ++ R+L T  +AD+++ DS  DT LH A+ K   + +EIL +    D    N + FN  H AAL+G+    E  L R   ++VD +KED F+A+HL +LNNH D   +L+   + DINIRNN  QT L +AV Q H + V++LV   A++N+ D DGDT +H+A+   Q+        MF   +  G+LG+ TE S     IA +L + GA ++  N KG +P+++  D  +   I S +                  PN+    ++   P P                           A R +  I         IRQ       SP      +   LE+L+ R + ME+  TC IC D  I + F CGH +C  C+  L  C ICR++I  +I+L+
Sbjct:  247 HSFQQGDKVKCLLDMDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFGVGELVRVLEDMESVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPLEVDANLMTTENPNESGSTVISVLEKLLSQST---EQDNPSRLVIEAAHGSAIKVREL--VQKYPDKVDIKN--QGKTALQVAAHQGHMEVVKALLQANGSIEIKDEDGDTALHYSAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDMVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILVMVPNIDFTQQNHRGFNLLHHAALKGNKLATEKILAR-ARQLVDVKKEDGFSALHLASLNNHRDVAEILIKEGRCDINIRNNRNQTPLQLAVTQGHTDLVQLLVAEGADVNMEDEDGDTAMHVALLRPQLANI-----MFSPLNTSGLLGN-TELS-VGAAIACFLAQEGADINYANHKGKSPLDLVADGAMLQLIKSFSEKHRYGLSSASLRRVHTTPNTMTNLVLPTSPGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIRQDQTEVDCSPGTENSEQHNLLEQLQSRYRQMEERITCPICIDNHIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 926          

HSP 2 Score: 68.5514 bits (166), Expect = 6.646e-8
Identity = 37/130 (28.46%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            DM+ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V ++E+ E  KRLQ  +GEW+D M  +LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  260 DMDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FGVGELVRVLEDMESVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 384          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. TrEMBL
Match: A0A556U1X5 (E3 ubiquitin-protein ligase MIB2 OS=Bagarius yarrelli OX=175774 GN=Baya_7512 PE=4 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 4.594e-89
Identity = 232/728 (31.87%), Postives = 360/728 (49.45%), Query Frame = 2
Query:  782 LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEA-----------TDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEIL-LDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQI-----EAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDL-LKARILSL--------------NIPNSTKQDLIEKEPNPG------------------------TKAERFEAPI-------APIRQ------LSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
             ++GD V+   D+  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F+ G+ VR++++   +KRLQ GHGEW ++M   LG+VGKV  V  +GDL+V   GQ    NP C+ A            D+  ES     T+++ L +++ QS    E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK+L++  +++ AKD+DGD ALH     NQ +I  LL++KGA VN  NN+  T + +A + G  ++ R+L T  +AD+++ DS  DT LH A+ K   + +EIL +    D    N + FN  H AAL+G+    E+ L R   ++VD +KED F+A+HL ALNNH +   +L+   + D+NIRNN  QT L +AV Q H+  V++LV   A +N  D +GDT +H A+  +Q+      A +    ++   S  G+LG+ TE  +    IA +L + GA ++  N KG +P+++  D + L+A                     PN+    ++   P P                           A R +  I         IRQ       SP  +I ++   LE+L+ R + ME+  TC IC D  I + F CGH +C  C+++L  C ICR+SI  +I+L+
Sbjct:  346 FQQGDKVKCLLDVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMAPALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPGEVDANLMTADNPTESR---TTVISVLEKLLSQST---EQDNPG----RLVIEAAH-GSAAKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKVLLQANSSIEAKDEDGDAALHYTAFGNQSEIARLLLSKGASVNLLNNSMCTALHIAVNKGFTDMVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVRNIDFTQQNNRGFNLLHHAALKGNKLATEMILAR-ARQLVDKKKEDGFSALHLAALNNHYEVAEILIKEGRCDVNIRNNRGQTPLQLAVTQGHMKLVELLVMEGANVNAEDEEGDTAMHTALSRQQLATMLSSAERDASNLYSRLSSSGLLGN-TE-LNIGAAIACFLAQEGADMNYANHKGKSPLDLVTDSIVLQAGTCGTGGTGGSSSSLRRVHTTPNTMTNLVMPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIRQDQTEVDSSPNSDIPAQHNLLEQLQSRYRQMEERITCPICIDNHIKLVFQCGHASCMECSSSLKTCPICRQSIRERIQLF 1031          

HSP 2 Score: 64.6994 bits (156), Expect = 1.140e-6
Identity = 35/130 (26.92%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V ++++ E  KRLQ  +GEW+D M   LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  357 DVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FAVGELVRVLDDIESVKRLQAGHGEWTDSMAPALGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 481          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. TrEMBL
Match: A0A0L8FX87 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22005289mg PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 6.147e-89
Identity = 236/782 (30.18%), Postives = 394/782 (50.38%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRL-GME---WMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCE-----GNQANPTAARGQRRR--------SSALEKLEVKV---------FSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECV-EATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILL-DAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMF-GMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLL---KARILSLNIPNSTKQDLIEKEPN-------PGTKAERFEAPIA------------PIRQ-LSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            +V +  +   +K LQ+ HGGW   M  FIG+ V IV+ + + D  + +  G+    W  NPK + K        +K   GD V+I DDI+++K+ Q NHGGW   M    GKI  V+   P GD+ V+V     ++NP+  TK       G + + T+      +        S  L+ ++  +         F  G+ V++I +  K+K  Q+ HG WV+ M  +LGK  +VK V  NG L V + G+  ++NP+C  + + S  +SE D +++ + + Q+   S  +   D         F      G+   VR+ +    D +       G   L +A   GH D+V +L+E  A+L  +D DGDTAL+ +    + +I +LL++KGA  NA N N+ T + +A +  SV+  R+L    +A ++I DS  DTALH A+RK     +++L+ D+  D    NK+ FN  H AA++G+     + + ++   IV+ +K+D F A+HL ALN H +    LL+  +A+INI+N+  QT L +A  Q H+  +++L+   AE+N+ D DG+  LH+A+  + +   K   ++   + S +G+  D +E ++    IA YL+  GA    KN++ + P+++ +D  L     ++ SL+        + E+  N          +A     P              P++  L     I  +    +  ++RI+++E+  TC IC DRP N+ F CGH  C  C  +L ECH+C + I+ K+ LY
Sbjct:   15 RVSMYEDINTIKLLQEGHGGWNPFMANFIGQ-VGIVQGVNNVDDVIVKFEGLSKNLWRFNPKALTK-------IDKFSVGDAVKILDDIEQVKRYQINHGGWSPDMTSVLGKIGSVKIAFPDGDLFVSVSGKIFLFNPLCCTKVPQSMKVGEEDDATSIMEVMEQFFNLKTGFSGLLQSMQGIMGDSERQDDQFLVGETVKIIEDIQKVKAYQEKHGGWVDDMVSILGKTARVKLVLPNGALLVSVSGKMCSINPKCCRKVSRSVDDSESDSESVDDMMQQLFNMSFGATVLD--------GFVKEAAKGHTRNVREFIKNHRDEIDKKC--SGKTALQVASYKGHKDIVLMLLEAGADLELQDDDGDTALNFSAIGGETEIMELLLSKGAKTNALNKNRHTALHIAVNKESVKCVRIL-VKHSAPINIQDSLGDTALHDAIRKENEEIIDMLISDSRIDFKIRNKRGFNTLHYAAIRGN-NFATVSILQKCQDIVNVKKDDGFTALHLAALNGHREVANTLLSVGRAEINIKNSSGQTPLFLAATQGHIGLIELLILKGAEVNVEDEDGNICLHLAVSRQNVSISKDDLKIIENIRSQLGL--DESERAEVV--IACYLVHKGANPYYKNRQDVMPLDIMSDQSLIEKLVKVASLSTEQPCGAQIEERRSNNKDCMLCSNKQATVLFQPCCHVLICEHCNVRVPVKHCLQCKVLIADKITIHDPQQKRIEELEERVTCPICMDRPRNMAFECGHTVCKECGESLKECHMCSKPIQKKLNLY 772          

HSP 2 Score: 123.635 bits (309), Expect = 5.301e-25
Identity = 152/609 (24.96%), Postives = 256/609 (42.04%), Query Frame = 2
Query:  317 IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQD-GNVKIKYRGRT---FRINSKAILTDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCI----------------------------------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVG--TSTLLEGVY-PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKG-ADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHL 1996
            +G  V++ E+    K LQ  +G W+  M N +G+ V I+Q   +  +V +K+ G +   +R N KA          +   + F  G+ V ++ + E +K  Q +HGGW   M   +G+   +     DGD++VS  G  ++ NP C                                         G   +++ + ++   G+ V+I +DIQK+K  Q+ HGGWV+ M    GK  +V+ +LP+G + V+V       NP    K         +       S +++ +  ++F+      +++    +K   KGH    N  +F                    I   +  ++ +C   T     S    + +V  L +    +D   + D+ D     T  N   IG   E+ +L+ S G  T+ L +  +  L IAVN   +  V++L++  A +N +D  GDTALH A+ K   +I D+LI+    D   +N      +  AA  G+   T  +       +++   D  TALHLA           LL  G A+IN  N        LAA QGH  ++EL + + G + V+ + ED    +HL
Sbjct:   12 VGDRVSMYEDINTIKLLQEGHGGWNPFMANFIGQ-VGIVQGVNNVDDVIVKFEGLSKNLWRFNPKA----------LTKIDKFSVGDAVKILDDIEQVKRYQINHGGWSPDMTSVLGKIGSVKIAFPDGDLFVSVSGKIFLFNPLCCTKVPQSMKVGEEDDATSIMEVMEQFFNLKTGFSGLLQSMQGIMGDSERQDDQFLVGETVKIIEDIQKVKAYQEKHGGWVDDMVSILGKTARVKLVLPNGALLVSVSGKMCSINPKCCRKVS------RSVDDSESDSESVDDMMQQLFNMSFGATVLDG--FVKEAAKGHTR--NVREF--------------------IKNHRDEIDKKCSGKTALQVASYKGHKDIVLMLLE--AGADLELQDDDGD-----TALNFSAIGGETEIMELLLSKGAKTNALNKNRHTALHIAVNKESVKCVRILVKHSAPINIQDSLGDTALHDAIRKENEEIIDMLISDSRIDFKIRNKRGFNTLHYAAIRGNNFATVSILQKCQDIVNVKKDDGFTALHLAALNGHREVANTLLSVGRAEINIKNSSGQTPLFLAATQGHIGLIELLILK-GAE-VNVEDEDGNICLHL 570          

HSP 3 Score: 80.1073 bits (196), Expect = 1.711e-11
Identity = 68/260 (26.15%), Postives = 113/260 (43.46%), Query Frame = 2
Query:  122 KDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSC--AIVK--GPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI--------LTDNCKKTSMXXXXXXXXXXKV-----------------------MLIRNSEVMKNLQK------DHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSE 778
            +D+ TIK+ Q  HGGWN  M     G   +VQ + +    IVK  G S N++R N + L + D      +G  V ++++ E+ KR Q+ +G WS DM ++LGK   +   F DG++ +   G+ F  N            + +    TS+          K                        ++    ++++++QK       HGGW + M   +G+   +  +L +G + VS  G    INPKC  K + +   SE
Sbjct:   20 EDINTIKLLQEGHGGWNPFMAN-FIGQVGIVQGVNNVDDVIVKFEGLSKNLWRFNPKALTKIDK---FSVGDAVKILDDIEQVKRYQINHGGWSPDMTSVLGKIGSVKIAFPDGDLFVSVSGKIFLFNPLCCTKVPQSMKVGEEDDATSIMEVMEQFFNLKTGFSGLLQSMQGIMGDSERQDDQFLVGETVKIIEDIQKVKAYQEKHGGWVDDMVSILGKTARVKLVLPNGALLVSVSGKMCSINPKCCRKVSRSVDDSE 275          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. TrEMBL
Match: A0A3Q1FJ50 (Mindbomb E3 ubiquitin protein ligase 2 OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 1.506e-88
Identity = 229/725 (31.59%), Postives = 351/725 (48.41%), Query Frame = 2
Query:  776 EKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESE--------PDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL--EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDA-GADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIE--AFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEM----------------CNDDLLKARILSLNIPNSTKQDLIEKEPNPGTK--------------------------AERFEAPI-------APIRQ------LSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
               ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F  G+ VR++ +   +KRLQ GHGEW ++M  VLG+ GKV  V  +GDL+V   GQ    NP C+ A   + ++             T+++ L +++ QS    E D P    ++    A   G+ N+VR+LV        +  +G   L +A + GH++VVK L++  +++  KD+DGDTALH     NQ +I  LL++KGA+VN  NN+  T + +A + G  ++ R+L T  +AD+++ DS  DT LH A+ K   N +EIL+     D    N + FN  H AAL+G+    E  L R   ++VD +KED F+A+HL ALNNH D   +L+   + DINIRNN  QT L +AV Q H + V++LV   A++N+ D DGDT +H+A+   Q+     K  G +    +  G+LG       T   IA +L   GA ++  N KG +P+++                C   L  A +  ++   +T  +L+   P PG                            A R +  I         IRQ       SP      +   LE+L+ R + ME+  TC IC D  I + F CGH +C  C+  L  C ICR++I  +I+L+
Sbjct:  322 HSFQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFGVGELVRVLEDMESVKRLQAGHGEWTDSMTPVLGQAGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVEVDANLMTAENPNESGSTVISVLEKLLSQST---EQDNP----SRLVIEAAH-GSANKVRELVQKYPDKVDIKNQGKTALQVAAHQGHMEVVKALLQANSSVEVKDEDGDTALHYTAFGNQAEIARLLLSKGANVNILNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRNIIEILVVVPNIDFTYQNHRGFNLLHHAALKGNKLSTEKILAR-ARQLVDVKKEDGFSALHLAALNNHRDVAEILIKEGRCDINIRNNRNQTPLQLAVTQGHTDLVQLLVAEGADVNMEDEDGDTAMHVALLRPQLANVVLKGCGSIPRPLNSSGLLGSTELNVGTA--IACFLAHEGADINYANHKGKSPLDLVADSTMLQLQRLQAITCGQGLSSANLRRVHTTPNTMTNLVLPTP-PGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIRQDQTEVDCSPGTENSEQHNLLEQLQSRYRQMEERITCPICIDNHIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 1008          

