Phosphodiesterase

Overview
NamePhosphodiesterase
Smed IDSMED30008671
Length (bp)3096
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphodiesterase (SMED30008671) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30008671) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphodiesterase (SMED30008671) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30008671) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008671

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30008671h1SMcG0015225 Contig46972uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008671h1SMcG0015225 Contig46972newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30008671h1SMcG0015225 dd_Smed_v4_8589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008671h1SMcG0015225 dd_Smed_v4_8589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008671h1SMcG0015225 dd_Smed_v4_8589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008671h1SMcG0015225 dd_Smed_v4_8589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008671h1SMcG0015225 dd_Smed_v4_8589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30008671h1SMcG0015225 dd_Smed_v4_8589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008671h1SMcG0015225 dd_Smed_v4_8589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30008671h1SMcG0015225 dd_Smed_v4_8589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30008671h1SMcG0015225 dd_Smed_v6_8589_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30008671h1SMcG0015225 dd_Smed_v4_8589_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 369/722 (51.11%), Postives = 502/722 (69.53%), Query Frame = 1
Query:  595 SNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            +++  +IL+LCG L+D DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK     FT+ DE VI  CF YT++VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F SF   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+   F ++  E
Sbjct:  203 TDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPL--TGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE 900          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 721.079 bits (1860), Expect = 0.000e+0
Identity = 367/712 (51.54%), Postives = 498/712 (69.94%), Query Frame = 1
Query:  595 SNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNS 2730
            +++  +IL+LCG L+D DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK     FT+ DE VI  CF YT++VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F SF   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+
Sbjct:  215 TDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPL--TGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNN 902          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 721.079 bits (1860), Expect = 0.000e+0
Identity = 367/712 (51.54%), Postives = 498/712 (69.94%), Query Frame = 1
Query:  595 SNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNS 2730
            +++  +IL+LCG L+D DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK     FT+ DE VI  CF YT++VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F SF   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+
Sbjct:  217 TDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPL--TGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNN 904          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 369/722 (51.11%), Postives = 502/722 (69.53%), Query Frame = 1
Query:  595 SNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            +++  +IL+LCG L+D DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK     FT+ DE VI  CF YT++VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F SF   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+   F ++  E
Sbjct:  224 TDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPL--TGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE 921          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 369/722 (51.11%), Postives = 502/722 (69.53%), Query Frame = 1
Query:  595 SNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            +++  +IL+LCG L+D DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK     FT+ DE VI  CF YT++VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F SF   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+   F ++  E
Sbjct:  109 TDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPL--TGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE 806          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-2 (Probable 3',5'-cyclic phosphodiesterase pde-2 [Source:UniProtKB/Swiss-Prot;Acc:P30645])

HSP 1 Score: 325.479 bits (833), Expect = 8.954e-97
Identity = 193/535 (36.07%), Postives = 311/535 (58.13%), Query Frame = 1
Query: 1168 DNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQ--IPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQS--NSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            +NL+ L+  I+ EA+  T+AE  +VFL DED+ ++V  +F+        NE + L  G         +F    GI G VA+T   +NI+     P F   +D++   K +N++ FP+ D     +GV  L NK  G  F++ DE+  K FS +   SI H+++ K++E+ + R  +  E  +      I E DI  L    +     F  +F  F+  PR+V +     A +  F+ +G    +++N+R L+  +  V   YR  PYHNW HAF+V HF ++ ++   + + L+++E  +L +A LCHDIDHRGT NSFQ+QS   + L+ LYS+EGSVLERHHF+QT+ +L  E C++ E+LP  ++   ++ IR++ILATD++ HL+   +I+ M  +GY+ +  ++  LL+CL+MT++DLSDQ KN+ N + +AE IY EFF QGDLE  +G +P E MDR  A VP +QI FL  I  P++++L+ + P+    +  I+     W  + ++V ++    N+ E  R++ +E
Sbjct:  173 NNLSALISCIIAEAKKNTEAEDYAVFLHDEDNKQMV--LFN--------NETM-LMTGK--------KFDMGYGIVGKVASTMRTMNIRDVSRCPFFNEEIDEQFSIKARNLIAFPLIDSSCSLIGVIVLYNKENG--FSRHDEKYIKRFSYFVANSIAHAILAKQIEEVRTRIHMVEEFKIQGEDAVIEEVDIMRLVNDPLRDWRYFSQNFADFSFPPRSVGENHFHRASMMFFEDLGFSMLYKLNKRKLSYLVLRVSAGYRPVPYHNWSHAFAVTHFCWLTLRTDAIRRALSDMERLSLLIACLCHDIDHRGTTNSFQMQSLQKTPLSVLYSTEGSVLERHHFAQTIKLLQQEECSILENLPAADFRTIVNTIREVILATDISAHLRKQERIKTMISEGYNPMSFDHRYLLMCLVMTASDLSDQAKNFHNAKRIAENIYLEFFAQGDLELQLGVKPLEMMDRTNAYVPTVQIDFLFKIGVPVFQLLASVVPEGRTTSEAIDANHLCWVALDEEVRNNPSATNTLEYLRDENLE 686          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-2 (Probable 3',5'-cyclic phosphodiesterase pde-2 [Source:UniProtKB/Swiss-Prot;Acc:P30645])

HSP 1 Score: 325.479 bits (833), Expect = 9.160e-97
Identity = 193/535 (36.07%), Postives = 311/535 (58.13%), Query Frame = 1
Query: 1168 DNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQ--IPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQS--NSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            +NL+ L+  I+ EA+  T+AE  +VFL DED+ ++V  +F+        NE + L  G         +F    GI G VA+T   +NI+     P F   +D++   K +N++ FP+ D     +GV  L NK  G  F++ DE+  K FS +   SI H+++ K++E+ + R  +  E  +      I E DI  L    +     F  +F  F+  PR+V +     A +  F+ +G    +++N+R L+  +  V   YR  PYHNW HAF+V HF ++ ++   + + L+++E  +L +A LCHDIDHRGT NSFQ+QS   + L+ LYS+EGSVLERHHF+QT+ +L  E C++ E+LP  ++   ++ IR++ILATD++ HL+   +I+ M  +GY+ +  ++  LL+CL+MT++DLSDQ KN+ N + +AE IY EFF QGDLE  +G +P E MDR  A VP +QI FL  I  P++++L+ + P+    +  I+     W  + ++V ++    N+ E  R++ +E
Sbjct:  176 NNLSALISCIIAEAKKNTEAEDYAVFLHDEDNKQMV--LFN--------NETM-LMTGK--------KFDMGYGIVGKVASTMRTMNIRDVSRCPFFNEEIDEQFSIKARNLIAFPLIDSSCSLIGVIVLYNKENG--FSRHDEKYIKRFSYFVANSIAHAILAKQIEEVRTRIHMVEEFKIQGEDAVIEEVDIMRLVNDPLRDWRYFSQNFADFSFPPRSVGENHFHRASMMFFEDLGFSMLYKLNKRKLSYLVLRVSAGYRPVPYHNWSHAFAVTHFCWLTLRTDAIRRALSDMERLSLLIACLCHDIDHRGTTNSFQMQSLQKTPLSVLYSTEGSVLERHHFAQTIKLLQQEECSILENLPAADFRTIVNTIREVILATDISAHLRKQERIKTMISEGYNPMSFDHRYLLMCLVMTASDLSDQAKNFHNAKRIAENIYLEFFAQGDLELQLGVKPLEMMDRTNAYVPTVQIDFLFKIGVPVFQLLASVVPEGRTTSEAIDANHLCWVALDEEVRNNPSATNTLEYLRDENLE 689          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-5 (Probable 3',5'-cyclic phosphodiesterase pde-5 [Source:UniProtKB/Swiss-Prot;Acc:P91119])