HSP 2 Score: 66.2402 bits (160), Expect = 4.179e-7
Identity = 35/130 (26.92%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V ++E+ E  KRLQ  +GEW+D M  +LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  335 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FGVGELVRVLEDMESVKRLQAGHGEWTDSMTPVLGQAGKVLKVYADGDLRVAFGGQTWTFNPACL 459          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 307.375 bits (786), Expect = 9.779e-90
Identity = 224/728 (30.77%), Postives = 352/728 (48.35%), Query Frame = 2
Query:  782 LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCES--------EPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEIL-LDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQI-----EAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLN------------------IPNSTKQDLIEKEPNPG------------------------TKAERFEAPI-------APIRQ------LSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
             ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F+ G+ VR++++   +KRLQ GHGEW ++M   LG+VGKV  V  +GDL+V   GQ    NP C+     + ++             T+++ L +++ QS    E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK+L++  +++ AKD+DGD ALH     NQ +I  LL++KGA+VN  NN+  T + +A + G  ++ R+L T  +AD+++ DS  DT LH A+ K   + +EIL +    D    N + FN  H AAL+G+    E+ L R   ++ D +KED F+A+HL ALNNH D   +L+   + D NIRNN  QT L +AV Q H+  V +LV   A++N  D +GDT +H A+  +Q+      + ++   ++   S  G+LG+ TE  +    IA +L + GA ++  N KG +P+++  D      I S +                   PN+     +   P P                           A R +  I         IRQ       SP  +   +   LE+L+ R + ME+  TC IC D  I + F CGH +C  C+  L  C ICR++I  +I+L+
Sbjct:  258 FQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSGQPGEVDANLMTAENPSESGSTVISVLEKLLSQST---EQDNPG----RLVIEAAH-GSATKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKVLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGN-TE-LNVGAAIACFLAQEGADINYANHKGKSPLDLVTDSTTLQLIRSFSEKHRYVVSSSSSLRRVHTTPNTMTNLAMPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIRQDQTEVECSPNSDNSEQHNLLEQLQSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLF 946          

HSP 2 Score: 63.5438 bits (153), Expect = 8.779e-10
Identity = 34/130 (26.15%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V ++++ E  KRLQ  +GEW+D M + LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  269 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 393          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 292.352 bits (747), Expect = 6.169e-84
Identity = 215/732 (29.37%), Postives = 363/732 (49.59%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG--------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   +L A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A ++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +  +          I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +           KE   G    R              P++ S +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC++ ++++ ++
Sbjct:  196 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVARSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKV------APAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCH-----------KEKTSGQVGSR-------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKDQVQSRTKI 861          

HSP 2 Score: 66.2402 bits (160), Expect = 1.568e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  946 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          

HSP 3 Score: 56.225 bits (134), Expect = 1.703e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  257 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 397          

HSP 4 Score: 51.9878 bits (123), Expect = 3.087e-6
Identity = 53/241 (21.99%), Postives = 99/241 (41.08%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K               + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  224 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 459          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 292.738 bits (748), Expect = 6.326e-84
Identity = 215/732 (29.37%), Postives = 363/732 (49.59%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG--------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   +L A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A ++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +  +          I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +           KE   G    R              P++ S +E LEE             C++C D   +  FG CGH+A C +C+  + +C IC++ ++++ ++
Sbjct:  193 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGTFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVARSGEVAAGAEGGSSQ---------FMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKV------APAGSAVTNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGSASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCH-----------KEKTSGQVGSR-------------SPSLNSNNETLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKDQVQSRTKI 858          

HSP 2 Score: 66.2402 bits (160), Expect = 1.378e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  967 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1027          

HSP 3 Score: 56.225 bits (134), Expect = 1.713e-7
Identity = 39/148 (26.35%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYDTRQDHK-------------IGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +  +  +             +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  254 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 394          

HSP 4 Score: 51.9878 bits (123), Expect = 3.051e-6
Identity = 53/241 (21.99%), Postives = 99/241 (41.08%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVM------LIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G  YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            + M      +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K               + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  221 GTFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVARSGEVAAGAEGGSSQFMVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKVAPAGSAVTNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 456          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 285.034 bits (728), Expect = 3.142e-81
Identity = 210/673 (31.20%), Postives = 339/673 (50.37%), Query Frame = 2
Query:  782 LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCES--------EPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEIL-LDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQI-----EAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2734
             ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F+ G+ VR++++   +KRLQ GHGEW ++M   LG+VGKV  V  +GDL+V   GQ    NP C+     + ++             T+++ L +++ QS    E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK+L++  +++ AKD+DGD ALH     NQ +I  LL++KGA+VN  NN+  T + +A + G  ++ R+L T  +AD+++ DS  DT LH A+ K   + +EIL +    D    N + FN  H AAL+G+    E+ L R   ++ D +KED F+A+HL ALNNH D   +L+   + D NIRNN  QT L +AV Q H+  V +LV   A++N  D +GDT +H A+  +Q+      + ++   ++   S  G+LG+ TE  +    IA +L + GA ++  N KG +P+++  D      I S +  +  +Q    +    GT +         +R++   PN  +           +        C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  319 FQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSGQPGEVDANLMTAENPSESGSTVISVLEKLLSQST---EQDNPG----RLVIEAAH-GSATKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKVLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGN-TE-LNVGAAIACFLAQEGADINYANHKGKSPLDLVTDSTTLQLIRSFSEKHRLQQ---LQAITCGTSSSSSS-----LRRVHTTPNTMT--------NLAMPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIR 936          

HSP 2 Score: 63.929 bits (154), Expect = 6.916e-10
Identity = 34/130 (26.15%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V ++++ E  KRLQ  +GEW+D M + LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  330 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 454          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 284.648 bits (727), Expect = 3.612e-81
Identity = 210/673 (31.20%), Postives = 339/673 (50.37%), Query Frame = 2
Query:  782 LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCES--------EPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEIL-LDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQI-----EAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGH-VACDVCANNLYECHICRESIENKIR 2734
             ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F+ G+ VR++++   +KRLQ GHGEW ++M   LG+VGKV  V  +GDL+V   GQ    NP C+     + ++             T+++ L +++ QS    E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK+L++  +++ AKD+DGD ALH     NQ +I  LL++KGA+VN  NN+  T + +A + G  ++ R+L T  +AD+++ DS  DT LH A+ K   + +EIL +    D    N + FN  H AAL+G+    E+ L R   ++ D +KED F+A+HL ALNNH D   +L+   + D NIRNN  QT L +AV Q H+  V +LV   A++N  D +GDT +H A+  +Q+      + ++   ++   S  G+LG+ TE  +    IA +L + GA ++  N KG +P+++  D      I S +  +  +Q    +    GT +         +R++   PN  +           +        C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  313 FQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSGQPGEVDANLMTAENPSESGSTVISVLEKLLSQST---EQDNPG----RLVIEAAH-GSATKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKVLLQANSSIEAKDEDGDAALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEILTVVPNIDFTQQNNRGFNLLHHAALKGNKLATEMILSR-ARQLADVKKEDGFSALHLAALNNHRDVAEILVKEGRCDANIRNNRNQTPLQLAVTQGHVALVALLVSEGADVNAEDEEGDTAMHTALSRQQLTNMLSTSEREASALYCRLSSSGLLGN-TE-LNVGAAIACFLAQEGADINYANHKGKSPLDLVTDSTTLQLIRSFSEKHRLQQ---LQAITCGTSSSSSS-----LRRVHTTPNTMT--------NLAMPSAPGPSECLICSELALLVLFSPCQHSVACEECAHRMKKCIKCQVTITKKIR 930          

HSP 2 Score: 63.929 bits (154), Expect = 7.909e-10
Identity = 34/130 (26.15%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V ++++ E  KRLQ  +GEW+D M + LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  324 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FAVGELVRVLDDIESVKRLQAGHGEWTDSMASALGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 448          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008505.1 (pep scaffold:Pmarinus_7.0:GL477211:28706:49738:-1 gene:ENSPMAG00000007672.1 transcript:ENSPMAT00000008505.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.948 bits (450), Expect = 1.833e-46
Identity = 159/583 (27.27%), Postives = 265/583 (45.45%), Query Frame = 2
Query:  740 CIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDV-KVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDC-----ESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVG--TSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGA-DINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK-----------------VKQIEAFKKMGR--------MFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEM 2383
            C+G  + N+  +     GD V+   D Q +  LQQ+HGG+  +M   + +  KV  ++ +GDV  V  +  + +YNP  L K +  Q     +  Q R+S  +  +   +FSP   + LIN+             W+  ++  LG+VG+V  V  +GDL+V + G   N NP CV   D         SE     ++ +   ++  +D +           K   +    GN+  V+KLV       +   EG   L +A + GHIDV + L++  A+    D  G+TALH A   N+  +  LL++  A VN++N+   T + LAA  G  E+ R L      D++  DS  ++ +H A+ ++    +E L      D+   N+  F    LAA +G    ++  L +   K+VD QK D FA +HL A N   D + +L+   ++ +N R    QTAL +A  + H++ V +LV    ++++ D  G+T LH+ +K                 + QI    ++ R        +FG GS+              + +A +L+K GA L   N +G  P + 
Sbjct:  226 CLGD-SSNRTSTMGFCLGDTVRCGVDGQTLMVLQQDHGGFSVAMALIAARPGKVAGLIDNGDVLVVYSNGGKYIYNPKCLIKVKMAQC---ISHLQLRQSFWI--VIALIFSP-SCIALINDDSI---------NWMKMVKPTLGRVGRVVKVLPSGDLRVALGGHIWNFNPACVSTADPKSLDLAETSEDSAADILKERVILVWDTDLNK----------KQLISEAAQGNVGNVQKLVQLFPGQINAQQEGRTALHVAAHQGHIDVARALLKAGASTEIGDDKGNTALHYAAHGNEAAMAGLLVSHRARVNSRNHAGRTALHLAARKGYGEVARTLC-EHACDVNTQDSTKNSPIHDAIAENYEEVIEALTSVKTLDLERQNESGFTPLQLAAFKGSKLAVQRILAKS-PKLVDEQKSDGFAPLHLAAYNGRLDVVHILIKQGRSAVNARTCGGQTALMLAAGRGHVDVVFLLVREACKLDVEDEGGNTALHLVLKEADLFSTDCHLLQDDSTIVQIHYATRVLRINRLRDSGLFGAGSIY-----------AGEALACFLVKEGANLRQTNARGKAPFDY 769          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 5.099e-28
Identity = 99/349 (28.37%), Postives = 169/349 (48.42%), Query Frame = 2
Query: 1373 NDRTKTFFNALKI----GNLNEVRKLVDSVGTS---TLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKM---GRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            N  T++ F  L I    GN+N V  L+ ++G +   T   G+ PL +A   G+ ++VKLL+++ A ++ K +DG T LH A      K+ ++L+ + A + A+  N ++P+ +A     +   +LL   R A +     D  T LH+A         ++LLD G + NA     F   H+A  +   K++EL LK  G  I  +  E     IH+ +   H + +++LL   A  N  N   +T LH+A     L  VK L+++ A + ++  +  TPLHIA ++ + E  + +   G      +  G         +   D+A  LL++GA +    KKG TP+ + +
Sbjct:  206 NQTTESGFTPLHIAAHYGNMN-VATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLL-LGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLK-HGASI-HTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIAS 550          

HSP 2 Score: 116.316 bits (290), Expect = 9.912e-27
Identity = 98/355 (27.61%), Postives = 166/355 (46.76%), Query Frame = 2
Query: 1352 DESDEPDNDRTKTFFNALKIG---NLNEVRKLVDSVGTS---TLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFK-KMGRM--FGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            D   EP N R    F  L I    N  +V +L+   G S   T   G+ P+ +A   GH++VV+LL++  A+ NA +  G+T LH+A    Q+++   L+  GA V  +     TP+ +A+  G  EI +LL   R +D +   +   T L+ A R+   +   +LL+ GADI+ + KK F   H+A+  G  ++  L L++      D + ++    +H+    +H+    +LL   A  +       T LHIA  +  L   K+L+E  AE N+    G  PLH+A +    +     +GR     + +  G+        +   ++A  L KH A ++   K   TP+ + +
Sbjct:  365 DRGGEP-NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL-LQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYAS--ADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVAS 715          

HSP 3 Score: 115.546 bits (288), Expect = 1.579e-26
Identity = 74/244 (30.33%), Postives = 124/244 (50.82%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK 2203
            G  PL  A   GH DV  LL+E  A+++   K G T LH+A    ++++  LL+ K A  + +  N +TP+ +A      ++  LL   + A       +  T LH+A +K+++   ++LL+ GA+ N L ++     HLAA +GHA ++ L L R     +    +    A+HL A  +  +   +L  +KAD+N    +  T LH+A    ++  V  L+ N A +N +  +G TPLH A +
Sbjct:  509 GSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVA-LLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS--ISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQ 749          

HSP 4 Score: 112.079 bits (279), Expect = 1.823e-25
Identity = 76/247 (30.77%), Postives = 128/247 (51.82%), Query Frame = 2
Query: 1466 LEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLL---ATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIA 2197
            L+ + PL +A + GH  V KLL+++    NA+  +G T LH+A  KN+IK+ +LL+  GA ++    + +TPI +A+  G + + +LL     S NA     +   +T LH+A R  ++  V+ LL +GA +    ++     H+A+  G A+I++L L+R      ++        ++  +   H D   +LL   ADI+       T LHIA     L    +L+E YA  + +  +G TPLH+A
Sbjct:  342 LDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNAT----NVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP--NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVA 582          

HSP 5 Score: 110.153 bits (274), Expect = 7.805e-25
Identity = 112/423 (26.48%), Postives = 178/423 (42.08%), Query Frame = 2
Query: 1373 NDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLE-----GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDT-----------------------------ALHLAVRKSRVNSVEILL--DAGADINA---LNKKLFNGF------------------------------------HLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAI---------YLLKHGAGLDMKNKKGLTPMEMCN 2389
            +D   +F  A + GNL    +L+D +     +      G+  L +A   GH+DVV  L+++ A ++   K G+TALH+A    Q  I  +L+  GA++NAQ+ N  TP+ +AA    +EI + L     A+ S+   D  T                             ALH+A RK   N+  +LL  +  AD+ +   LN+   +GF                                    H+AA +G+  +++L L R G KI D++  D    +H  A + HE  + +LL   A I  +     + LH+A   +HL CV++L+   A ++    D  TPLH+A         K +    G  +   + G       TP  IA           LLKHGA +    + GLTP+ + +
Sbjct:    8 SDAATSFLRAARNGNL---ERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFL-LDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDR-GAKI-DTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNG------FTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVAS 418          

HSP 6 Score: 85.5001 bits (210), Expect = 3.464e-17
Identity = 58/190 (30.53%), Postives = 91/190 (47.89%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINA------------------------------LNKKLFNGF---HLAALQGHAKILELFLKRE 1942
            G+ PL +A +  H  V  LL++K A+ ++  K+G T LH+A  KNQ+++  +L+  GA+ N      + P+ LAA  G  ++  LL   R+A +S+      TA+HLA ++ +VN  EIL    AD+N                               +N K  NG+   H AA QGH  ++   L+ E
Sbjct:  575 GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALL-LGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHE 763          

HSP 7 Score: 68.5514 bits (166), Expect = 5.727e-12
Identity = 46/150 (30.67%), Postives = 80/150 (53.33%), Query Frame = 2
Query: 1424 EVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALN 1864
            EV K++  +G  T +   +GV PL +A   GH D+V LL+ + A+++   K G TA+HLA  ++++ + ++L    ADVN       TP+ +A+  G++++   L  +R A ++    +  T LH A ++   + V  LL   A  N L 
Sbjct:  622 EVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNR-ALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELT 770          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 1.512e-27
Identity = 98/346 (28.32%), Postives = 168/346 (48.55%), Query Frame = 2
Query: 1382 TKTFFNALKI----GNLNEVRKLVDSVGTS---TLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKM---GRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            +K+ F  L I    GN+N V  L+ ++G +   T   G+ PL +A   G+ ++VKLL+++ A ++ K +DG T LH A      K+ ++L+ + A + A+  N ++P+ +A     +   +LL   R A +     D  T LH+A         ++LLD G + NA     F   H+A  +   K++EL LK  G  I  +  E     IH+ +   H + +++LL   A  N  N   +T LH+A     L  VK L+++ A + ++  +  TPLHIA ++ + E  + +   G      +  G         +   D+A  LL++GA +    KKG TP+ + +
Sbjct:  202 SKSGFTPLHIAAHYGNMN-VATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLL-LGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLK-HGASI-HTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIAS 543          

HSP 2 Score: 115.161 bits (287), Expect = 1.791e-26
Identity = 97/355 (27.32%), Postives = 164/355 (46.20%), Query Frame = 2
Query: 1352 DESDEPDNDRTKTFFNALKIG---NLNEVRKLVDSVGTS---TLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFK-KMGRM--FGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            D   EP N R    F  L I    N  +V +L+   G S   T   G+ P+ +A   GH++VV+LL++  A+ NA +  G+T LH+A    Q+++   L+  GA V  +     TP+ +A+  G  EI +LL   R +D +   +   T L+ A R+   +   +LL+ GADI+ + KK F   H+A+  G  ++  L L++          ++    +H+    +H+    +LL   A  +       T LHIA  +  L   K+L+E  AE N+    G  PLH+A +    +     +GR     + +  G+        +   ++A  L KH A ++   K   TP+ + +
Sbjct:  358 DRGGEP-NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL-LQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVAS 710          

HSP 3 Score: 111.694 bits (278), Expect = 2.154e-25
Identity = 108/413 (26.15%), Postives = 171/413 (41.40%), Query Frame = 2
Query: 1373 NDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLE-----GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDT-----------------------------ALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILEL---------FLKREG---------------VKI-------VDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAI---------YLLKHGAGLDMKNKKGLTPMEMCN 2389
            +D   +F  A + GNL    +L+D +     +      G+  L +A   GH+DVV  L+++ A ++   K G+TALH+A    Q  I  +L+  GA++NAQ+ N  TP+ +AA    +EI + L     A+ S+   D  T                             ALH+A RK   N+  +LL    + +  +K  F   H+AA  G+  +  L         F  R G               VK+       +D++  D    +H  A + HE  + +LL   A I  +     + LH+A   +HL CV++L+   A ++    D  TPLH+A         K +    G  +   + G       TP  IA           LLKHGA +    + GLTP+ + +
Sbjct:    9 SDAATSFLRAARNGNL---ERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFL-LDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNG------FTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVAS 411          

HSP 4 Score: 111.309 bits (277), Expect = 2.766e-25
Identity = 75/247 (30.36%), Postives = 123/247 (49.80%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINK--GADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK 2203
             G  PL  A   GH DV  LL+E  A+++   K G T LH+A    ++++  LL+ K   AD      N +TP+ +A      ++  LL   + A       +  T LH+A +K+++   ++LL+ GA+ N L ++     HLAA +GHA ++ L L R     +    +    A+HL A  +  +   +L  +KAD+N    +  T LH+A    ++  V  L+ N A +N +  +G TPLH A +
Sbjct:  501 SGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLL-LDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS--ISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQ 744          

HSP 5 Score: 109.383 bits (272), Expect = 1.128e-24
Identity = 93/348 (26.72%), Postives = 155/348 (44.54%), Query Frame = 2
Query: 1466 LEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLL---ATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDS-----------------------------------DGDTPLHIAMKVKQIEAFK---KMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMC 2386
            L+ + PL +A + GH  V KLL+++    NA+  +G T LH+A  KN+IK+ +LL+  GA ++    + +TPI +A+  G + + +LL     S NA     +   +T LH+A R  ++  V+ LL +GA +    ++     H+A+  G A+I++L L+R      ++        ++  +   H D   +LL   ADI+       T LHIA     L    +L+E YA  + + +                                   +G TPLHIA K  Q+E  K   ++G    M +  G+        +   D+   LL   A + +  K GLT M + 
Sbjct:  335 LDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNAT----NVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP--NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLA 676          

HSP 6 Score: 85.1149 bits (209), Expect = 3.790e-17
Identity = 58/191 (30.37%), Postives = 91/191 (47.64%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINA------------------------------LNKKLFNGF---HLAALQGHAKILELFLKREG 1945
            G+ PL +A +  H  V  LL++K A+ ++  K+G T LH+A  KNQ+++  +L+  GA+ N      + P+ LAA  G  ++  LL   R+A +S+      TA+HLA ++ +VN  EIL    AD+N                               +N K  NG+   H AA QGH  ++   L+ E 
Sbjct:  570 GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALL-LGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEA 759          

HSP 7 Score: 68.5514 bits (166), Expect = 4.559e-12
Identity = 46/150 (30.67%), Postives = 80/150 (53.33%), Query Frame = 2
Query: 1424 EVRKLVDSVGTSTLL---EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALN 1864
            EV K++  +G  T +   +GV PL +A   GH D+V LL+ + A+++   K G TA+HLA  ++++ + ++L    ADVN       TP+ +A+  G++++   L  +R A ++    +  T LH A ++   + V  LL   A  N L 
Sbjct:  617 EVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNR-ALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELT 765          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 2.091e-27
Identity = 88/337 (26.11%), Postives = 151/337 (44.81%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREG---------------VKIVDSQK----------------EDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAM---KVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPME 2380
            G+ P+ ++   G++++V +L++  A+ NA +  G+TALH+A    Q ++   L+  GA V+A+   + TP+ +AA  G +EI +LL     A      S+  T LH+A R+   +   ILL+ GA +    KK F   H+A+  G  ++  L L+R                     D+QK                ++ +  +H+ A  +  +    LL Y A+ N         LH+   + H +   +L+  YA++N     G +PLH+A    KV   E   K G      + +G    +         +  +LL+HGA ++ K K G TP+ 
Sbjct:   48 GLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLL-LQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLH 383          

HSP 2 Score: 107.457 bits (267), Expect = 5.633e-24
Identity = 65/223 (29.15%), Postives = 117/223 (52.47%), Query Frame = 2
Query: 1529 LIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIA 2197
            L++K AN N +  +G T LH+A  KN+I++ +LL+  GA + A   + +TP+ ++A  G++ I  +L     A  +  +   +TALH+A R  +   V  LL  GA ++A  ++     H+AA  G  +I++L L+   +   D+   + +  +H+ A   HED   +LL + A + +      T LH+A     +    +L++ +A  +    +G TPLH+A
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQG-GASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQH--MASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVA 220          

HSP 3 Score: 93.5893 bits (231), Expect = 1.071e-19
Identity = 65/248 (26.21%), Postives = 115/248 (46.37%), Query Frame = 2
Query: 1460 TLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK 2203
            T  +G  PL +A   G ++V  LL+++ A+ +A  K+G T LH+A   +  K+  LL+++GA  +A   N  TP                                  LH+A +K ++     LL+ GA+ NA+ ++     HL A +GHA +  L L R     V+   +   + +HL A  +  +   +L+ + A +N    +  T L +A    ++  V  L+++ A++N +  +G TPLH A +
Sbjct:  176 TTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTP----------------------------------LHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLAR--YADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQ 387          

HSP 4 Score: 78.5666 bits (192), Expect = 5.342e-15
Identity = 46/156 (29.49%), Postives = 72/156 (46.15%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLK 1936
            +GV PL +    GH DV  LL+ + A++N   K G + LHLA  ++++ + ++L+  GA VNA      TP+++A   G++++                                  V  LL  GAD+N+  K  +   H AA QGH  I+ L LK
Sbjct:  278 QGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKM----------------------------------VNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLK 399          

HSP 5 Score: 72.7886 bits (177), Expect = 2.852e-13
Identity = 52/190 (27.37%), Postives = 91/190 (47.89%), Query Frame = 2
Query: 1829 LLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFG---MGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            LLD GA+ N      F   H+A  +   +++EL LK  G  I ++  E     +H+ A   + + + +LL   A  N  N   +TALH+A        V+ L+ N A+++ +  +  TPLHIA ++ ++E  + + +        +  G         +  +D+   LL+HGA L +  KKG TP+ + +
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKY-GASI-EAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVAS 188          

HSP 6 Score: 49.6766 bits (117), Expect = 3.415e-6
Identity = 27/82 (32.93%), Postives = 45/82 (54.88%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEI 1717
            G  PL++A + G+I +V  L++  A++N+K K+G T LH A  +    I +LL+  GA  N    N  T + +A   G + +
Sbjct:  345 GYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISV 426          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 2.114e-27
Identity = 84/307 (27.36%), Postives = 150/307 (48.86%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCN 2389
            +G+ PL  A   GH  VV++L+E+ A + AK K+G + LH+A   + ++   +L+   A V+    + +T + +AA  G     ++L   + A+ ++   +  T LH+A +K+R+  +E+LL  GA I A+ +      H++A  G+  I+ + L  +G    ++       A+H+ A     + +R LL   A ++ +    QT LHIA     L  V++L+++ A  +   S+G TPLH+A +                           EG    +D+   LL+HGA L +  KKG TP+ + +
Sbjct:    5 DGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVL-LDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILL--QGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAR---------------------------EGH---EDVTAILLEHGASLAVTTKKGFTPLHVAS 278          

HSP 2 Score: 118.627 bits (296), Expect = 2.574e-27
Identity = 88/336 (26.19%), Postives = 151/336 (44.94%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREG---------------VKIVDSQK----------------EDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAM---KVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPM 2377
            G+ P+ ++   G++++V +L++  A+ NA +  G+TALH+A    Q ++   L+  GA V+A+   + TP+ +AA  G +EI +LL     A      S+  T LH+A R+   +   ILL+ GA +    KK F   H+A+  G  ++  L L+R                     D+QK                ++ +  +H+ A  +  +    LL Y A+ N         LH+   + H +   +L+  YA++N     G +PLH+A    KV   E   K G      + +G    +         +  +LL+HGA ++ K K G TP+
Sbjct:  138 GLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLL-LQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPL 472          