HSP 1 Score: 305.449 bits (781), Expect = 2.305e-90
Identity = 182/525 (34.67%), Postives = 307/525 (58.48%), Query Frame = 1
Query: 1132 MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLL-CLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQK 2700
            +L VA++IF  + +++ +++ +M  A+ L  A+R S+FLVD  + ++ A++FD     +   E +R+   +E Q+  EIRF  ++GIAG+VA+TGE LNI+ AY+   F   VD +TG+ TK ILC PI    G  +GV Q+ NK  G  FT+ DE+  + F++YC +++ H+ +Y K+  ++ + R+A E++ YH     D++  L    I    + L   + FN +   + + +  +  + MF  +      R +   L +F+  V++NYR   YHNW H +SVAH +F  + N P     T+LE  AL+V+ LCHD+DHRG NN++    ++ LA++YS+  SV+ERHHF+QTV IL  +G N+ +SL  ++Y + L LI+  ILATDLA      +K+  +      +++ + H LL   ++MT  DL    K W       ++I++EF+ QGD E+  G +P   MDR++A ++P +Q+ F+ GI  P Y +++ + P+ D +    E   + W +++++
Sbjct:  201 LLDVARSIFHDIVSMDAVIIKVMNFAQKLVDADRASLFLVDSKNAQIYARIFD---VGTGDEEHVRV--NSEGQK--EIRFDMSKGIAGYVASTGEGLNIENAYEDERFNADVDSKTGYTTKTILCMPILIR-GIVIGVVQMVNKHDG-VFTRQDEDAFEIFAVYCGLALHHAKLYDKIRRSEQKYRVALEVLAYHSVCNADEVNKLKKIEINNRIVELETID-FNGM--RLSELEKPLYAVYMFKTL-FADTLRFDTEDLIRFVLTVRKNYRRVAYHNWAHGWSVAHAMFATLMNSP--DAFTKLEALALYVSCLCHDLDHRGKNNAYMKTMSTPLASIYST--SVMERHHFNQTVTILQQDGHNILKSLSSEDYKKTLSLIKHCILATDLALFFSNKAKLNVILDNNTFDINRQEHRLLTQAVMMTGCDLVASAKPWNIQTETVKVIFEEFYDQGDAERLSGKEPIPMMDRQQAHMLPQMQVGFMRGICMPCYDLIARIFPKNDKMRERCEYNAKKWEELAEE 708          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 121.709 bits (304), Expect = 1.838e-28
Identity = 87/291 (29.90%), Postives = 156/291 (53.61%), Query Frame = 1
Query: 1828 KDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKM--AQQGYDN----LDSENHNL-LLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLS-LLHPQTDCINHTIERTRE 2676
            K+    +   S+     L   + I++ TL  ++  ++ +YR+  YHN++HA  VA  + + + +  L +  T+LE+ A   A   HD+DH G  N + + SN+ LA +Y+ E SVLE+HH +    +L    C+   +L +K+ ++   ++ D++LATD++ H+ + + ++ M  A++   N    LD  N  + +L  ++  ADLS+ TK     +   + I +E++RQGD EK +G + +   DR    +   Q+ F+D IV PLY   + L++P    I   +E  RE
Sbjct:  237 KNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHYRNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDE-SVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENRE 526          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-4 (Probable 3',5'-cyclic phosphodiesterase pde-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22000])

HSP 1 Score: 121.709 bits (304), Expect = 3.096e-28
Identity = 87/291 (29.90%), Postives = 156/291 (53.61%), Query Frame = 1
Query: 1828 KDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKM--AQQGYDN----LDSENHNL-LLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLS-LLHPQTDCINHTIERTRE 2676
            K+    +   S+     L   + I++ TL  ++  ++ +YR+  YHN++HA  VA  + + + +  L +  T+LE+ A   A   HD+DH G  N + + SN+ LA +Y+ E SVLE+HH +    +L    C+   +L +K+ ++   ++ D++LATD++ H+ + + ++ M  A++   N    LD  N  + +L  ++  ADLS+ TK     +   + I +E++RQGD EK +G + +   DR    +   Q+ F+D IV PLY   + L++P    I   +E  RE
Sbjct:  287 KNHSLTVVTFSLLRQRNLFKTFEIHQSTLVTYLLNLEHHYRNNHYHNFIHAADVAQSMHVLLMSPVLTEVFTDLEVLAAIFAGAVHDVDHPGFTNQYLINSNNELAIMYNDE-SVLEQHHLAVAFKLLQDSNCDFLANLSRKQRLQFRKIVIDMVLATDMSKHMSLLADLKTMVEAKKVAGNNVIVLDKYNDKIQVLQSMIHLADLSNPTKPIELYQQWNQRIMEEYWRQGDKEKELGLEISPMCDRGNVTIEKSQVGFIDYIVHPLYETWADLVYPDAQNILDQLEENRE 576          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0303163)

HSP 1 Score: 316.62 bits (810), Expect = 2.259e-91
Identity = 203/599 (33.89%), Postives = 323/599 (53.92%), Query Frame = 1
Query:  937 LCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIF-LSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSK-----IEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGN-QPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVAS 2709
            LC+P++   + DVI +  +INK     F+  DE+V +   ++    L     Y+  +    + + +L +A+ IF     +  ++  I+   ++L Q +R  + LV E      ++VFD    ++D +E    ++ T    P E RFP   GI GHVATTGE +N+  AY+   F   VD+ + FK ++ILC  I++  G+ +GV QL NK     FTK DE   +AF+I+C + I ++ MY+K   A  +  +  E++ YH     D+   L    +P    F L DF+ F+ I  + +D DTL AC+ MF  +  + R+ I+   L +++  VK+NYR+  YHNW HAF+VA  +F  +      K   E+E  AL +  LCHD+DHRGTNNSFQ++++S LA LYS+  S +E HHF Q + ILN+ G  +  +L   +Y R + ++ D IL+TD    L ++ K     +E ++Q     +  E   LL  + MT  DLS  TK W   + VA+L+  EFF QGD+EK   N  P + M+RE+   +P +Q+ F+D I  P+Y   + L  + + +   +   R +W  ++  V +
Sbjct:  483 LCMPIK-DSSGDVIGVAQVINKMNGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILLVHEADKGSFSRVFDF--EANDLSE----EEATSRTSPYESRFPINIGITGHVATTGETVNVPNAYEDDRFDASVDENSCFKHRSILCMAIKNSLGQIIGVIQLINKFNELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVHFRLHDFK-FDDI--HFEDDDTLKACLRMFLDLDFVERFHIDYEVLCRWLLSVKKNYRNVTYHNWRHAFNVAQMMFAILTTTQWWKIFGEIECLALIIGCLCHDLDHRGTNNSFQIKASSPLAQLYST--STMEHHHFDQCLMILNSPGNQILANLSSDDYCRVIRVLEDAILSTD----LAVYFKKRGPFLESVSQPTSYWVAEEPRALLRAMSMTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQELNITPIDIMNREKEDELPMMQVNFIDSICLPIYEAFATLSDKLEPLVEGVRDNRGHWIDLADVVKT 1065          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0303162)

HSP 1 Score: 317.005 bits (811), Expect = 2.910e-91
Identity = 203/599 (33.89%), Postives = 322/599 (53.76%), Query Frame = 1
Query:  937 LCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIF-LSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSK-----IEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGN-QPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVAS 2709
            LC+P++   + DVI +  +INK     F+  DE+V +   ++    L     Y+  +    + + +L +A+ IF     +  ++  I+   ++L Q +R  + LV E      ++VFD      + N+ L  ++ T    P E RFP   GI GHVATTGE +N+  AY+   F   VD+ + FK ++ILC  I++  G+ +GV QL NK     FTK DE   +AF+I+C + I ++ MY+K   A  +  +  E++ YH     D+   L    +P    F L DF+ F+ I  + +D DTL AC+ MF  +  + R+ I+   L +++  VK+NYR+  YHNW HAF+VA  +F  +      K   E+E  AL +  LCHD+DHRGTNNSFQ++++S LA LYS+  S +E HHF Q + ILN+ G  +  +L   +Y R + ++ D IL+TD    L ++ K     +E ++Q     +  E   LL  + MT  DLS  TK W   + VA+L+  EFF QGD+EK   N  P + M+RE+   +P +Q+ F+D I  P+Y   + L  + + +   +   R +W  ++  V +
Sbjct:  527 LCMPIK-DSSGDVIGVAQVINKMNGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILLVHEADKGSFSRVFD-----FEAND-LSEEEATSRTSPYESRFPINIGITGHVATTGETVNVPNAYEDDRFDASVDENSCFKHRSILCMAIKNSLGQIIGVIQLINKFNELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVHFRLHDFK-FDDI--HFEDDDTLKACLRMFLDLDFVERFHIDYEVLCRWLLSVKKNYRNVTYHNWRHAFNVAQMMFAILTTTQWWKIFGEIECLALIIGCLCHDLDHRGTNNSFQIKASSPLAQLYST--STMEHHHFDQCLMILNSPGNQILANLSSDDYCRVIRVLEDAILSTD----LAVYFKKRGPFLESVSQPTSYWVAEEPRALLRAMSMTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQELNITPIDIMNREKEDELPMMQVNFIDSICLPIYEAFATLSDKLEPLVEGVRDNRGHWIDLADVVKT 1109          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0343831)

HSP 1 Score: 315.464 bits (807), Expect = 8.685e-90
Identity = 203/599 (33.89%), Postives = 322/599 (53.76%), Query Frame = 1
Query:  937 LCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIF-LSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSK-----IEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGN-QPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVAS 2709
            LC+P++   + DVI +  +INK     F+  DE+V +   ++    L     Y+  +    + + +L +A+ IF     +  ++  I+   ++L Q +R  + LV E      ++VFD      + N+ L  ++ T    P E RFP   GI GHVATTGE +N+  AY+   F   VD+ + FK ++ILC  I++  G+ +GV QL NK     FTK DE   +AF+I+C + I ++ MY+K   A  +  +  E++ YH     D+   L    +P    F L DF+ F+ I  + +D DTL AC+ MF  +  + R+ I+   L +++  VK+NYR+  YHNW HAF+VA  +F  +      K   E+E  AL +  LCHD+DHRGTNNSFQ++++S LA LYS+  S +E HHF Q + ILN+ G  +  +L   +Y R + ++ D IL+TD    L ++ K     +E ++Q     +  E   LL  + MT  DLS  TK W   + VA+L+  EFF QGD+EK   N  P + M+RE+   +P +Q+ F+D I  P+Y   + L  + + +   +   R +W  ++  V +
Sbjct:  483 LCMPIK-DSSGDVIGVAQVINKMNGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILLVHEADKGSFSRVFD-----FEAND-LSEEEATSRTSPYESRFPINIGITGHVATTGETVNVPNAYEDDRFDASVDENSCFKHRSILCMAIKNSLGQIIGVIQLINKFNELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVHFRLHDFK-FDDI--HFEDDDTLKACLRMFLDLDFVERFHIDYEVLCRWLLSVKKNYRNVTYHNWRHAFNVAQMMFAILTTTQWWKIFGEIECLALIIGCLCHDLDHRGTNNSFQIKASSPLAQLYST--STMEHHHFDQCLMILNSPGNQILANLSSDDYCRVIRVLEDAILSTD----LAVYFKKRGPFLESVSQPTSYWVAEEPRALLRAMSMTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQELNITPIDIMNREKEDELPMMQVNFIDSICLPIYEAFATLSDKLEPLVEGVRDNRGHWIDLADVVKT 1065          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0112545)

HSP 1 Score: 315.464 bits (807), Expect = 8.685e-90
Identity = 203/599 (33.89%), Postives = 322/599 (53.76%), Query Frame = 1
Query:  937 LCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIF-LSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSK-----IEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGN-QPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVAS 2709
            LC+P++   + DVI +  +INK     F+  DE+V +   ++    L     Y+  +    + + +L +A+ IF     +  ++  I+   ++L Q +R  + LV E      ++VFD      + N+ L  ++ T    P E RFP   GI GHVATTGE +N+  AY+   F   VD+ + FK ++ILC  I++  G+ +GV QL NK     FTK DE   +AF+I+C + I ++ MY+K   A  +  +  E++ YH     D+   L    +P    F L DF+ F+ I  + +D DTL AC+ MF  +  + R+ I+   L +++  VK+NYR+  YHNW HAF+VA  +F  +      K   E+E  AL +  LCHD+DHRGTNNSFQ++++S LA LYS+  S +E HHF Q + ILN+ G  +  +L   +Y R + ++ D IL+TD    L ++ K     +E ++Q     +  E   LL  + MT  DLS  TK W   + VA+L+  EFF QGD+EK   N  P + M+RE+   +P +Q+ F+D I  P+Y   + L  + + +   +   R +W  ++  V +
Sbjct:  483 LCMPIK-DSSGDVIGVAQVINKMNGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILLVHEADKGSFSRVFD-----FEAND-LSEEEATSRTSPYESRFPINIGITGHVATTGETVNVPNAYEDDRFDASVDENSCFKHRSILCMAIKNSLGQIIGVIQLINKFNELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVHFRLHDFK-FDDI--HFEDDDTLKACLRMFLDLDFVERFHIDYEVLCRWLLSVKKNYRNVTYHNWRHAFNVAQMMFAILTTTQWWKIFGEIECLALIIGCLCHDLDHRGTNNSFQIKASSPLAQLYST--STMEHHHFDQCLMILNSPGNQILANLSSDDYCRVIRVLEDAILSTD----LAVYFKKRGPFLESVSQPTSYWVAEEPRALLRAMSMTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQELNITPIDIMNREKEDELPMMQVNFIDSICLPIYEAFATLSDKLEPLVEGVRDNRGHWIDLADVVKT 1065          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0112544)

HSP 1 Score: 315.849 bits (808), Expect = 9.129e-90
Identity = 203/599 (33.89%), Postives = 322/599 (53.76%), Query Frame = 1
Query:  937 LCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIF-LSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSK-----IEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGN-QPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVAS 2709
            LC+P++   + DVI +  +INK     F+  DE+V +   ++    L     Y+  +    + + +L +A+ IF     +  ++  I+   ++L Q +R  + LV E      ++VFD      + N+ L  ++ T    P E RFP   GI GHVATTGE +N+  AY+   F   VD+ + FK ++ILC  I++  G+ +GV QL NK     FTK DE   +AF+I+C + I ++ MY+K   A  +  +  E++ YH     D+   L    +P    F L DF+ F+ I  + +D DTL AC+ MF  +  + R+ I+   L +++  VK+NYR+  YHNW HAF+VA  +F  +      K   E+E  AL +  LCHD+DHRGTNNSFQ++++S LA LYS+  S +E HHF Q + ILN+ G  +  +L   +Y R + ++ D IL+TD    L ++ K     +E ++Q     +  E   LL  + MT  DLS  TK W   + VA+L+  EFF QGD+EK   N  P + M+RE+   +P +Q+ F+D I  P+Y   + L  + + +   +   R +W  ++  V +
Sbjct:  527 LCMPIK-DSSGDVIGVAQVINKMNGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILLVHEADKGSFSRVFD-----FEAND-LSEEEATSRTSPYESRFPINIGITGHVATTGETVNVPNAYEDDRFDASVDENSCFKHRSILCMAIKNSLGQIIGVIQLINKFNELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVHFRLHDFK-FDDI--HFEDDDTLKACLRMFLDLDFVERFHIDYEVLCRWLLSVKKNYRNVTYHNWRHAFNVAQMMFAILTTTQWWKIFGEIECLALIIGCLCHDLDHRGTNNSFQIKASSPLAQLYST--STMEHHHFDQCLMILNSPGNQILANLSSDDYCRVIRVLEDAILSTD----LAVYFKKRGPFLESVSQPTSYWVAEEPRALLRAMSMTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQELNITPIDIMNREKEDELPMMQVNFIDSICLPIYEAFATLSDKLEPLVEGVRDNRGHWIDLADVVKT 1109          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde11a (phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-070912-207])

HSP 1 Score: 299.286 bits (765), Expect = 1.504e-86
Identity = 189/599 (31.55%), Postives = 319/599 (53.26%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKS-GPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELV--AKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHN-LLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKA-IGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQK 2700
            K ++ LC+P+ H    +VI +   INKS   A FT  DE+V+     +    +     +   R+   ++  +L V  ++F    +L +++  IM  A+ L + ERCSV L+++  + +V   K F+ L      +     +D  +     +     +  IA  VA+TG  +NI  AY  P F    D  +GF  +++LC PI +   + +GVAQ+ N++ G  F   D+ + +AF I+C + I +++MY +V+ +  +  +A +++ YH    + ++      +IP V     D  SF+    +V    T  A + MF  +G++ +++I+  TL +++  V++NYR   YHNW HAF+V   +F  +      + LTE+E  AL V  +CHD+DHRGTNN+FQ ++ S L+ LY +  + LE HHF+  V IL +EG N+F +L   EY   + L++  ILATDL  + Q  +   ++  +G  N + + H  +   +LMT+ DL   TK W  +  VAEL+  EFF QGD E++ +   P+   DR R   +P LQ+ ++DGI +PLY   + L+P+   +   I+  R  W ++  +
Sbjct:  269 KTKSLLCMPI-HNSDGEVIGVAQAINKSPNGALFTQDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVKFTKSFELLSPKCSADMENSFKDSMDKSSYSDWLINNS--IAELVASTGLPVNISDAYQDPRFDAEADQFSGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKTEVDKFKAANIPLVCELGIDKLSFDDFSLDVDAMVT--AALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQCMFSMLTTAGFQETLTEMETLALIVGCICHDLDHRGTNNAFQAKTGSALSLLYGTSAT-LEHHHFNHAVMILQSEGHNIFSNLSSHEYGELMQLLKQSILATDLTLYFQNRNSFFELVNKGEYNWNVKEHREMCRSMLMTACDLGAVTKPWEISHKVAELVTSEFFEQGDRERSELKLTPSAIFDRNRKDELPGLQLEWIDGICAPLYETFAKLNPKLQPMMDLIKANRAKWEELHHR 861          