HSP 3 Score: 118.242 bits (295), Expect = 2.951e-27
Identity = 94/355 (26.48%), Postives = 167/355 (47.04%), Query Frame = 2
Query: 1418 LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKV---KQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDD-------LLKARILSLNIPNSTKQDL 2452
            L + R  VD +     L+ +  L +A + GH    K+L++K AN N +  +G T LH+A  KN+I++ +LL+  GA + A   + +TP+ ++A  G++ I  +L     A  +  +   +TALH+A R  +   V  LL  GA ++A  ++     H+AA  G  +I++L L+   +   D+   + +  +H+ A   HED   +LL + A + +      T LH+A     +    +L++ +A  +    +G TPLH+A      K        G      +  G             +IA  LL++GA  +   ++G+ P+ +   +       LL AR   +N  ++TK  L
Sbjct:   58 LMQYRAPVDDI----TLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQG-GASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQH--MASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVN--HATKSGL 403          

HSP 4 Score: 114.775 bits (286), Expect = 3.707e-26
Identity = 84/307 (27.36%), Postives = 146/307 (47.56%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDD---IAIYLLKHGAGLDMKNKKGLTPMEM 2383
            G+ PL +A  G H++ V++L++ RA ++    D  TALH+A      +   +L++KGA+ N +  N  TP+ +A     + +  LL     A +        T +H++     +N V ILL  GA  NA N +     H+AA  G  +++   L R G + VD++  ++   +H+ A     + +++LL + A  +   +   T LH+A  + H +   IL+E+ A + +    G TPLH+A K  ++E    + + F      G  G       +  D   +A+ LL  GA      K G TP+ +
Sbjct:   39 GLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELL-LKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLL-RNGAQ-VDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHI 342          

HSP 5 Score: 95.9005 bits (237), Expect = 2.763e-20
Identity = 69/224 (30.80%), Postives = 117/224 (52.23%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLL---AYKADINIRNNILQTALHIAVLQKHLNCVKIL 2134
            G+ PL +A +  +  V  LL+++ A+ +A  K+G T LH+A  K+Q++I   L+  GA+ NA     + P+ L A  G  ++  LL  +R AD++       + LHLA ++ +VN  EIL+  GA +NA  K  +    +A   G+ K++  FL + G   V+S+ ++ +  +H  A   H   + +LL   A   D+ +  N   TAL IA    +++ V  L
Sbjct:  303 GLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLL-LARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVN-FLLQHGAD-VNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGN---TALAIARRLGYISVVDTL 520          

HSP 6 Score: 93.5893 bits (231), Expect = 1.313e-19
Identity = 65/248 (26.21%), Postives = 115/248 (46.37%), Query Frame = 2
Query: 1460 TLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMK 2203
            T  +G  PL +A   G ++V  LL+++ A+ +A  K+G T LH+A   +  K+  LL+++GA  +A   N  TP                                  LH+A +K ++     LL+ GA+ NA+ ++     HL A +GHA +  L L R     V+   +   + +HL A  +  +   +L+ + A +N    +  T L +A    ++  V  L+++ A++N +  +G TPLH A +
Sbjct:  266 TTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTP----------------------------------LHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLAR--YADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQ 477          

HSP 7 Score: 78.1814 bits (191), Expect = 6.132e-15
Identity = 46/156 (29.49%), Postives = 72/156 (46.15%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLK 1936
            +GV PL +    GH DV  LL+ + A++N   K G + LHLA  ++++ + ++L+  GA VNA      TP+++A   G++++                                  V  LL  GAD+N+  K  +   H AA QGH  I+ L LK
Sbjct:  368 QGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKM----------------------------------VNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLK 489          

HSP 8 Score: 49.2914 bits (116), Expect = 4.739e-6
Identity = 40/153 (26.14%), Postives = 66/153 (43.14%), Query Frame = 2
Query: 1961 SQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKM---GRMFGMGSLMGILGDMTEGSDTPDDIAI---------YLLKHGAGLDMKNKKGLTPMEM 2383
            + ++D    +H  A + HE  + +LL   A I  +     + LH+A    H+ CV++L++  A ++    D  T LH+A         K +   G    + +L G          TP  IA           LLK+GA ++   + GLTPM +
Sbjct:    1 AHRQDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGF---------TPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHV 144          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 67.3958 bits (163), Expect = 4.515e-12
Identity = 58/196 (29.59%), Postives = 96/196 (48.98%), Query Frame = 2
Query: 1715 ITRLLATSRNADLSIG-DSDND-TALHLAVRKSRVNSVEILLDAGADINALNKKLFNG---FHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEI----NLRDSDGDTPLHIAMKV-------KQIEAFKKMGRMFGMG 2254
            + RLL   RN DL    DS+N  ++LH A    R      L+  G D + L  K F G    HLA ++GH + L L L+ +  + ++ + E+  A IH+  +N++  CL +L+   AD+ + +    T LH+ +    ++C+K+L+ N  E+    N+RD     P+ +A          K ++  KK G   G G
Sbjct:   21 VKRLL--RRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHEL-IKTFKGNTCVHLALMKGHEQTLHLLLQ-QFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLL-NEGEVSLDDNVRDKGNWKPIDVAQTFEVGNIYSKVLKEVKKKGPPLGAG 211          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 59.6918 bits (143), Expect = 2.792e-10
Identity = 50/163 (30.67%), Postives = 73/163 (44.79%), Query Frame = 2
Query: 1361 DEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLL----EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKG-ADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSI----GDSDNDTALHLAVRKSRVNSV 1822
            D PD+     F  A  +GNL  V+ L D      L     +GV  L +AV     +V + LIE  A++  KDK     LH A     +K+ +LL   G + VN Q+    TP+  A + G  +   LL     A+  +    G    D AL+  V+K  +N+V
Sbjct:   66 DYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV 228          

HSP 2 Score: 56.6102 bits (135), Expect = 2.711e-9
Identity = 40/136 (29.41%), Postives = 70/136 (51.47%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEK--RANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLD-AGADINALNKK 1870
            G  P  IA + G+++VVK L ++  + +LN     G T LHLAV K   ++   LI  GA V  ++     P+  AAS GS+++  LL     + ++  D    T L  A+ +   ++  +L++  GA+ + ++ K
Sbjct:   72 GWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNK 207          

HSP 3 Score: 56.225 bits (134), Expect = 3.327e-9
Identity = 60/206 (29.13%), Postives = 96/206 (46.60%), Query Frame = 2
Query: 1478 YPLMIA-VNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVN---AQNNNKITPIMLAASSGSVEITR-LLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNG--FHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLA-YKADINIRNN 2071
            YPL  A +      V +LL  K + L  KD+DG   LH +V     +I   L++K  +VN     +++  TP  +A S G++E+ + L       DL+   +   T LHLAV K      + L++ GA +   +K  FN    H AA  G  K++EL L   G   V+ Q +  +  +       H D   +L+  Y A+ ++ +N
Sbjct:    4 YPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDK--FNQIPLHRAASVGSLKLIEL-LCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDN 206          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 58.151 bits (139), Expect = 4.585e-9
Identity = 55/207 (26.57%), Postives = 92/207 (44.44%), Query Frame = 2
Query: 1391 FFNALKIGNLNEVRKLVDSVGTST---LLEGVYPLMIAVNGGHIDVVKLLIEKRANLN-AKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSR-----NADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKIL-ELFLKREGVKIVDSQKEDKF 1981
            F  A K G+L  V+ +V+S         ++ +  L  A       V K L+ + AN N A    G TALH A     I I DLL+  GAD   ++   +  +  +  S ++ +   +         N D+   D++N T L  A  +    +VE+LL  G+ +   + + FN  H A + G  +++ +L L        ++QK+D F
Sbjct:   54 FIEAAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCF 260          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 56.9954 bits (136), Expect = 1.299e-8
Identity = 58/200 (29.00%), Postives = 86/200 (43.00%), Query Frame = 2
Query: 1493 AVNGGHIDVVKLLIEKRANLNAKDKDGD-----TALHLAVPKNQIKICDLLINKGADVNAQNNN-KITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILL-----DAGADINALNKKLFNGFHLAALQGHA-KILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADI 2056
            A   G +  VK +I  +  L   + DGD     T LH A   N++ + D L+++GADVNA+      TP+  AA  G V I   L     AD ++ D      LHL+V  S +  V  +L         DI+  + K       AA QG +  + EL      +KI D++    F  +H   +      L+ L+   AD 
Sbjct:   80 ACQRGDLATVKEMIHGK--LLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLL-KHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTE---GFTPLHWGTVKGQPHVLKYLIQDGADF 273          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 55.8398 bits (133), Expect = 3.238e-8
Identity = 34/89 (38.20%), Postives = 55/89 (61.80%), Query Frame = 2
Query: 1472 GVYPLMIAVNGGHIDVVKLLIEKRA-NLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKI--TPIMLAASSGSVEITRLL 1729
            G   L IA + G  DVVK +IE+   ++N +D  G+TALH A  +  I+I +LLI  GADVN ++      TP++ A+++G +++ + L
Sbjct:  330 GRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYL 418          

HSP 2 Score: 54.299 bits (129), Expect = 8.170e-8
Identity = 41/112 (36.61%), Postives = 57/112 (50.89%), Query Frame = 2
Query: 2051 DINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSD--GDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPME 2380
            DIN ++N   TALH A LQ H+  V++L+EN A++N++  +  GDTPL        I+A           S  G L           D+  YLLK+GA   ++N KGLT  E
Sbjct:  356 DINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPL--------IDA-----------SANGHL-----------DVVKYLLKNGADPTIRNAKGLTAFE 437          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 88.1965 bits (217), Expect = 1.366e-19
Identity = 67/216 (31.02%), Postives = 106/216 (49.07%), Query Frame = 2
Query: 1583 LHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQG-HAKILELFLKREGVKIVDSQKEDK--FAAIHLVALNNHEDCLRVLLAYKADINIRNNILQ--------TALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIA 2197
            LHLA      + C  L+  G DVNA++NN  TP+  AA SG+V    LL  S+  D +  D      LH A   +    V  L+ AG+++N  + K     H AA     AK +E  L+  G    ++ K DK  ++A+H  + N H+  + +LL   A     N++L         T LH+A    H   +++L++++ ++ +RD  G TPL +A
Sbjct:    4 LHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELL-MSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRG----NASKRDKQGYSAVHYASANGHKLAIEMLLDVSA-----NDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLA 209          

HSP 2 Score: 52.7582 bits (125), Expect = 1.572e-7
Identity = 42/156 (26.92%), Postives = 68/156 (43.59%), Query Frame = 2
Query: 1988 IHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDT--PDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQD 2449
            +HL  L    +C + LL Y  D+N ++N  +T LH A    ++NC+++L+    + N  D  G  PLH A                G  +   ++  +T GS+   PD  A   L + A  D+  K        C + LL+ R       N++K+D
Sbjct:    4 LHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAA---------------GHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAK--------CVEHLLRNR------GNASKRD 130          

HSP 3 Score: 47.3654 bits (111), Expect = 8.551e-6
Identity = 45/192 (23.44%), Postives = 75/192 (39.06%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSG--SVEITRLLATSRNA---------------------------DLSIGDSDND-------TALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGV 1948
            PL  A   G+++ ++LL+ +  + N  DK G   LH A      +    L+  G++VN  +    TP+  AA+S   +  +  LL    NA                           D+S  D  N        T LHLA       ++E+L+ +  D+   + +      LA+ QGH + +E  L    +
Sbjct:   36 PLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHNAM 227          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 84.3445 bits (207), Expect = 6.188e-17
Identity = 70/244 (28.69%), Postives = 114/244 (46.72%), Query Frame = 2
Query: 1517 VVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKS-------RVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFK 2227
            ++  +I  RA +  +DKD DT L +A  KN +     L+  GAD+ A++ N    +  AA+ G +E        +    +I D   D  L+  V  S       R++S ++LLD GA I++ N +     H AA  G  + +   LKR+   I++ +       +HL AL+ H   ++ LL     I+ RN  L T L  A  +  +    IL++  A ++  D    TPLH+A +   +E  K
Sbjct:  162 IICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICD---DVCLNGLVGGSNKLILVLRISS-QLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPA-IINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVK 400          

HSP 2 Score: 75.8702 bits (185), Expect = 2.883e-14
Identity = 65/248 (26.21%), Postives = 110/248 (44.35%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIK--------------ICD-----------------------LLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKH 2113
            PLMIA    H+D V+ L++  A++ AKD +   ++  A  +  ++              ICD                       LL++ GA ++++N+  ITPI  AA  G V     L     A ++  D  ++T LHLA        V+ LL  G  I+A N  L+     AA +G  ++  + L  +    VD   + K   +HL +   H + +++LL+ KA+I + ++  +  L IA+   H
Sbjct:  183 PLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAP--VDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSH 428          