HSP 2 Score: 98.9821 bits (245), Expect = 1.692e-20
Identity = 67/211 (31.75%), Postives = 110/211 (52.13%), Query Frame = 1
Query: 1081 TTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNE--LVAKVFDGLPTSSDKNERLRLQDGTEIQQPV----EIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNK-IKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSR 1692
            T + Y+   +   + E  L + K+I + +D L  L   I+     +  A+RCS+FLV+  +N+  LV+K FD             +  GT +   +    E++ P  +GI G+VA  GE +NI  AY    F   +D  TG+KTK++LC PI +  G+ +GVAQ  NK   G  FT+ DE++ + +  +C I+I+++ ++        RSR
Sbjct:  141 TAVDYKYYLKEHNEREFFLELVKDISNDLD-LTSLSYKILVFVCIMVDADRCSLFLVEGPTNKKTLVSKFFD-------------VHAGTTVLPSLSNSDEVQVPWGKGIIGYVAEHGETVNIPDAYQDHRFSDEIDKLTGYKTKSLLCMPIHNSDGEVIGVAQAINKSPNGALFTQDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSR 337          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 294.664 bits (753), Expect = 6.163e-86
Identity = 204/579 (35.23%), Postives = 311/579 (53.71%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEK---MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEI-QQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQT 2640
            ++ + LC+P+      D+IAI+ L    G   F    ++V      + +  +      Q  R L  QTE    +L V+K  F  +  ++ LL  IM  A+NL  A+RC++F VD ++ EL + +FD      ++NE      G  + ++  EIRF   +GIAG VA TGE+LNI  AY  P F R VD  TG+ T+NILC PI    G  +GV Q+ NK+ G  FTK DE   K F+++C +++  + MY ++  ++   R+  E + YH     ++   L+  ++P  S    + E F+    ++   + L   I ++       +       L +F   V++NYR  PYHNW HA +VAH ++  ++        TELE   L +A LCHD+DHRG +NS+  + +  LAALYS+  S +E+HHFSQTV IL  EG N+F +L   EY + L++IR  I+ATDLA +     ++ ++   G  +L++  H + ++ L+MT+ DL   TK W  TR  A  IY EF+ +GD  K IG QP   MDR++   VP  Q+ F + +  P Y  LS L P +
Sbjct:  194 RVHSVLCLPIL-TAIGDLIAILELHRHLGREPFNLSHQEVATANLAWASVAIHQV---QVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD----IGEENE------GKPVFRKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSR-GTVIGVVQMVNKLGGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLTLP--SAIYKEIELFHF---DIAPFEELWPAIFVYMVHNSCGKTSFELEKLCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQK--TTGIFTELERKGLLIACLCHDLDHRGYSNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLTSGEYEQVLEIIRKAIIATDLALYFGNRKQLAELLSTGALDLNNRAHRDRVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWAEGDEMKKIGMQPISMMDRDKKDEVPQGQVGFYNAVAIPCYTTLSELFPPS 748          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 293.893 bits (751), Expect = 2.344e-85
Identity = 210/600 (35.00%), Postives = 320/600 (53.33%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEK---MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTREN---WSKISQ 2697
            ++ + LC+P+      D+IAI+ L    G   F    ++V      + +  +      Q  R L  QTE    +L V+K  F  +  ++ LL  IM  A+NL  A+RC++F VD ++ EL + +FD      ++NE   +      ++  EIRF   +GIAG VA TGE+LNI  AY  P F R VD  TG+ T+NILC PI    G  +GV Q+ NK+ G  FTK DE   K F+++C +++  + MY ++  ++   R+  E + YH     ++   L+  ++P  S    + E F+    ++   + L   I ++       +       L +F   V++NYR  PYHNW HA +VAH ++  ++        TELE   L +A LCHD+DHRG +NS+  + +  LAALYS+  S +E+HHFSQTV IL  EG N+F +L   EY + L++IR  I+ATDLA +     ++ ++   G  +L++  H + ++ L+MT+ DL   TK W  TR  A  IY EF+ +GD  K IG QP   MDR++   VP  Q+ F + +  P Y  LS L P +  +   +E  REN   W +I Q
Sbjct:  194 RVHSVLCLPIL-TAIGDLIAILELHRHLGREPFNLSHQEVATANLAWASVAIHQV---QVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD----IGEENEGKPV-----FRKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSR-GTVIGVVQMVNKLGGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLTLP--SAIYKEIELFHF---DIAPFEELWPAIFVYMVHNSCGKTSFELEKLCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQK--TTGIFTELERKGLLIACLCHDLDHRGYSNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQ-EGHNIFSNLTSGEYEQVLEIIRKAIIATDLALYFGNRKQLAELLSTGALDLNNRAHRDRVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWAEGDEMKKIGMQPISMMDRDKKDEVPQGQVGFYNAVAIPCYTTLSELFPPSVPL---LEACRENLSQWERIVQ 766          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 293.508 bits (750), Expect = 9.167e-85
Identity = 210/600 (35.00%), Postives = 320/600 (53.33%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEK---MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTREN---WSKISQ 2697
            ++ + LC+P+      D+IAI+ L    G   F    ++V      + +  +      Q  R L  QTE    +L V+K  F  +  ++ LL  IM  A+NL  A+RC++F VD ++ EL + +FD      ++NE   +      ++  EIRF   +GIAG VA TGE+LNI  AY  P F R VD  TG+ T+NILC PI    G  +GV Q+ NK+ G  FTK DE   K F+++C +++  + MY ++  ++   R+  E + YH     ++   L+  ++P  S    + E F+    ++   + L   I ++       +       L +F   V++NYR  PYHNW HA +VAH ++  ++        TELE   L +A LCHD+DHRG +NS+  + +  LAALYS+  S +E+HHFSQTV IL  EG N+F +L   EY + L++IR  I+ATDLA +     ++ ++   G  +L++  H + ++ L+MT+ DL   TK W  TR  A  IY EF+ +GD  K IG QP   MDR++   VP  Q+ F + +  P Y  LS L P +  +   +E  REN   W +I Q
Sbjct:  194 RVHSVLCLPIL-TAIGDLIAILELHRHLGREPFNLSHQEVATANLAWASVAIHQV---QVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD----IGEENEGKPV-----FRKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSR-GTVIGVVQMVNKLGGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLTLP--SAIYKEIELFHF---DIAPFEELWPAIFVYMVHNSCGKTSFELEKLCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQK--TTGIFTELERKGLLIACLCHDLDHRGYSNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQ-EGHNIFSNLTSGEYEQVLEIIRKAIIATDLALYFGNRKQLAELLSTGALDLNNRAHRDRVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWAEGDEMKKIGMQPISMMDRDKKDEVPQGQVGFYNAVAIPCYTTLSELFPPSVPL---LEACRENLSQWERIVQ 766          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde11al (phosphodiesterase 11a, like [Source:ZFIN;Acc:ZDB-GENE-031118-106])

HSP 1 Score: 288.115 bits (736), Expect = 2.646e-82
Identity = 191/602 (31.73%), Postives = 316/602 (52.49%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQ-FTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELV--AKVFDGLPT--SSDKN---ERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLM-ACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQG-YDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKA-IGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKI 2691
            K Q+ LC+ +R+    +VI +V  INK+     FT  DE+V+     +    +     +   R+   ++  +L V  ++F    +L +++  IMQ A  L Q ERCSV L+++  + +V  ++ F+ +    S D++   E++   D           +     IA  VA+TG  +NI      P F    D  +GF  +++LC PI +   + +GVAQ+ N++    F   D+ + +AF I+C + I +++MY +V+    +  +A +++ YH    + ++  L    IP  S    D   FN       D D ++ A + MF  +G++ +++I+   L +++  V++NYR   YHNW HAF+V+  +FI I      + LTE E  AL V   CHD+DHRGTNN+FQ +S S LA LY +  + LE HHF+  V IL +EG N+F +L  KEY   + L++  IL+TDL  + +  +        G +   D E+ ++   +LMT+ DL   T+ W  ++ VAEL+  EFF QGD E++ +   PA   DR R   +P LQ+ ++DGI  PLY  L  L+ +   +   I+  R+ W ++
Sbjct:  275 KTQSILCMAIRN-SDGEVIGVVQAINKNPSGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYERSRALLEVVNDLFEEQTDLEKIVRKIMQRALTLLQCERCSVLLLEDIHSPVVKFSQTFELMSPLCSVDRDISMEKVSCSD-----------WLINNSIAELVASTGLPVNISDVCQDPRFDAEADQASGFHIRSVLCVPIWNRTHQIIGVAQILNRLDRKTFNDADQRLFEAFVIFCGLGINNTMMYNQVKKTWAKQSVALDMLSYHATCSKAEVDRLKAAKIPLSSELGIDEFHFNDFSL---DNDAMITASLRMFLELGVVQKFKIDYEVLCRWLLTVRKNYRTVAYHNWRHAFNVSQCMFIMITTAAFQEVLTETETLALMVGCFCHDLDHRGTNNAFQAKSGSALALLYGTSAT-LEHHHFNHAVMILQSEGHNIFANLCSKEYCNMMQLLKQAILSTDLTLYFKKRTTFFDCVLSGQFSWSDEEHRDMFRSMLMTACDLGAVTRPWEISKQVAELVTSEFFEQGDRERSELKLTPAAIFDRNRKDELPVLQLEWIDGICKPLYEALVKLNRKLQPMVDGIDANRKKWEEL 860          

HSP 2 Score: 93.5893 bits (231), Expect = 7.217e-19
Identity = 68/210 (32.38%), Postives = 112/210 (53.33%), Query Frame = 1
Query: 1078 FTTIAYQNERRLKLQTEK--MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNE--LVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNK-IKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSR 1692
            + + A   + RLK   E+   L + K+I + +D  N L   I+     +  A+RCS+FLV+  S++  LV+K FD    ++ +     L D  E+Q       P  +GI G+VA  GE +N   AY+   F   +D  TG+KT++ILC  I++  G+ +GV Q  NK   G  FT+ DE++ + +  +C ISI+++ ++ +      RSR
Sbjct:  142 YASSAIDYKYRLKESNEREFFLELVKDISNELDMTN-LSYKILINVCIMVNADRCSLFLVEGPSHKRTLVSKFFDVHSGTTVRPSSSTL-DSNEVQ------VPWGKGIIGYVAEHGETVNTPNAYEDHRFSDEIDKLTGYKTQSILCMAIRNSDGEVIGVVQAINKNPSGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYERSR 343          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: pde2a (phosphodiesterase 2A [Source:NCBI gene;Acc:780063])

HSP 1 Score: 342.428 bits (877), Expect = 2.846e-105
Identity = 179/376 (47.61%), Postives = 249/376 (66.22%), Query Frame = 1
Query:  610 QILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPED 1737
            +IL+LCG L+D DA  LQ KV+ YL Q T +    LLLV  D+ +L CQV+G  + E+ I+F     G   +V+  K  I L  ++  + R+++ ++       ++ + LCVPV  + T+ V+A+ C  NK G  ++T  DE  I  CF YT++VL +T+A+Q E++LK + + +  V K++ + +D+++ LL  I+ EARNL+ AE CSVFL++  S+ELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNIK AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G  FTK DE++A AFSIYC ISI HSL+YK+V +AQ RS LANE+MMYHM+I  D
Sbjct:  230 KILQLCGELYDLDAASLQIKVIHYLEQQTQSPCCCLLLVSEDSHQLFCQVVGGKVLEEEISFPLT-FGHLGQVVDKKKSITLQDISSEEHRQLNNMLG-----FEVHSMLCVPVISRATSQVVALACAFNKQG-GKYTEVDEHKIQHCFCYTSTVLTSTLAFQKEQKLKCECQSLRRVRKSLITYLDDVSVLLQEIITEARNLSNAEICSVFLLERQSHELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIKDAYSHPLFYRGVDDSTGFRTRNILCFPIKNESNEVIGVAELVNKINGPGFTKFDEDLATAFSIYCGISIAHSLLYKQVREAQFRSHLANEMMMYHMKICRD 583          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: pde2a (phosphodiesterase 2A [Source:NCBI gene;Acc:780063])

HSP 1 Score: 328.176 bits (840), Expect = 6.864e-100
Identity = 175/373 (46.92%), Postives = 241/373 (64.61%), Query Frame = 1
Query:  610 QILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQI 1728
            +IL+LCG L+D DA  LQ KV+ YL Q T +    LLLV  D+ +L CQV+G  + E+ I+F     G   +V+  K  I L  ++  + R+++ ++       ++ + LCVPV  + T+ V+A+ C  NK G  ++T  DE  I  CF YT++VL +T+A+Q E++LK + +             D+++ LL  I+ EARNL+ AE CSVFL++  S+ELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNIK AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G  FTK DE++A AFSIYC ISI HSL+YK+V +AQ RS LANE+MMYHM++
Sbjct:  228 KILQLCGELYDLDAASLQIKVIHYLEQQTQSPCCCLLLVSEDSHQLFCQVVGGKVLEEEISFPLT-FGHLGQVVDKKKSITLQDISSEEHRQLNNMLG-----FEVHSMLCVPVISRATSQVVALACAFNKQG-GKYTEVDEHKIQHCFCYTSTVLTSTLAFQKEQKLKCECQ---------VGPTDDVSVLLQEIITEARNLSNAEICSVFLLERQSHELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIKDAYSHPLFYRGVDDSTGFRTRNILCFPIKNESNEVIGVAELVNKINGPGFTKFDEDLATAFSIYCGISIAHSLLYKQVREAQFRSHLANEMMMYHMKV 569          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE10A (phosphodiesterase 10A [Source:NCBI gene;Acc:100485841])

HSP 1 Score: 302.368 bits (773), Expect = 2.647e-88
Identity = 209/603 (34.66%), Postives = 318/603 (52.74%), Query Frame = 1
Query:  919 TKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEK---MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIP-----PVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQ 2697
            T+IQ+ LC+P+      D+I I+ L    G   F    +QV      + +  +      Q  R L  QTE    +L V+K  F  +  ++ LL  IM  A+NL  A+RC++F VD  + EL + +FD      D+ + +        ++  EIRF   +GIAG VA TGE+LNI  AY  P F R VD  TG+ T+NILC PI    G  +GV Q+ NK+ G  F+K DE   K F+++C +++  + MY ++  ++   R+  E + YH     D+   L   ++P      + ++  D + F          + L   I ++       +       L +F   VK+NYR  PYHNW HA +V+H +++ ++N    +  T+LE   L VA LCHD+DHRG  NS+  + +  LAALYS+  S +E+HHFSQTV IL  EG N+F +L   EY + L++IR  I+ATDLA +      +E + Q G  NL+++ H + L+ L+MT+ DL   TK W  TR +A+ IY EF+ +GD  K +G  P   MDR++   +P  Q+ F + +  P Y  LS + P T  +    +     W K+S+
Sbjct:  191 TRIQSVLCLPIV-TAIGDLIGILELYRHWGKGSFRLCHQQVATANLAWASVAIHQV---QVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFD--IGEEDEGKPV-------FKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDVYTGYTTRNILCMPIVIR-GSVIGVVQMVNKLSGSAFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTLEKLSYHSICTSDEWQNLMNCTLPVSLCREIELYHFDIQPF----------EDLWPAIYVYMIHQSCGKNCFELEKLCRFTMSVKKNYRRVPYHNWKHAVTVSHCMYVILQN--NQEIFTDLERKGLLVACLCHDLDHRGYTNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLSSNEYEQVLEIIRKAIIATDLALYFGNRKHLEDLHQMGALNLNNQAHRDRLIGLMMTACDLCSVTKLWPVTRLIADDIYAEFWTEGDEMKRLGISPIPMMDRDKQDEIPQGQMGFYNAVAVPCYTTLSEIFPSTRPLLQACKENLSQWEKVSR 765          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: ENSXETT00000053056.1 (phosphodiesterase 11A [Source:NCBI gene;Acc:100379882])

HSP 1 Score: 299.286 bits (765), Expect = 2.525e-86
Identity = 191/613 (31.16%), Postives = 329/613 (53.67%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKS-GPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELV--AKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVS-IFLSD--FESFNSIPRNVKDRDTLM-ACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLL-CLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEK-AIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNS 2730
            K ++ LC+P+R     ++I +   INK+ G A F   DE+V+     +    +     +   R+   ++  +L V  ++F    +L +++  IM  A+NL + ERCSV L+++  + +V   K F+ L      +     +D  E     +  +     IA  VA+TG  +NI  AY  P F    D  +GF  +++LC PI +   + +GVAQ+ N+I G  F   D+ + +AF I+C + I +++MY +V+ +  +  +A +++ YH    + ++      +IP VS + ++D  F+ F        D D ++ A + MF  +G++ +++I+  TL +++  +++NYR   YHNW HAF+V   +F  +      + L++ E  AL V  LCHD+DHRGTNN+FQ +S S L+ LY +  + LE HHF+  V IL +EG N+F +L  +EY   + L++  ILATD+  H +  ++  ++  +G  N + ++H ++   +LMT+ DL   TK W  +R VAEL+  EFF QGD E+  +   P+   DR R   +P LQ+ ++D I  PLY  L  ++ +   +  ++   R  W ++      H  +GNS
Sbjct:  274 KTKSLLCMPIR-SSDGEIIGVAQAINKTPGGAPFIEDDEKVMQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKVVKKIMHRAQNLLKCERCSVLLLEDIESPVVKFTKSFELLSPKCSADTENSFKDSVEKSSYSD--WLVNNSIAELVASTGLPVNISDAYQDPRFDVEADQFSGFHIRSVLCVPIWNSSHQIIGVAQVLNRIDGKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIPLVSELSIADIHFDDF------CLDVDAMISAALRMFMELGMVQKFKIDYETLCRWLLTIRKNYRMVLYHNWRHAFNVCQLMFAMLTTAGFQEVLSDTETLALIVGCLCHDLDHRGTNNAFQAKSGSALSQLYGTSAT-LEHHHFNHAVMILQSEGHNIFANLSSQEYSDLMQLLKQSILATDITLHFERRNEFFELVNKGDYNWNVKSHRVIFRSMLMTACDLGAATKPWEISRQVAELVTSEFFEQGDRERLELKMTPSAIFDRNRKDELPRLQLEWIDNICFPLYESLVKINGKLKPMLDSVTTNRGKWEEL------HRKQGNS 870          