HSP 3 Score: 65.4698 bits (158), Expect = 5.637e-11
Identity = 82/361 (22.71%), Postives = 143/361 (39.61%), Query Frame = 2
Query: 1577 TALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIG-----------DSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILEL----------FLKREGVK----------------------IVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKA-----DINIRNNILQTALH--IAVLQKHLN------------CV------------------KILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLM----GILGDMTEGSDTPDDIAIY---------LLKHGAGLDMKNKKGLTPME 2380
            T LH+A     I +   L+  GAD+ + +  ++TP+  A   G++ + +LL  +  A+L  G           D +  TALHLAV     +  ++ L+ GA++NA+ +     FH   +     I  +          F K E +K                       ++ + +DK   + + A  NH D +R LL + A     DIN RN++ + A    +  L+  L             C+                  ++L++N A I+ ++ +  TP+H A          K GR+  + +L+     I+ D    S+TP  +A           LL  G  +D +N    TP++
Sbjct:    6 TPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVA--AELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYA---------AKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLD 355          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 76.2554 bits (186), Expect = 8.146e-16
Identity = 49/162 (30.25%), Postives = 82/162 (50.62%), Query Frame = 2
Query: 1469 EGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALH------LAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLK 1936
            +G  PL  A    H+D+V++L++  A+++ +   G  ++        A   N I+ C +L+  GADVN  N    T +  A   G  ++  LL      D+++ D DN T+LH+A        ++ LL  GA+I A +   F  FHLAA +G  ++L+  L+
Sbjct:   28 DGFSPLHYATTTNHVDIVQMLLDAGADVDVR---GSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 2 Score: 69.3218 bits (168), Expect = 2.049e-13
Identity = 63/244 (25.82%), Postives = 98/244 (40.16%), Query Frame = 2
Query: 1517 VVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNN---NKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGR 2239
            V KLL     NLN  D DG + LH A   N + I  +L++ GADV+ + +    +I PI+ AA   ++E                                  S  +LL AGAD+N  N       H A  +GH+K++EL L R+G                                 + D+N+ +    T+LH+A +      +K L+   A I  +D+DG T  H+A +  + E  + + R
Sbjct:   11 VRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIE----------------------------------SCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLL-RDG---------------------------------QMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 3 Score: 54.6842 bits (130), Expect = 1.842e-8
Identity = 44/141 (31.21%), Postives = 66/141 (46.81%), Query Frame = 2
Query: 1793 AVRKSRVNSVEILLDAG-ADINALNKKLFNGFHLAALQGHAKILELFLKREG-VKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILV-ENYAEINLRDSDGDTPLHIAMKV 2206
            A R  R + V  LL     ++N L+   F+  H A    H  I+++ L     V +  S    +   I   A  N  +  RVLL   AD+NI N   QTALH A  + H   V++L+ +   ++N+ D D  T LH+A  +
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMI 142          

HSP 4 Score: 54.6842 bits (130), Expect = 2.225e-8
Identity = 46/164 (28.05%), Postives = 80/164 (48.78%), Query Frame = 2
Query: 1370 DNDRTKTFFNALKIGNLNEVRKLVDS-----VGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKG-ADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAG 1843
            D D       A    +++ V+ L+D+     V  S  ++ + P++ A     I+  ++L+   A++N  +  G TALH A  +   K+ +LL+  G  DVN  + +  T + +AA  GS  I + L     A+++  D+D  TA HLA R+     ++ LL  G
Sbjct:   26 DADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFC-GANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 73.9442 bits (180), Expect = 9.134e-15
Identity = 52/184 (28.26%), Postives = 88/184 (47.83%), Query Frame = 2
Query: 1388 TFFNALKIGN-LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLK 1936
            T F+AL      N V  + + +   ++ +   PL +A   G ++V +LL+EK A L+ K+  G+T LH+A           L++KG  ++ ++ +  TP + A ++G  E   LL           D +  + LHLA    R   VE L  AG   N  +++  +  H+AAL G  K++   L+
Sbjct:    7 TGFSALHHATRYNRVEAMAELIRNGSIEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK--------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLR 182          

HSP 2 Score: 63.5438 bits (153), Expect = 3.195e-11
Identity = 62/225 (27.56%), Postives = 100/225 (44.44%), Query Frame = 2
Query: 1550 LNAKDKDGDTALHLAVPKNQIKICDLLINKGA--DVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIE 2218
            LN  D  G +ALH A   N+++    LI  G+  D++       TP+ +A   GS+E+ RLL   + A L   +   +T LH+A      ++++ LL  G  I+  +      F  A   G  +   L L+++         E++ + +HL         +  L       N R+   Q+ALH+A L      V  L+   A+IN RDS+  TPL  A K   ++
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELIRNGSIEDLS-------TPLHVACKKGSMEVGRLL-VEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKD---------ENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVK 208          

HSP 3 Score: 58.5362 bits (140), Expect = 1.510e-9
Identity = 29/78 (37.18%), Postives = 47/78 (60.26%), Query Frame = 2
Query: 1481 PLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVE 1714
            PL +A   G    V+ L     + N +D++G +ALH+A      K+   L+  GAD+NA+++N+ TP+M AA +GSV+
Sbjct:  131 PLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVK 208          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 73.1738 bits (178), Expect = 4.655e-14
Identity = 68/248 (27.42%), Postives = 119/248 (47.98%), Query Frame = 2
Query: 1388 TFFNALKIGNLNEVRKLVDSVGTSTL--LEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCV 2125
             F +A+  G+++EV+KL+          ++G+  L  A    + D+VK+L++K A+++ +D +G T+LH A     ++I   LI  GADV A NN    P+ LA      E    L T    +  I D D+  A+     K  +N  +  L+      + +K   +  H+A+ +G+ K++ L L+  GV+I +++  D +  +H  A    +D   +L    AD N RN ++        L+  L C 
Sbjct:   52 VFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEE----EDMEDLLTDEIENQGI-DVDDARAVE---EKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQL-GVEI-NAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNKMVGIDHQQNWLKNFLECF 289          

HSP 2 Score: 64.6994 bits (156), Expect = 3.597e-11
Identity = 56/211 (26.54%), Postives = 104/211 (49.29%), Query Frame = 2
Query: 1592 AVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADIN-IRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEA 2221
            AV    +     L+ KGAD+N QN + +T +  A    + ++ ++L   + A + + D++  T+LH A     V   + L++ GAD+ A+N +      LA  +    +L   ++ +G+ + D++     A    + LN+ +  L      K  IN  ++    +ALH+A  + +L  + +L++   EIN +D+D  TPLH A    Q +A
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVL-VDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDAR-----AVEEKIMLNDAQSWLN-----KNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDA 255          

HSP 3 Score: 51.9878 bits (123), Expect = 4.833e-7
Identity = 36/126 (28.57%), Postives = 61/126 (48.41%), Query Frame = 2
Query: 2018 DCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDD 2395
            D ++ LLA  ADIN +N    TALH A + ++ + VK+LV+  A +++RD++G T LH A     +E                              IA YL+++GA +   N +G  P+++  ++
Sbjct:   63 DEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVE------------------------------IAKYLIENGADVAAVNNEGELPLDLAEEE 158          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 305.449 bits (781), Expect = 1.930e-88
Identity = 233/753 (30.94%), Postives = 356/753 (47.28%), Query Frame = 2
Query:  776 EKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESE--------PDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGA-DINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMG------------------SLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEM--------------------------CNDDLLKARILSLNIPNSTKQDLIEKEPNPGTK--------------------------AERFEAPI-------APIRQ------LSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
               ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F  G+ VR+++    +KRLQ GHGEW ++M  VLG+VGKV  V  +GDL+V   GQ    NP C+ A   D ++             T+++ L +++ QS    E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK L++   ++  KD+DGDTALH A   NQ +I  LL++KGA+VN  NN+  T + +A + G  ++ R+L T  +AD+++ DS  DT LH A+ K   + +E+L+   + D    N + FN  H AAL+G+    E  L R   ++VD +K+D F+A+HL ALNNH D   VL+   + DIN+RNN  QTAL +AV Q H   V++LV+  A++N+ D DGDT +H+A+   Q+ A   +    G G                  S  G+LG+      T   IA +L + GA ++  N KG +P+++                          C   L  A +  ++   +T  +L+   P PG                            A R +  I         IRQ       SP      +   LE+L+ R + ME+  TC IC D  I + F CGH +C  C+  L  C ICR++I  +I+L+
Sbjct:  316 HSFQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVDVDANLMTTENPNESGSTVISVLEKLLSQST---EQDNP----CRLVIEAAH-GSAVKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKALLQANCSVEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILAR-ARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQL-ANVMLSPAVGTGATEDNSEGCSPTTLHGRLSSSGLLGNGELSVGTA--IACFLAQEGADINYANHKGKSPLDLLADSGALQLIKSFSEKHRLQRLQAITCGQGLSSASLRRVHTTPNTMTNLVLPTP-PGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIRQDQTEVDCSPGTENSEQHNLLEQLQSRYRQMEERITCPICIDNHIKLVFQCGHASCIECSAALKTCPICRQTIRERIQLF 1027          

HSP 2 Score: 63.5438 bits (153), Expect = 1.073e-9
Identity = 34/130 (26.15%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V +++  E  KRLQ  +GEW+D M  +LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  329 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 453          

HSP 3 Score: 51.2174 bits (121), Expect = 6.034e-6
Identity = 33/130 (25.38%), Postives = 59/130 (45.38%), Query Frame = 2
Query:  356 FKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCI 745
             +++Q  +G W+  M   + +   + +    G+V+++Y            LT            TF  GE V ++   E +K LQ  HG W + M   +G+  +++K+  DGD+ V+  G  W  NP C+
Sbjct:  333 LRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALT---------KVNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 453          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 305.449 bits (781), Expect = 4.367e-88
Identity = 233/753 (30.94%), Postives = 356/753 (47.28%), Query Frame = 2
Query:  776 EKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESE--------PDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGA-DINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMG------------------SLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEM--------------------------CNDDLLKARILSLNIPNSTKQDLIEKEPNPGTK--------------------------AERFEAPI-------APIRQ------LSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
               ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F  G+ VR+++    +KRLQ GHGEW ++M  VLG+VGKV  V  +GDL+V   GQ    NP C+ A   D ++             T+++ L +++ QS    E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK L++   ++  KD+DGDTALH A   NQ +I  LL++KGA+VN  NN+  T + +A + G  ++ R+L T  +AD+++ DS  DT LH A+ K   + +E+L+   + D    N + FN  H AAL+G+    E  L R   ++VD +K+D F+A+HL ALNNH D   VL+   + DIN+RNN  QTAL +AV Q H   V++LV+  A++N+ D DGDT +H+A+   Q+ A   +    G G                  S  G+LG+      T   IA +L + GA ++  N KG +P+++                          C   L  A +  ++   +T  +L+   P PG                            A R +  I         IRQ       SP      +   LE+L+ R + ME+  TC IC D  I + F CGH +C  C+  L  C ICR++I  +I+L+
Sbjct:  372 HSFQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVDVDANLMTTENPNESGSTVISVLEKLLSQST---EQDNP----CRLVIEAAH-GSAVKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKALLQANCSVEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILAR-ARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQL-ANVMLSPAVGTGATEDNSEGCSPTTLHGRLSSSGLLGNGELSVGTA--IACFLAQEGADINYANHKGKSPLDLLADSGALQLIKSFSEKHRLQRLQAITCGQGLSSASLRRVHTTPNTMTNLVLPTP-PGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIRQDQTEVDCSPGTENSEQHNLLEQLQSRYRQMEERITCPICIDNHIKLVFQCGHASCIECSAALKTCPICRQTIRERIQLF 1083          

HSP 2 Score: 63.5438 bits (153), Expect = 1.110e-9
Identity = 34/130 (26.15%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V +++  E  KRLQ  +GEW+D M  +LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  385 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 509          

HSP 3 Score: 51.2174 bits (121), Expect = 6.056e-6
Identity = 33/130 (25.38%), Postives = 59/130 (45.38%), Query Frame = 2
Query:  356 FKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCI 745
             +++Q  +G W+  M   + +   + +    G+V+++Y            LT            TF  GE V ++   E +K LQ  HG W + M   +G+  +++K+  DGD+ V+  G  W  NP C+
Sbjct:  389 LRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALT---------KVNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 509          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 291.967 bits (746), Expect = 1.188e-83
Identity = 218/733 (29.74%), Postives = 363/733 (49.52%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG--------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQ-DLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   +L A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A ++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +  +          I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D            PN  K      KE + G    R              P++ S  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  197 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKI------APSGSAVSNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPD------------PNLCKALAKCHKEKSSGQVGTR-------------SPSLNSNMESLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 862          

HSP 2 Score: 66.2402 bits (160), Expect = 1.310e-10
Identity = 25/61 (40.98%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 2558 ELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            ++++L+Q++QD++++  C +C DR  N+ F CGH  C +C + + EC ICR++IE +I LY
Sbjct:  960 DVQKLQQQLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1020          

HSP 3 Score: 56.225 bits (134), Expect = 1.670e-7
Identity = 41/149 (27.52%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYD--------------TRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +              + Q H +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  258 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFH-VGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 398          

HSP 4 Score: 51.6026 bits (122), Expect = 4.436e-6
Identity = 53/241 (21.99%), Postives = 101/241 (41.91%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXK------VMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G+ YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            +      V +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K   +           + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  225 GSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 460          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 291.582 bits (745), Expect = 2.991e-83
Identity = 216/732 (29.51%), Postives = 365/732 (49.86%), Query Frame = 2
Query:  677 ILKDGDMYVSRLGMEWMINPKCI----------------GKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSME---FCSGKICKVQS------ILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVN----QLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV--DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFL-KREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMG--------ILGDMTEGSD--TPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFG-CGHVA-CDVCANNLYECHICRESIENKIRL 2737
            +  +G   + R+G E M + KC+                G++N N+     L+ GD+V I  D++ ++ LQ  HGGW + M      +G +C +          PSG+           +NP +LTK    ++   AA  +   S          F  GD V++  +  +IK LQ+GHGEW  AM   LGKVG+V+ +  + DLKV++ G     NP  V          P    + N    +L+Q++ +   + ES + + +  K   N    G+L +V  ++    V  +    G   +  A   GH+DV+KLL++   +L A+DKDGD A+H A   ++  + ++L   GAD+NA+N  + TP+ +A + G +++ + L        S+ DS+ DT LH A+ K R + + +LL+AGAD+   N   FN  H AAL+G+   + + L K     IVD +K+D + A+HL ALNNH +   +L+    A ++I+N   QTALH+AV ++H   V++LV   A+++++D DGDTPLH A++   +   +++  M  +  +          I+G  T+G++  +   IA +L  +GA L ++NKKG +P+++C D  L   +   +   S+ Q         GT++                P++ S  E LEE             C++C D   +  FG CGH+A C +C+  + +C IC+E ++++ ++
Sbjct:  197 LWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNR-NPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGN--------RWTFNPAVLTKANVVRSGEVAAGAEGGSSQ---------FHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKI------APSGSAVSNASGERLSQLLKKLFETQESGDINEELVKAAAN----GDLAKVEDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTL-LDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNASLDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQ--------VGTRS----------------PSLNSNMESLEE-------------CMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 862          