HSP 2 Score: 97.4413 bits (241), Expect = 6.839e-20
Identity = 62/183 (33.88%), Postives = 96/183 (52.46%), Query Frame = 1
Query: 1171 NLNELLLMIMQEARNLTQAERCSVFLVDEDSNE--LVAKVFDG------LPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHF-FTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSR 1692
            NL  L   I+     +  A+RCS+FLV+  +N+  LV+K FD       LP+ S +N               E++ P  +GI G+VA  GE +NI  AY    F   +D  TG+KTK++LC PI+   G+ +GVAQ  NK  G   F + DE++ + +  +C I+I+++ ++        RSR
Sbjct:  173 NLTSLCYKILIFVCIMVDADRCSLFLVEGTANKKSLVSKFFDVHAGTTLLPSCSTENSN-------------EVQVPWGKGIIGYVAEHGETVNIPDAYQDRRFSDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKTPGGAPFIEDDEKVMQMYLPFCGIAISNAQLFAASRKEYDRSR 342          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE10A (phosphodiesterase 10A [Source:NCBI gene;Acc:100485841])

HSP 1 Score: 287.345 bits (734), Expect = 8.991e-84
Identity = 204/583 (34.99%), Postives = 305/583 (52.32%), Query Frame = 1
Query:  919 TKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTE--KMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIP-----PVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQT 2640
            T+IQ+ LC+P+      D+I I+ L    G   F    +QV      + +  +      Q  R L  QTE    L+   N F      NE  L I   A+NL  A+RC++F VD  + EL + +FD      D+ + +        ++  EIRF   +GIAG VA TGE+LNI  AY  P F R VD  TG+ T+NILC PI    G  +GV Q+ NK+ G  F+K DE   K F+++C +++  + MY ++  ++   R+  E + YH     D+   L   ++P      + ++  D + F  +   +       +C           +       L +F   VK+NYR  PYHNW HA +V+H +++ ++N    +  T+LE   L VA LCHD+DHRG  NS+  + +  LAALYS+  S +E+HHFSQTV IL  EG N+F +L   EY + L++IR  I+ATDLA +      +E + Q G  NL+++ H + L+ L+MT+ DL   TK W  TR +A+ IY EF+ +GD  K +G  P   MDR++   +P  Q+ F + +  P Y  LS + P T
Sbjct:  133 TRIQSVLCLPIV-TAIGDLIGILELYRHWGKGSFRLCHQQVATANLAWASVAIHQV---QVCRGLAKQTELNDFLLDVSNHFD-----NESFLQIY--AKNLVNADRCALFQVDHKNKELYSDLFD--IGEEDEGKPV-------FKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDVYTGYTTRNILCMPIVIR-GSVIGVVQMVNKLSGSAFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTLEKLSYHSICTSDEWQNLMNCTLPVSLCREIELYHFDIQPFEDLWPAIYVYMIHQSC----------GKNCFELEKLCRFTMSVKKNYRRVPYHNWKHAVTVSHCMYVILQN--NQEIFTDLERKGLLVACLCHDLDHRGYTNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLSSNEYEQVLEIIRKAIIATDLALYFGNRKHLEDLHQMGALNLNNQAHRDRLIGLMMTACDLCSVTKLWPVTRLIADDIYAEFWTEGDEMKRLGISPIPMMDRDKQDEIPQGQMGFYNAVAVPCYTTLSEIFPST 680          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Gm45837 (predicted gene 45837 [Source:MGI Symbol;Acc:MGI:5804952])

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 371/725 (51.17%), Postives = 502/725 (69.24%), Query Frame = 1
Query:  586 KIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            K  ++   +IL+LCG LFD DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK G   FT+ DE VI  CF YT +VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F +F   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+   F ++  E
Sbjct:  241 KGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLT-MGRLGQVVEDKQCIQLKDLTSDDVQQLQNMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE 942          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde2a (phosphodiesterase 2A, cGMP-stimulated [Source:MGI Symbol;Acc:MGI:2446107])

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 371/725 (51.17%), Postives = 502/725 (69.24%), Query Frame = 1
Query:  586 KIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            K  ++   +IL+LCG LFD DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK G   FT+ DE VI  CF YT +VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F +F   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+   F ++  E
Sbjct:  225 KGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLT-MGRLGQVVEDKQCIQLKDLTSDDVQQLQNMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE 926          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde2a (phosphodiesterase 2A, cGMP-stimulated [Source:MGI Symbol;Acc:MGI:2446107])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 371/725 (51.17%), Postives = 502/725 (69.24%), Query Frame = 1
Query:  586 KIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            K  ++   +IL+LCG LFD DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK G   FT+ DE VI  CF YT +VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F +F   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+   F ++  E
Sbjct:  215 KGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLT-MGRLGQVVEDKQCIQLKDLTSDDVQQLQNMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE 916          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde2a (phosphodiesterase 2A, cGMP-stimulated [Source:MGI Symbol;Acc:MGI:2446107])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 371/725 (51.17%), Postives = 502/725 (69.24%), Query Frame = 1
Query:  586 KIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            K  ++   +IL+LCG LFD DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK G   FT+ DE VI  CF YT +VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F +F   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+   F ++  E
Sbjct:  215 KGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLT-MGRLGQVVEDKQCIQLKDLTSDDVQQLQNMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE 916          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde2a (phosphodiesterase 2A, cGMP-stimulated [Source:MGI Symbol;Acc:MGI:2446107])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 371/729 (50.89%), Postives = 503/729 (69.00%), Query Frame = 1
Query:  586 KIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSG----PAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            K  ++   +IL+LCG LFD DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK G     + FT+ DE VI  CF YT +VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F +F   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+   F ++  E
Sbjct:  215 KGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLT-MGRLGQVVEDKQCIQLKDLTSDDVQQLQNMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLGGDFPTSSFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE 920          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|P14099|PDE2A_BOVIN (cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Bos taurus OX=9913 GN=PDE2A PE=1 SV=2)

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 372/712 (52.25%), Postives = 501/712 (70.37%), Query Frame = 1
Query:  595 SNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNS 2730
            +NQ  +IL+LCG L+D DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  + E+ I+F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK G   FT+ DE VI  CF YT++VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F SF   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H+LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+
Sbjct:  203 TNQDRKILQLCGELYDLDASSLQLKVLQYLQQETQASRCCLLLVSEDNLQLSCKVIGDKVLEEEISFPLT-TGRLGQVVEDKKSIQLKDLTSEDMQQLQSMLGC-----EVQAMLCVPVISRATDQVVALACAFNKLGGDLFTDQDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVEDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDMEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRTNKQHHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNN 891          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|O00408|PDE2A_HUMAN (cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE2A PE=1 SV=1)

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 369/722 (51.11%), Postives = 502/722 (69.53%), Query Frame = 1
Query:  595 SNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            +++  +IL+LCG L+D DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK     FT+ DE VI  CF YT++VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F SF   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+   F ++  E
Sbjct:  224 TDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPL--TGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE 921          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q01062|PDE2A_RAT (cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde2a PE=1 SV=2)

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 365/707 (51.63%), Postives = 496/707 (70.16%), Query Frame = 1
Query:  610 QILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNS 2730
            +IL+LCG L+D DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG+ +  + ++F     G   +V++ K  I L  LT   ++++  ++       +++  LCVPV  + T+ V+A+ C  NK G   FT+ DE+ I  CF YT +VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F +F   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+
Sbjct:  216 KILQLCGELYDLDATSLQLKVLRYLQQETQATHCCLLLVSEDNLQLSCKVIGEKVLGEEVSFPLT-MGRLGQVVEDKQCIQLKDLTSDDVQQLQNMLGC-----ELRAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDERAIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNN 899          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q922S4|PDE2A_MOUSE (cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde2a PE=1 SV=4)