HSP 2 Score: 56.6102 bits (135), Expect = 1.218e-7
Identity = 41/149 (27.52%), Postives = 68/149 (45.64%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNECLTGPCQLVQSLGS-CAI-------VKGPSGNVYRLNSELLIQYD--------------TRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            D+E ++  Q  HGGW   M E LT       + G+ C I       V+ PSGN +  N  +L + +              + Q H +G  V +  + +  K LQ  +GEW++ M   LGK   + Q + D ++K++  G ++  N  A+
Sbjct:  258 DLEIVQSLQHGHGGWTDGMFETLT-------TTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFH-VGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAV 398          

HSP 3 Score: 52.373 bits (124), Expect = 2.300e-6
Identity = 53/241 (21.99%), Postives = 101/241 (41.91%), Query Frame = 2
Query:  254 GNVYRLNSELLIQYDTRQDH---KIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKY-RGRTFRINSKAILTDNCKKTSMXXXXXXXXXXK------VMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNS---MEFCSGKICKVQSILPSGDVKVN 937
            G+ YR +  +L + +  ++    +IG  V +  + E  + LQ  +G W+D M   L     +    +D ++ ++Y  G  +  N   +   N  ++            +      V +  + + +K LQ+ HG W E M   +G+   + +I  D D+ V   G  W  NP  + K   +           + Q+   ++K+ + Q++  G +N        +G + KV+ IL   DV VN
Sbjct:  225 GSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANVVRSGEVAAGAEGGSSQFHVGDLVQICYDIDRIKLLQRGHGEWAEAMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVTKIAPSGSAVSNASGERLSQL---LKKLFETQES--GDINEELVKAAANGDLAKVEDILKRPDVDVN 460          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 283.493 bits (724), Expect = 3.674e-81
Identity = 220/695 (31.65%), Postives = 341/695 (49.06%), Query Frame = 2
Query:  776 EKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNV-DRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESE--------PDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLV----DSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGA-DINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMG------------------SLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEA-------PIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTF-GCGH-VACDVCANNLYECHICRESIENKIR 2734
               ++GD V+   ++  ++Q+Q+ HGGW   M     +I  V  I   GDV+V   + +   ++P  LTK                         V  F  G+ VR+++    +KRLQ GHGEW ++M  VLG+VGKV  V  +GDL+V   GQ    NP C+ A   D ++             T+++ L +++ QS    E D P     +    A   G+  +VR+LV    D V      +G   L +A + GH++VVK L++   ++  KD+DGDTALH A   NQ +I  LL++KGA+VN  NN+  T + +A + G  ++ R+L T  +AD+++ DS  DT LH A+ K   + +E+L+   + D    N + FN  H AAL+G+    E  L R   ++VD +K+D F+A+HL ALNNH D   VL+   + DIN+RNN  QTAL +AV Q H   V++LV+  A++N+ D DGDT +H+A+   Q+ A   +    G G                  S  G+LG+      T   IA +L + GA ++  N KG +P+++  D      I S +          EK      + +R +A         A +R++   PN  +           +        C+IC +  + V F  C H VAC+ CA+ + +C  C+ +I  KIR
Sbjct:  247 HSFQQGDKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALTK-------------------------VNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACLSAQPVDVDANLMTTENPNESGSTVISVLEKLLSQST---EQDNP----CRLVIEAAH-GSAVKVRELVQKHPDKVDIKN--QGKTALQVAAHQGHMEVVKALLQANCSVEVKDEDGDTALHYAAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDVVRVL-TEHSADVNLQDSYGDTPLHDAIAKDFRSIIEMLVVVPSIDFTQQNHRGFNLLHHAALKGNKLATEKILAR-ARQLVDVKKDDGFSALHLAALNNHRDVAEVLVKEGRCDINVRNNRNQTALQLAVTQGHTELVQLLVDEGADVNMEDEDGDTAMHVALLRPQL-ANVMLSPAVGTGATEDNSEGCSPTTLHGRLSSSGLLGNGELSVGTA--IACFLAQEGADINYANHKGKSPLDLLADSGALQLIKSFS----------EKH-----RLQRLQAITCGQGLSSASLRRVHTTPNTMT--------NLVLPTPPGPSECLICSELALLVLFCPCQHSVACEECAHRMKKCIKCQVTITKKIR 878          

HSP 2 Score: 63.1586 bits (152), Expect = 1.276e-9
Identity = 34/130 (26.15%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  125 DMETIKIKQREHGGWNANMNE--CLTGPCQLVQSLGSCAIVKGPSGNV-YRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAI 505
            +++ ++  Q  HGGWN  M E  C  G    +   G   +    S N+ +  +   L + +T     +G  V +++  E  KRLQ  +GEW+D M  +LG+  ++++ + DG++++ + G+T+  N   +
Sbjct:  260 EVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQY--SNNIRWTFHPGALTKVNT---FGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 384          

HSP 3 Score: 50.8322 bits (120), Expect = 7.742e-6
Identity = 33/130 (25.38%), Postives = 59/130 (45.38%), Query Frame = 2
Query:  356 FKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCI 745
             +++Q  +G W+  M   + +   + +    G+V+++Y            LT            TF  GE V ++   E +K LQ  HG W + M   +G+  +++K+  DGD+ V+  G  W  NP C+
Sbjct:  264 LRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPGALT---------KVNTFGVGELVRVLDEVETVKRLQAGHGEWTDSMTPVLGQVGKVLKVYADGDLRVAFGGQTWTFNPACL 384          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Planmine SMEST
Match: SMESG000017279.1 (SMESG000017279.1)

HSP 1 Score: 1489.94 bits (3856), Expect = 0.000e+0
Identity = 742/895 (82.91%), Postives = 802/895 (89.61%), Query Frame = 2
Query:   68 MGGAESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQ---DLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLYK 2743
            MGG ESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMEMEETFEEGEKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAAR QRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVN GHIDV+KLLIEKRAN+NAK+++GDTALH+AV K++ KICDLLINKGADVNAQNNNKITPIMLAAS+GS++ITRLLATSRNADLSIG+S+NDTALHLAV+     SV +LLDAGADI A+N K FN FHL A +G+ +ILE+FLKREGVKIV+SQK+DKFAA+HL   NNHE CLRVLL YKADINIRNN LQTALHIAV QK+LNC+KILVE  AEI++ D++GDT LHIA+++  ++  KK G++ G+  +        EGSD P+D+AIYLLK  A  D+KNK   TPM+ C D  LK ++   N    +K+    +++ + +    A    A        +   ++K++DEELEELRQRIQDMEDE+TCIIC+DR  NVTFGCGHVACDVCANNLYECHICRE+I NKIRLY+
Sbjct:    1 MGGVESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMEMEETFEEGEKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARAQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNEGHIDVIKLLIEKRANINAKEENGDTALHIAVQKDKFKICDLLINKGADVNAQNNNKITPIMLAASAGSMDITRLLATSRNADLSIGNSENDTALHLAVKNFHAESVNVLLDAGADIRAVNNKNFNAFHLVAQRGNERILEMFLKREGVKIVNSQKDDKFAALHLAVFNNHEGCLRVLLKYKADINIRNNNLQTALHIAVSQKYLNCMKILVEKGAEIDVTDANGDTALHIAVRIHSMDTVKKRGKLLGISGIFQSTASSNEGSDKPEDLAIYLLKKKARTDIKNKNDRTPMDFC-DPSLKEKLSVANARRMSKEIETKILQAQGSTTVAAGGLMAHPGDHIDRNSAQHLKTKDEELEELRQRIQDMEDERTCIICFDRQNNVTFGCGHVACDVCANNLYECHICRENIGNKIRLYR 894          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Planmine SMEST
Match: SMESG000017281.1 (SMESG000017281.1)

HSP 1 Score: 1322.38 bits (3421), Expect = 0.000e+0
Identity = 683/905 (75.47%), Postives = 760/905 (83.98%), Query Frame = 2
Query:   68 MGGAESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQY--DTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMG-QSDHSDESDE-PDNDRTKT---------FFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLYK 2743
            MG + S   +   VVI  KD+ETI   Q  HGGWN +MNECL GPC+LVQ +GS AIV+GPSGNVYRLNSELL +Y  DT Q+   G  V LI++ ++F++LQV +GEW+++M +I+GKKV++I +F DG+VKIKY G TF IN KAI + N K    E+   F+ GEKV+LI N + MK LQ++HGGW +L+ L+ G+EVEIV+I +DGDMYVS+ GMEWMINP+CI        K  KLRKGD V + DDIQK KQLQQNHGGWV+ M   +GK  K+++ILP+GDVKVNV+ L LVYNP+LLTK +                    K ++K+F+PGDKVRLIN+K K+K LQK HGEWV++M+F LGK GKVKS+  +GDL+VKIM Q L LNPECVEATDSD +S+PDI +M+  L+++M   SD SD+ D+  D+D  KT          F A+K G LN VR L +SVG +  L+G+YPLMIAVN GHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLYK
Sbjct:    1 MGASLSGLKAGDDVVIAIKDLETIIQMQMAHGGWNDSMNECLIGPCKLVQGIGSDAIVRGPSGNVYRLNSELLSKYGSDTSQESISGYVVELIQDEKQFRQLQVGHGEWNNNMKDIIGKKVQVIHKFLDGDVKIKYNGSTFVINPKAIASKNEKPPVSEVCHKFKIGEKVVLIGNVDTMKKLQENHGGWSDLLMLYAGKEVEIVEIFEDGDMYVSKFGMEWMINPECI------DVKDNKLRKGDTVILSDDIQKTKQLQQNHGGWVSRMSVFAGKCGKIEAILPTGDVKVNVNGLGLVYNPLLLTKSD--------------------KSDLKMFAPGDKVRLINDKSKVKLLQKNHGEWVSSMEFFLGKKGKVKSLFADGDLRVKIMNQNLTLNPECVEATDSDSDSDPDIFSMMEHLSKLMNLDSDQSDQEDKGKDSDDGKTDGNQEEVMKLFFAVKNGELNNVRNLCESVGVNARLKGIYPLMIAVNEGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLYK 879          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Planmine SMEST
Match: SMESG000031930.1 (SMESG000031930.1)

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 311/644 (48.29%), Postives = 417/644 (64.75%), Query Frame = 2
Query:  815 DIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQ--RRRSSALEKLE-VKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHEDCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEPNPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRL 2737
            D+  I + Q+NHGGW + M+ C    CK+          +N D               G+ A      G   R  S  L   + VK    G  V+LI ++ + K LQ  HGEW   M+ +LGK  +V  +  +GD K+    +   ++P+ +++     E   + +   +        +D S  +DE    RT  F  ALK GNL+EV +LVDSVG +T L+G+YPL+IA N GH D+V LL+EK+AN+N  DKDGDTALHLAV +N+ K+CDLL+ KGADVNAQNN KITP M+A   GS +I  LL TS NADLSIGDSD DTALHLAV  SR+ SVE LL+AGADI  LNKKLFN +HLAA+ GH KILE+FLKR+G K+V+SQKEDKFAAIH+ A+NNHE CL VL+ YKAD+N++N  L+TALHIAV +K+L+ VK LVEN AE++L+D +G+T LH+AMKV Q E+    G    M S +G+LG++ EG D  +DIAIYL+++GA +D+KN KG TP+++CND+ LK RILSL   +S K  +        TK E  E P+        P + +S + EL ELRQ++++MEDEK C IC+DR + V F CGH+ CD C++N+ ECH+C E I +KI++
Sbjct:   20 DLSTIIKKQKNHGGWNDLMKECLTGPCKL----------INDD---------------GSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKS-----EIVENTELKSDDSDDSDDSNDRSLITDE----RTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVNLLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSIGDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENKAELDLKDKNGNTALHVAMKVNQTES--GFGNFLKMTSALGVLGNIGEGLDKLEDIAIYLIENGASIDIKNNKGKTPLDICNDNSLKTRILSLVERDSQKHHI--------TKKELLEHPV-------QPSDARSNEAELMELRQKLKEMEDEKICKICHDRRLKVIFECGHMCCDDCSDNISECHLCSEKILHKIKI 612          

HSP 2 Score: 161.77 bits (408), Expect = 2.328e-41
Identity = 79/156 (50.64%), Postives = 106/156 (67.95%), Query Frame = 2
Query:   68 MGGAESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQSLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRLQVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDNCKKTSM 535
            MG   S  +   +VVI  +D+ TI  KQ+ HGGWN  M ECLTGPC+L+   GS A V GPSG +YRLNSELL+ + + + HKIGSFV LI++ EEFK LQ  +GEW +DM NILGK+VE+IQ F+DG+ KI +    F ++ K I ++  + T +
Sbjct:    1 MGANISSFDIRKKVVIANQDLSTIIKKQKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTEL 156          

HSP 3 Score: 64.3142 bits (155), Expect = 3.555e-10
Identity = 98/440 (22.27%), Postives = 183/440 (41.59%), Query Frame = 2
Query:  608 QKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRK-GDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTK--CEGNQANP---------------TAARGQR----RRSSALEKLEVKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGD--LKVKIMGQKLNLNPECV-EATDSDCESEPDIQ-TMV------NQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGNLNEVRKLVDSVGTSTLLEG--VYPLMIAVNGGHIDVVKLLIEKRAN--LNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNS 1819
            QK+HGGW +LM   +    +++         +   GM + +N + +       FKS K  K G  VQ+  D ++ K LQ  HG W   M    GK  +V  I   GD K++ +    + +P  +     E  +                  T  R  R     ++  L ++   V S G    L      +    +GH + VN    +L K   +   D +GD  L + +   +  L    + +  D + ++   I  TM+        + +++  S+++D S   D+DR      A+    L  V  L+++     LL         +A   GH  ++++ +++     +N++ +D   A+H+A   N      +L+   AD+N QN    T + +A     +   + L  ++ A+L + D + +TALH+A++ ++  S
Sbjct:   28 QKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVP-----FKSVKKHKIGSFVQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTIKSEIVENTELKSDDSDDSDDSNDRSLITDERTMRFLVALKTGNLSEVLRLVDSVGVNTNLKGMYPLLIAANEGHEDLVN---LLLEKKANINIADKDGDTALHLAVHENRFKLCDLLLKKGADVNAQNNKKITPTMIAVLKGSQDILELLITSNNADLSI-GDSDRDTALHLAVNSSRLESVEALLNAGADIYLLNKKLFNAYHLAAISGHEKILEIFLKRDGEKLVNSQKEDKFAAIHMAAMNNHEHCLPVLMKYKADLNLQNIELRTALHIAVKRKYLSFVKHLVENK-AELDLKDKNGNTALHVAMKVNQTES 457          

HSP 4 Score: 55.0694 bits (131), Expect = 2.542e-7
Identity = 38/127 (29.92%), Postives = 62/127 (48.82%), Query Frame = 2
Query:  368 QVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILT-DNCKKTSMXXXXXXXXXXKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYVSRLGMEWMINPKCI 745
            Q  +G W+D M   L    ++I         +   G  +R+NS+ ++   + KK  +           V LI++ E  K LQ  HG W E M   +G+EVE+++I KDGD  +S     ++++PK I
Sbjct:   28 QKNHGGWNDLMKECLTGPCKLINDDGSDATVMGPSGMIYRLNSELLVPFKSVKKHKIGSF--------VQLIQDEEEFKLLQNTHGEWKEDMRNILGKEVEVIQIFKDGDYKISHNNEIFIVHPKTI 146          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Planmine SMEST
Match: SMESG000030607.1 (SMESG000030607.1)

HSP 1 Score: 227.254 bits (578), Expect = 4.208e-61
Identity = 189/671 (28.17%), Postives = 318/671 (47.39%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYV-SRLGMEWMINPKCIGK-----RNENKFKSEK--------LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLE--VKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDS-------DCESEPDIQTMVNQLTQIMGQSDHSDESDEP------------------------DNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIE---KRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVK-IVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGS-LMGI-LGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCND-DLLKA 2407
            +V++  + ++++NLQ  HGGW + M   +  E  + +I +DGD+ V    G ++  NP C+ K       EN   S++        LR G       +I + +  + +                   S +P  D           YNP    +       PT+   Q R SS    L    +  SPG  V++ ++   IK +Q G G W  +M   +G VGK+  V   G    +++  + + + E     +S          S P++     Q   ++     +  + +P                          D  + F  A   G+L++V +L+   SV  +++      L  A   GH+++V+ LI+    + ++N KD DGD A+H A   +   I  +L N GAD+N++N    TP+ +A + G +E+ + L   ++A  +  D D DT LH ++ +        L+ A +DI   N   FN  H AAL+G+     + L+    + IVD +K+D + A+HL ALNNH D   +L+    AD+N++N  LQT LH+AV ++H N VK+LV++ A+I++ D DGDTPLH A++   +   ++M  +  MG  LMG+ LG     +     IA YL+ +G+ + +KNKKG TP+++C D +L++A
Sbjct:  250 QVVIDLDFDIVRNLQVGHGGWADCMMECLSMEGTVTQIDEDGDVQVIFSSGAQYTFNPVCLTKTTRRDHGENSLSSQRSTITVPITLRPGAT-----NISRTRSTESDD--------------VPTSSTVPDSDTTR--------YNPHNPRR----STLPTSVYAQHRDSSQSRPLSHAPESLSPGCWVKISSDLELIKTVQCGLGMWNESMAVCVGTVGKI--VQSLGHDLWRVVLSRTSGSSESTFVLNSALLARIRSPMSSPEVSVSATQPRTMLLSQRSTGSTSQPIEAVEAASTGTLSHVLRSIFEAHTTGDAKELFVKAAANGDLDKVLELLKKRSVDVNSMFARHSALHAASQNGHVEIVQALIKYGGDQLDINLKDPDGDAAVHHAALGDHKIIIQILKNAGADINSRNRRNQTPLHIAVNKGHLEVLKALLELKSALQTNQDYDGDTPLHDSITRRHDKLTLALVQANSDITVCNNAGFNSLHHAALRGNPNATRIILENLPRQWIVDEKKDDGYTALHLAALNNHADVAELLIKVGSADLNVQNINLQTPLHLAVERQHSNMVKLLVDSGADISIPDKDGDTPLHEALRHHTLSQLRQMQDLQDMGKLLMGLSLGGEKRSA---AHIACYLVSNGSDIHIKNKKGQTPLDLCPDQNLIRA 884          

HSP 2 Score: 66.6254 bits (161), Expect = 8.489e-11
Identity = 27/64 (42.19%), Postives = 42/64 (65.62%), Query Frame = 2
Query: 2549 RDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            +D++ ++L Q+ QD+++   C +C DR   + F CGH +C +C + L  C ICRE+I NKI LY
Sbjct: 1230 KDKDYKKLEQQYQDIKEMTMCPVCMDRVRKMVFMCGHCSCQLCGDKLETCPICRETITNKILLY 1293          
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Planmine SMEST
Match: SMESG000030607.1 (SMESG000030607.1)

HSP 1 Score: 224.172 bits (570), Expect = 4.370e-60
Identity = 189/671 (28.17%), Postives = 317/671 (47.24%), Query Frame = 2
Query:  566 KVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVEIVKILKDGDMYV-SRLGMEWMINPKCIGK-----RNENKFKSEK--------LRKGDIVQICDDIQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNPMLLTKCEGNQANPTAARGQRRRSSALEKLE--VKVFSPGDKVRLINNKHKIKRLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEATDS-------DCESEPDIQTMVNQLTQIMGQSDHSDESDEP------------------------DNDRTKTFFNALKIGNLNEVRKLVD--SVGTSTLLEGVYPLMIAVNGGHIDVVKLLIE---KRANLNAKDKDGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEITRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNKKLFNGFHLAALQGHAKILELFLKREGVK-IVDSQKEDKFAAIHLVALNNHEDCLRVLLAY-KADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRDSDGDTPLHIAMKVKQIEAFKKMGRMFGMGS-LMGI-LGDMTEGSDTPDDIAIYLLKHGAGLDMKNKKGLTPMEMCND-DLLKA 2407
            +V++  + ++++NLQ  HGGW + M   +  E  + +I +DGD+ V    G ++  NP C+ K       EN   S++        LR G       +I + +  + +                   S +P  D           YNP    +       PT+   Q R SS    L    +  SPG  V++ ++   IK +Q G G W  +M   +G VGK+  V   G    +++  + + + E     +S          S P++     Q   ++     +  + +P                          D  + F  A   G+L++V +L+   SV  +++      L  A   GH+++V+ LI+    + ++N KD DGD A+H A   +   I  +L N GAD+N++N    TP+ +A + G +E+ + L   +    S+ D D DT LH ++ +        L+ A +DI   N   FN  H AAL+G+     + L+    + IVD +K+D + A+HL ALNNH D   +L+    AD+N++N  LQT LH+AV ++H N VK+LV++ A+I++ D DGDTPLH A++   +   ++M  +  MG  LMG+ LG     +     IA YL+ +G+ + +KNKKG TP+++C D +L++A
Sbjct:  250 QVVIDLDFDIVRNLQVGHGGWADCMMECLSMEGTVTQIDEDGDVQVIFSSGAQYTFNPVCLTKTTRRDHGENSLSSQRSTITVPITLRPGAT-----NISRTRSTESDD--------------VPTSSTVPDSDTTR--------YNPHNPRR----STLPTSVYAQHRDSSQSRPLSHAPESLSPGCWVKISSDLELIKTVQCGLGMWNESMAVCVGTVGKI--VQSLGHDLWRVVLSRTSGSSESTFVLNSALLARIRSPMSSPEVSVSATQPRTMLLSQRSTGSTSQPIEAVEAASTGTLSHVLRSIFEAHTTGDAKELFVKAAANGDLDKVLELLKKRSVDVNSMFARHSALHAASQNGHVEIVQALIKYGGDQLDINLKDPDGDAAVHHAALGDHKIIIQILKNAGADINSRNRRNQTPLHIAVNKGHLEVLKALLELK-CLASLQDYDGDTPLHDSITRRHDKLTLALVQANSDITVCNNAGFNSLHHAALRGNPNATRIILENLPRQWIVDEKKDDGYTALHLAALNNHADVAELLIKVGSADLNVQNINLQTPLHLAVERQHSNMVKLLVDSGADISIPDKDGDTPLHEALRHHTLSQLRQMQDLQDMGKLLMGLSLGGEKRSA---AHIACYLVSNGSDIHIKNKKGQTPLDLCPDQNLIRA 883          