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 371/729 (50.89%), Postives = 503/729 (69.00%), Query Frame = 1
Query:  586 KIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSG----PAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            K  ++   +IL+LCG LFD DA  LQ KVL YL Q T A    LLLV  D ++L C+VIG  +  + ++F     G   +V++ K  I L  LT   ++++  ++       ++Q  LCVPV  + T+ V+A+ C  NK G     + FT+ DE VI  CF YT +VL +T+A+Q E++LK + + +L VAKN+F+ +D+++ LL  I+ EARNL+ AE CSVFL+D+  NELVAKVFDG               G    +  EIR P  QGIAGHVATTG++LNI  AY HPLFYRGVDD TGF+T+NILCFPI+++  + +GVA+L NKI G +F+K DE++A AFSIYC ISI HSL+YKKV +AQ+RS LANE+MMYHM++ +D+   L    I PV+   S+F +F   PR++ + DT MA +SM   +  I+ ++I+  TL +F  MVK+ YRDPPYHNWMHAFSV+HF ++  KNL L   L ++E+FALF++ +CHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + ILNT GCN+F+   +K+Y R LDL+RDIILATDLAHHL+IF  ++KMA+ GYD  + ++H LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P E MDRE+A +P LQI+F++ I  P+Y++L  L P+   +   +   RE+W+K+S K     +  N+   F ++  E
Sbjct:  215 KGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLT-MGRLGQVVEDKQCIQLKDLTSDDVQQLQNMLGC-----ELQAMLCVPVISRATDQVVALACAFNKLGGDFPTSSFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG---------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYE 920          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|P30645|PDE2_CAEEL (Probable 3',5'-cyclic phosphodiesterase pde-2 OS=Caenorhabditis elegans OX=6239 GN=pde-2 PE=3 SV=4)

HSP 1 Score: 325.479 bits (833), Expect = 1.165e-95
Identity = 193/535 (36.07%), Postives = 311/535 (58.13%), Query Frame = 1
Query: 1168 DNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQ--IPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQS--NSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            +NL+ L+  I+ EA+  T+AE  +VFL DED+ ++V  +F+        NE + L  G         +F    GI G VA+T   +NI+     P F   +D++   K +N++ FP+ D     +GV  L NK  G  F++ DE+  K FS +   SI H+++ K++E+ + R  +  E  +      I E DI  L    +     F  +F  F+  PR+V +     A +  F+ +G    +++N+R L+  +  V   YR  PYHNW HAF+V HF ++ ++   + + L+++E  +L +A LCHDIDHRGT NSFQ+QS   + L+ LYS+EGSVLERHHF+QT+ +L  E C++ E+LP  ++   ++ IR++ILATD++ HL+   +I+ M  +GY+ +  ++  LL+CL+MT++DLSDQ KN+ N + +AE IY EFF QGDLE  +G +P E MDR  A VP +QI FL  I  P++++L+ + P+    +  I+     W  + ++V ++    N+ E  R++ +E
Sbjct:  176 NNLSALISCIIAEAKKNTEAEDYAVFLHDEDNKQMV--LFN--------NETM-LMTGK--------KFDMGYGIVGKVASTMRTMNIRDVSRCPFFNEEIDEQFSIKARNLIAFPLIDSSCSLIGVIVLYNKENG--FSRHDEKYIKRFSYFVANSIAHAILAKQIEEVRTRIHMVEEFKIQGEDAVIEEVDIMRLVNDPLRDWRYFSQNFADFSFPPRSVGENHFHRASMMFFEDLGFSMLYKLNKRKLSYLVLRVSAGYRPVPYHNWSHAFAVTHFCWLTLRTDAIRRALSDMERLSLLIACLCHDIDHRGTTNSFQMQSLQKTPLSVLYSTEGSVLERHHFAQTIKLLQQEECSILENLPAADFRTIVNTIREVILATDISAHLRKQERIKTMISEGYNPMSFDHRYLLMCLVMTASDLSDQAKNFHNAKRIAENIYLEFFAQGDLELQLGVKPLEMMDRTNAYVPTVQIDFLFKIGVPVFQLLASVVPEGRTTSEAIDANHLCWVALDEEVRNNPSATNTLEYLRDENLE 689          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A3Q0KMK5 (Phosphodiesterase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 457/919 (49.73%), Postives = 624/919 (67.90%), Query Frame = 1
Query:  169 EVSSLLGVVISYDEFLSKSKYAAKILFPLATAVQM-----HQVS----------EIKHPKIRAMCTIRRTSFLYVSDLEDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESLILTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMRI----------------HP--------NKIISNQINQ-ILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKS-KT--GINLGCLTEAQLREISEIMNA----------SKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVK-DRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPL-DKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            +VS LLG +IS  E L +S+ AAKILFP     ++     HQ S          EI++   + +  ++  +  +++ L  +S+  +    D+  +N +  ++   ++        +  F        +    +   L+ Q+S TL+R++R+                +P        +  IS + N  IL+LC SL+D +A +LQ KVL Y+++ T++E GF+++  +DT EL+C   G  I E+      E +  F+++++S KT    +L    E  L  I  + NA             + +I + LC PV  +  +  IA+VCLINK   +QFT  DE++I ECF++   +L +++AYQNER ++ +TE ML VA+NIF+ M +L  LLL IMQEA+NLT+AERCSVFL+D ++N LVAKV DGLPT+ +KN R    DG  +  P EIR    QGIAG+VATTGE+LNIK AY HPLFYRGVD ETGF+T+NILCFPI+++    VGVAQLCNKI   FFT+ DE++AK FSIYCCISI HSLMYK V+DAQHR++LANELMMYHM++ ED   WL+T  I  ++ FL +  SF S+PRN++ + +T +  +SMF  + LI+RWRI+RRTL +FI MV+R YR+P YHNWMHAFSVAHF+++CIKNLPL + QL ++E+ ALFVASLCHDIDHRGTNNSFQVQS S+LAALYSSEGSVLERHHFSQT+C+LNTEGCN+FE++ +++Y + LD IRDII+ATDL+HHL+I  K+E+++ +GYD   SE+H LLLCLLMTSADLSDQTK+W NT  VA+LIY+EFF+QGD+EK++G+ P + MDRERA VPNLQI+FLD I++PLY+VL+ L+PQ   I  TIE+ R+NW  I + V    IKGN  EIF + LVE
Sbjct:   16 DVSVLLGSIISRREMLEQSQNAAKILFPTCWLAELVISNRHQPSVNCPLEVLIREIRNSTDQEI-NVKEVTTNFITQLTSVSKSQNQPNFDLTNNNQH--MISFELNKDNEYGEYVAHFVMILESLPKAHLHKAQLLKNQLSSTLNRIIRLEQFNEFSSTSTLLKQRYPCCSQGTEASTWISREDNMLILKLCESLWDTEANRLQHKVLRYVMERTNSENGFIVMRNIDTSELVCHCTGNEIFEESTYI--ENDSFFNEIMQSGKTFKATHLNSEQEHTLLSILSVHNAYMNNENYVTNQNADIQIHSVLCSPVFTRSCDSPIAVVCLINKRD-SQFTQSDERIIEECFRFVAPILLSSLAYQNERYIRGRTEDMLKVARNIFTHMMDLTNLLLKIMQEAQNLTKAERCSVFLLDSETNVLVAKVLDGLPTAPNKNTRFTTADGKIVTLPEEIRLSLNQGIAGYVATTGELLNIKDAYAHPLFYRGVDKETGFRTRNILCFPIKNEKDGIVGVAQLCNKINHPFFTRADEDVAKTFSIYCCISIVHSLMYKNVQDAQHRTKLANELMMYHMKVDEDKKNWLTTCEIKDINTFLPNASSFESLPRNIQPENETYLCTLSMFHSLNLINRWRISRRTLAQFILMVRRGYRNPAYHNWMHAFSVAHFVYVCIKNLPLANNQLDDIEILALFVASLCHDIDHRGTNNSFQVQSKSVLAALYSSEGSVLERHHFSQTICVLNTEGCNIFENVSKEDYGQLLDHIRDIIVATDLSHHLRIMPKLEELSHRGYDGTKSEDHYLLLCLLMTSADLSDQTKSWNNTVYVAKLIYEEFFQQGDMEKSLGHNPIDSMDRERACVPNLQISFLDYIITPLYKVLNNLYPQCSSILDTIEKNRDNWKIILELVEKGYIKGNGSEIFNHNLVE 928          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A4Z2CV85 (Phosphodiesterase OS=Schistosoma japonicum OX=6182 GN=EWB00_007250 PE=3 SV=1)