HSP 2 Score: 66.6254 bits (161), Expect = 8.780e-11
Identity = 27/64 (42.19%), Postives = 42/64 (65.62%), Query Frame = 2
Query: 2549 RDEELEELRQRIQDMEDEKTCIICYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLY 2740
            +D++ ++L Q+ QD+++   C +C DR   + F CGH +C +C + L  C ICRE+I NKI LY
Sbjct: 1229 KDKDYKKLEQQYQDIKEMTMCPVCMDRVRKMVFMCGHCSCQLCGDKLETCPICRETITNKILLY 1292          
The following BLAST results are available for this feature:
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIB13.295e-8229.59mindbomb E3 ubiquitin protein ligase 1 [Source:HGN... [more]
MIB22.684e-7126.98mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB23.446e-7126.98mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB24.394e-7126.98mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
MIB22.490e-7027.85mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-444.153e-2929.09AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.153e-2929.09AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.790e-2929.09AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.790e-2929.09AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.247e-2929.09AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib12.789e-7728.27gene:FBgn0263601 transcript:FBtr0333578[more]
mib14.024e-7728.27gene:FBgn0263601 transcript:FBtr0075520[more]
mib29.280e-5831.88gene:FBgn0086442 transcript:FBtr0336840[more]
mib29.280e-5831.88gene:FBgn0086442 transcript:FBtr0081142[more]
mib29.280e-5831.88gene:FBgn0086442 transcript:FBtr0336841[more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib19.178e-8429.37mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib13.273e-8329.09mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib17.932e-8329.19mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib21.111e-5227.92mindbomb E3 ubiquitin protein ligase 2 [Source:ZFI... [more]
ank2b1.170e-3330.92ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coa72.981e-8328.63cytochrome c oxidase assembly factor 7 (putative) ... [more]
coa77.373e-8228.07cytochrome c oxidase assembly factor 7 (putative) ... [more]
mib15.905e-8129.19mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib18.368e-8129.45mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
coa75.886e-7528.18cytochrome c oxidase assembly factor 7 (putative) ... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mib16.543e-8229.33mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib16.543e-8229.33mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib11.001e-6329.78mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib25.767e-6228.65mindbomb E3 ubiquitin protein ligase 2 [Source:MGI... [more]
Mib21.559e-3325.47mindbomb E3 ubiquitin protein ligase 2 [Source:MGI... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q804S5|MIB1_DANRE6.929e-8329.37E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX... [more]
sp|Q86YT6|MIB1_HUMAN1.582e-8129.59E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens O... [more]
sp|Q80SY4|MIB1_MOUSE4.577e-8129.33E3 ubiquitin-protein ligase MIB1 OS=Mus musculus O... [more]
sp|Q6GNY1|MIB1_XENLA1.319e-7929.22E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis... [more]
sp|Q5ZIJ9|MIB2_CHICK1.564e-7929.30E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus ... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B5A8W55.928e-9031.56Mindbomb E3 ubiquitin protein ligase 2 OS=Stegaste... [more]
A0A3Q3WPX32.114e-8931.90Mindbomb E3 ubiquitin protein ligase 2 OS=Mola mol... [more]
A0A556U1X54.594e-8931.87E3 ubiquitin-protein ligase MIB2 OS=Bagarius yarre... [more]
A0A0L8FX876.147e-8930.18Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A3Q1FJ501.506e-8831.59Mindbomb E3 ubiquitin protein ligase 2 OS=Acanthoc... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib29.779e-9030.77mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib16.169e-8429.37mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib16.326e-8429.37mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib23.142e-8131.20mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib23.612e-8131.20mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008505.11.833e-4627.27pep scaffold:Pmarinus_7.0:GL477211:28706:49738:-1 ... [more]
ENSPMAT00000000093.15.099e-2828.37pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.11.512e-2728.32pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007449.12.091e-2726.11pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.12.114e-2727.36pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AVO24.515e-1229.59Component of a complex containing the Tor2p kinase... [more]
NAS62.792e-1030.67Evolutionarily conserved 19S regulatory particle a... [more]
AKR24.585e-926.57Ankyrin repeat-containing protein; member of a fam... [more]
AKR11.299e-829.00Palmitoyl transferase involved in protein palmitoy... [more]
HOS43.238e-838.20Subunit of the Set3 complex; complex is a meiotic-... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494851.366e-1931.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387026.188e-1728.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391138.146e-1630.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387259.134e-1528.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436904.655e-1427.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib21.930e-8830.94mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib24.367e-8830.94mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib11.188e-8329.74mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib12.991e-8329.51mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib23.674e-8131.65mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of Mindbomb E3 ubiquitin protein ligase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017279.10.000e+082.91SMESG000017279.1[more]
SMESG000017281.10.000e+075.47SMESG000017281.1[more]
SMESG000031930.12.328e-4148.29SMESG000031930.1[more]
SMESG000030607.14.208e-6128.17SMESG000030607.1[more]
SMESG000030607.14.370e-6028.17SMESG000030607.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008689 ID=SMED30008689|Name=Mindbomb E3 ubiquitin protein ligase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2835bp
CAGTGAACTTTTAAATAGTATTTTTTATTACATTTTTTATTAACTAATTG
CAAAATAAGAAGATCTGATGGGGGGAGCAGAATCAGTGGAAAACTCTAAT
ATCCAGGTTGTTATTGGAACTAAGGATATGGAAACCATTAAGATAAAGCA
GAGAGAGCATGGCGGCTGGAATGCCAATATGAACGAGTGTCTAACTGGTC
CATGCCAACTGGTACAAAGCCTTGGTTCATGTGCCATTGTCAAGGGCCCC
TCTGGAAATGTGTACCGTTTGAATTCTGAATTGCTGATCCAATACGACAC
AAGGCAAGATCATAAAATTGGATCATTTGTTACTCTTATTGAAAATGCCG
AAGAATTCAAACGTTTGCAGGTTCAGAATGGAGAATGGAGTGACGACATG
GGAAATATTTTAGGTAAAAAAGTAGAAATCATTCAACAATTTCAAGATGG
CAATGTTAAAATTAAATACAGAGGCAGAACTTTCAGAATAAATTCTAAAG
CTATTTTAACCGATAATTGCAAGAAAACCTCTATGGAGATGGAGGAGACA
TTTGAAGAAGGGGAAAAGGTTATGTTGATAAGAAATTCTGAAGTCATGAA
AAATCTTCAGAAAGACCATGGAGGATGGTGCGAATTGATGAACTTGTTTA
TTGGTGAAGAAGTGGAGATTGTGAAGATATTGAAAGATGGTGACATGTAC
GTATCAAGGTTGGGCATGGAGTGGATGATCAATCCTAAATGCATTGGAAA
AAGAAATGAAAACAAATTCAAGAGTGAAAAGTTAAGAAAGGGAGATATTG
TCCAAATCTGTGATGACATTCAGAAAATAAAGCAACTTCAGCAAAATCAC
GGCGGCTGGGTTAACAGCATGGAATTCTGCTCTGGCAAAATTTGTAAAGT
TCAATCTATTCTTCCGTCGGGCGATGTGAAAGTTAATGTTGATAGATTGG
AACTTGTCTATAATCCGATGTTGCTAACCAAATGTGAAGGTAACCAGGCA
AATCCAACTGCTGCTCGGGGTCAAAGGAGAAGGTCAAGTGCTCTTGAGAA
ACTTGAAGTTAAAGTGTTTTCTCCTGGAGATAAAGTGCGCTTGATTAACA
ACAAACATAAAATCAAACGCTTGCAAAAAGGTCACGGAGAATGGGTAAAT
GCCATGCAATTCGTTCTAGGAAAAGTTGGCAAAGTTAAGTCAGTTGATGT
TAATGGAGATCTGAAAGTGAAAATCATGGGTCAAAAACTAAATTTAAATC
CAGAATGCGTCGAGGCAACGGATTCAGACTGCGAATCGGAACCGGATATA
CAGACAATGGTGAACCAATTAACTCAAATAATGGGGCAATCTGATCACTC
TGATGAGTCGGATGAACCCGATAATGACAGAACCAAAACATTTTTCAATG
CACTTAAAATTGGAAATTTGAATGAAGTAAGGAAACTGGTGGACTCGGTG
GGAACTAGCACTTTGTTGGAAGGCGTTTATCCCTTGATGATTGCAGTAAA
TGGCGGCCACATTGATGTGGTGAAATTGTTGATAGAAAAGAGGGCGAATC
TCAATGCAAAGGATAAAGATGGCGACACCGCCCTTCATCTTGCAGTTCCG
AAAAACCAAATTAAAATTTGTGATCTGCTGATAAATAAAGGGGCCGATGT
GAATGCTCAGAATAATAACAAGATCACACCAATAATGCTGGCGGCAAGTT
CCGGTTCAGTGGAAATTACTCGATTGCTGGCTACTTCTAGGAATGCTGAC
CTCAGCATTGGGGATTCCGATAATGATACCGCCCTTCACTTGGCAGTCAG
GAAGTCTCGGGTGAACTCGGTGGAAATATTGCTGGACGCGGGCGCCGACA
TCAATGCATTGAATAAGAAATTATTTAATGGATTTCACCTTGCAGCTTTG
CAAGGTCACGCCAAAATTCTCGAGCTGTTTCTGAAACGAGAAGGAGTAAA
AATTGTTGATTCACAAAAGGAGGATAAATTTGCAGCGATCCATTTGGTGG
CGTTGAACAACCACGAAGACTGTTTGCGCGTCCTCCTCGCGTATAAGGCT
GACATAAACATTCGCAACAATATTTTACAAACCGCCTTGCACATCGCTGT
GTTACAAAAACATTTAAATTGTGTGAAAATATTGGTGGAAAATTATGCTG
AAATCAATTTGAGGGATTCTGATGGAGATACTCCCCTTCACATTGCCATG
AAGGTTAAGCAAATTGAAGCGTTCAAGAAAATGGGCAGAATGTTCGGAAT
GGGAAGTTTAATGGGGATTTTGGGAGACATGACGGAGGGATCGGATACGC
CGGATGATATAGCTATTTATTTGCTAAAACATGGAGCTGGACTTGATATG
AAAAACAAGAAGGGTCTAACACCGATGGAAATGTGCAATGATGACTTATT
GAAGGCGAGGATATTAAGCTTGAATATTCCAAACTCAACAAAACAGGATC
TGATAGAGAAAGAACCAAATCCGGGAACAAAAGCAGAGCGATTTGAAGCA
CCCATTGCACCGATTAGACAGCTTTCACCGCCGCCTAATATCAAATCTAG
AGATGAAGAACTGGAAGAATTGCGTCAAAGAATACAAGATATGGAAGACG
AAAAAACTTGTATCATTTGCTATGACCGACCAATTAATGTTACATTCGGC
TGTGGCCACGTGGCTTGCGACGTTTGCGCAAACAACTTATATGAGTGCCA
CATCTGCCGGGAAAGCATAGAAAACAAGATTAGACTATATAAATGATTTC
TTTTCCGTTTCAGCTTTCGAAATTAAATAATTTTGGGACATTTTTATATT
TTATAACGAATATTACGTTTTCCTAATTCATATCA
back to top

protein sequence of SMED30008689-orf-1

>SMED30008689-orf-1 ID=SMED30008689-orf-1|Name=SMED30008689-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=893bp
MGGAESVENSNIQVVIGTKDMETIKIKQREHGGWNANMNECLTGPCQLVQ
SLGSCAIVKGPSGNVYRLNSELLIQYDTRQDHKIGSFVTLIENAEEFKRL
QVQNGEWSDDMGNILGKKVEIIQQFQDGNVKIKYRGRTFRINSKAILTDN
CKKTSMEMEETFEEGEKVMLIRNSEVMKNLQKDHGGWCELMNLFIGEEVE
IVKILKDGDMYVSRLGMEWMINPKCIGKRNENKFKSEKLRKGDIVQICDD
IQKIKQLQQNHGGWVNSMEFCSGKICKVQSILPSGDVKVNVDRLELVYNP
MLLTKCEGNQANPTAARGQRRRSSALEKLEVKVFSPGDKVRLINNKHKIK
RLQKGHGEWVNAMQFVLGKVGKVKSVDVNGDLKVKIMGQKLNLNPECVEA
TDSDCESEPDIQTMVNQLTQIMGQSDHSDESDEPDNDRTKTFFNALKIGN
LNEVRKLVDSVGTSTLLEGVYPLMIAVNGGHIDVVKLLIEKRANLNAKDK
DGDTALHLAVPKNQIKICDLLINKGADVNAQNNNKITPIMLAASSGSVEI
TRLLATSRNADLSIGDSDNDTALHLAVRKSRVNSVEILLDAGADINALNK
KLFNGFHLAALQGHAKILELFLKREGVKIVDSQKEDKFAAIHLVALNNHE
DCLRVLLAYKADINIRNNILQTALHIAVLQKHLNCVKILVENYAEINLRD
SDGDTPLHIAMKVKQIEAFKKMGRMFGMGSLMGILGDMTEGSDTPDDIAI
YLLKHGAGLDMKNKKGLTPMEMCNDDLLKARILSLNIPNSTKQDLIEKEP
NPGTKAERFEAPIAPIRQLSPPPNIKSRDEELEELRQRIQDMEDEKTCII
CYDRPINVTFGCGHVACDVCANNLYECHICRESIENKIRLYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR040847SH3_15
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0016740transferase activity
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0000151ubiquitin ligase complex
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0016020membrane
GO:0030139endocytic vesicle
GO:0031410cytoplasmic vesicle
GO:0043234protein complex
GO:0048471perinuclear region of cytoplasm
Vocabulary: biological process
TermDefinition
GO:0001568blood vessel development
GO:0001570vasculogenesis
GO:0001756somitogenesis
GO:0001885endothelial cell development
GO:0002064epithelial cell development
GO:0002090regulation of receptor internalization
GO:0003407neural retina development
GO:0003408optic cup formation involved in camera-type eye development
GO:0007219Notch signaling pathway
GO:0007275multicellular organism development
GO:0007368determination of left/right symmetry
GO:0007417central nervous system development
GO:0007420brain development
GO:0007507heart development
GO:0008284positive regulation of cell proliferation
GO:0008593regulation of Notch signaling pathway
GO:0009880embryonic pattern specification
GO:0010001glial cell differentiation
GO:0016567protein ubiquitination
GO:0021508floor plate formation
GO:0021510spinal cord development
GO:0021514ventral spinal cord interneuron differentiation
GO:0021519spinal cord association neuron specification
GO:0021520spinal cord motor neuron cell fate specification
GO:0021521ventral spinal cord interneuron specification
GO:0021536diencephalon development
GO:0021546rhombomere development
GO:0021654rhombomere boundary formation
GO:0021986habenula development
GO:0022008neurogenesis
GO:0030097hemopoiesis
GO:0030182neuron differentiation
GO:0030318melanocyte differentiation
GO:0030902hindbrain development
GO:0030903notochord development
GO:0031076embryonic camera-type eye development
GO:0031398positive regulation of protein ubiquitination
GO:0035315hair cell differentiation
GO:0039022pronephric duct development
GO:0045664regulation of neuron differentiation
GO:0045685regulation of glial cell differentiation
GO:0045747positive regulation of Notch signaling pathway
GO:0048066developmental pigmentation
GO:0048259regulation of receptor-mediated endocytosis
GO:0048514blood vessel morphogenesis
GO:0048546digestive tract morphogenesis
GO:0048663neuron fate commitment
GO:0048665neuron fate specification
GO:0048666neuron development
GO:0048699generation of neurons
GO:0048793pronephros development
GO:0048859formation of anatomical boundary
GO:0048892lateral line nerve development
GO:0048899anterior lateral line development
GO:0048916posterior lateral line development
GO:0050931pigment cell differentiation
GO:0051865protein autoubiquitination
GO:0060035notochord cell development
GO:0060113inner ear receptor cell differentiation
GO:0060218hematopoietic stem cell differentiation
GO:0061195taste bud formation
GO:0061551trigeminal ganglion development
GO:0070086ubiquitin-dependent endocytosis
GO:0071599otic vesicle development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 825..845
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 845..885
e-value: 1.5E-8
score: 34.4
NoneNo IPR availablePANTHERPTHR24202FAMILY NOT NAMEDcoord: 329..882
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 841..887
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 584..598
score: 44.52
coord: 502..517
score: 37.1
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 568..597
e-value: 3.1E-5
score: 33.4
coord: 702..761
e-value: 480.0
score: 7.4
coord: 669..698
e-value: 8.7E-4
score: 28.6
coord: 534..564
e-value: 2.7
score: 17.0
coord: 601..631
e-value: 74.0
score: 12.2
coord: 468..497
e-value: 1.5E-5
score: 34.5
coord: 501..530
e-value: 8.0E-5
score: 32.0
coord: 636..665
e-value: 0.0039
score: 26.4
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 468..500
score: 13.651
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 501..533
score: 14.613
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 568..600
score: 13.971
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 669..701
score: 10.633
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 636..668
score: 9.912
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 824..892
e-value: 1.4E-14
score: 55.2
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 445..532
e-value: 2.1E-14
score: 53.8
coord: 606..700
e-value: 2.2E-13
score: 50.6
coord: 534..597
e-value: 5.8E-11
score: 42.8
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 468..722
score: 70.432
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 408..542
e-value: 1.1E-28
score: 101.8
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 543..628
e-value: 9.8E-19
score: 69.4
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 430..722
IPR040847Mind bomb, SH3 repeat domainPFAMPF18346SH3_15coord: 83..145
e-value: 3.0E-7
score: 30.7
coord: 334..398
e-value: 3.0E-16
score: 59.5
coord: 162..225
e-value: 6.7E-9
score: 35.9
coord: 240..302
e-value: 9.5E-13
score: 48.3
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 848..881
score: 9.76