HSP 1 Score: 850.892 bits (2197), Expect = 0.000e+0
Identity = 461/917 (50.27%), Postives = 621/917 (67.72%), Query Frame = 1
Query:  169 EVSSLLGVVISYDEFLSKSKYAAKILFPLATAVQM-----HQVS-----EIKHPKIRAM---CTIRRTSFLYVSDLEDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESLILTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMR------------------------IHPNKIISNQINQ-ILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKS-KTGINLGCLTEAQ--LREISEIMNAS----------KQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVK-DRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPL-DKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            +VS LLG +IS  E L +S+ AAKILFP     ++     HQ S     E+   +I +     T++  +  ++  L  +S+  +    +   +N Y  ++   +++   +   +  F        +    +    + Q+S TL+R++R                        I  +  I+ + N+ IL+LC SL+D    +LQ KVL YL+Q T++E GF+++   DT EL+C  IG  I ++      E + +F+++++S KT  +    +E +  L  +  I NA            +E +I + LC PV  + +   I +VCLINK   +QFT  DE +I ECF+YT  +L ++++ QNER ++ +TE ML VA+NIF+ M +L  LLL IMQEA+NLT+AERCSVFL+D ++N LVAKV DGLPT+ +KN      DG  +  P EIR    QGIAGHVATTGE+LNIK AY HPLFYRGVD ETGF+T+NILCFPI+++    VGVAQLCNKI   FFT+ DE++AK FSIYCCISI HSLMYK V+DAQHR++LANELMMYHM++ ED   WLST  I  ++ FL +  SF S+PRN++ + +T +  +SMF  + LI+RWRI+RRTL +FI MV+R YR+P YHNWMHAF+VAHFI++CIKNLPL +KQL ++E+ ALFVASLCHDIDHRGTNNSFQVQS S+LAALYSSEGSVLERHHFSQT+C+LNT+GCN+FE++ +++Y + LD IRDIILATDL+HHL+I SK+E+M+ +GYD   SE+H LLLCLLMTSADLSDQTK W NT  VA+LIY+EFF+QGD+EK++G+ P + MDRERA VPNLQI+FLD I+ PLYRVL+ L+PQ   I  TIE+ R+NW  I + V   EIKGN  EIF + L+E
Sbjct:   17 DVSILLGSIISRREMLEQSQNAAKILFPSCWIAELVISNRHQPSINCPLEVLMREISSSNQEITVKEVTTSFIVHLASVSKNQNMSNFNTKNTNQY--MISFELNNEDKRSDYVAHFVMILESLPKAHLHKAQLFKSQLSCTLNRIIRLEQFNELSSTLSSLKQRYPCCSQGIEASTWINRKDNELILKLCESLWDTQTNRLQHKVLRYLMQRTNSENGFIVMRNTDTSELVCYCIGDEIFDESTYI--ENDSLFNEIMQSGKTFTSTTPNSEQKQVLLSVLSIHNAYMNNEHPITNLHEEMEINSFLCSPVFTRSSEYPIGVVCLINKKD-SQFTQSDEFIIEECFRYTAPILLSSLSCQNERYIRDRTEDMLKVARNIFTHMMDLTNLLLKIMQEAQNLTKAERCSVFLLDSETNVLVAKVLDGLPTAPNKNTHFTTTDGKIVTLPEEIRLSLNQGIAGHVATTGELLNIKDAYAHPLFYRGVDKETGFRTRNILCFPIKNEKDGIVGVAQLCNKINHPFFTRADEDVAKTFSIYCCISIVHSLMYKNVQDAQHRTKLANELMMYHMKVDEDKKNWLSTCEIKDINSFLPNTSSFESLPRNIQPENETYLCTLSMFHNLNLINRWRISRRTLAQFILMVRRGYRNPAYHNWMHAFTVAHFIYVCIKNLPLANKQLEDIEILALFVASLCHDIDHRGTNNSFQVQSKSVLAALYSSEGSVLERHHFSQTICVLNTDGCNIFENVSKEDYSQLLDHIRDIILATDLSHHLRIMSKLEEMSHRGYDVTKSEDHYLLLCLLMTSADLSDQTKPWNNTVYVAKLIYEEFFQQGDMEKSLGHNPIDSMDRERACVPNLQISFLDYIILPLYRVLNNLYPQCSSILDTIEKNRDNWKTILELVEKGEIKGNGSEIFNHNLIE 928          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A5K4ENT0 (Phosphodiesterase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 419/731 (57.32%), Postives = 548/731 (74.97%), Query Frame = 1
Query:  613 ILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKS-KT--GINLGCLTEAQLREISEIMNA----------SKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVK-DRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPL-DKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            IL+LC SL+D +A +LQ KVL Y+++ T++E GF+++  +DT EL+C   G  I E+      E +  F+++++S KT    +L    E  L  I  + NA             + +I + LC PV  +  +  IA+VCLINK   +QFT  DE++I ECF++   +L +++AYQNER ++ +TE ML VA+NIF+ M +L  LLL IMQEA+NLT+AERCSVFL+D ++N LVAKV DGLPT+ +KN R    DG  +  P EIR    QGIAG+VATTGE+LNIK AY HPLFYRGVD ETGF+T+NILCFPI+++    VGVAQLCNKI   FFT+ DE++AK FSIYCCISI HSLMYK V+DAQHR++LANELMMYHM++ ED   WL+T  I  ++ FL +  SF S+PRN++ + +T +  +SMF  + LI+RWRI+RRTL +FI MV+R YR+P YHNWMHAFSVAHF+++CIKNLPL + QL ++E+ ALFVASLCHDIDHRGTNNSFQVQS S+LAALYSSEGSVLERHHFSQT+C+LNTEGCN+FE++ +++Y + LD IRDII+ATDL+HHL+I  K+E+++ +GYD   SE+H LLLCLLMTSADLSDQTK+W NT  VA+LIY+EFF+QGD+EK++G+ P + MDRERA VPNLQI+FLD I++PLY+VL+ L+PQ   I  TIE+ R+NW  I + V    IKGN  EIF + LVE
Sbjct:   69 ILKLCESLWDTEANRLQHKVLRYVMERTNSENGFIVMRNIDTSELVCHCTGNEIFEESTYI--ENDSFFNEIMQSGKTFKATHLNSEQEHTLLSILSVHNAYMNNENYVTNQNADIQIHSVLCSPVFTRSCDSPIAVVCLINKRD-SQFTQSDERIIEECFRFVAPILLSSLAYQNERYIRGRTEDMLKVARNIFTHMMDLTNLLLKIMQEAQNLTKAERCSVFLLDSETNVLVAKVLDGLPTAPNKNTRFTTADGKIVTLPEEIRLSLNQGIAGYVATTGELLNIKDAYAHPLFYRGVDKETGFRTRNILCFPIKNEKDGIVGVAQLCNKINHPFFTRADEDVAKTFSIYCCISIVHSLMYKNVQDAQHRTKLANELMMYHMKVDEDKKNWLTTCEIKDINTFLPNASSFESLPRNIQPENETYLCTLSMFHSLNLINRWRISRRTLAQFILMVRRGYRNPAYHNWMHAFSVAHFVYVCIKNLPLANNQLDDIEILALFVASLCHDIDHRGTNNSFQVQSKSVLAALYSSEGSVLERHHFSQTICVLNTEGCNIFENVSKEDYGQLLDHIRDIIVATDLSHHLRIMPKLEELSHRGYDGTKSEDHYLLLCLLMTSADLSDQTKSWNNTVYVAKLIYEEFFQQGDMEKSLGHNPIDSMDRERACVPNLQISFLDYIITPLYKVLNNLYPQCSSILDTIEKNRDNWKIILELVEKGYIKGNGSEIFNHNLVE 796          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A094ZED4 (Phosphodiesterase OS=Schistosoma haematobium OX=6185 GN=MS3_00246 PE=3 SV=1)

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 457/919 (49.73%), Postives = 625/919 (68.01%), Query Frame = 1
Query:  169 EVSSLLGVVISYDEFLSKSKYAAKILFPLATAVQM-----HQVS----------EIKHPKIRAMCTIRRTSFLYVSDLEDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESLILTFFQKFNENSE-NRSKRLDFLEKQMSLTLSRLMRIHP--------NKIISNQINQ-ILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQ---LREISEIMNA--------SKQETKIQ--NALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEI---------------QQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVK-DRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPL-DKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVE 2760
            +VS LLG +IS  E L +S+ AAKILFP     ++     HQ S          EI++   + + +++  +  +++ L  +S+I +    +   +N +       +S    K++    +   F  +S  NR  RL+    + S T S L + +P        +  IS + N  IL+LC SL+D++A +LQ KVL Y+++ T++E GF+++  +DT EL+C   G  I ++      E +  F+++++S+       L   Q   L  I  + NA        + Q T IQ  + LC PV  + +++ IA+VCLINK   +QFT  DE++I ECF++   +L +++AYQNER ++ +TE ML VA+NIF+ M +L  LLL IMQEA+NLT+AERCSVFL++ ++N LVAKV DGLPT+ +KN + +  DG  +                 P EIR    QGIAG+VATTGE+LNIK AY HPLFYRGVD ETGF+T+NILCFPI+++    VGVAQLCNKI   FFT+ DE++AK FSIYCCISI HSLMYK V+DAQHR++LANELMMYHM++ ED   WLST  I  ++ FL +  SF S+PRN++ + +T +  +SMF  + LI+RWRI+RRTL +FI MV+R YR P YHNWMHAFSVAHF+++CIKNLPL + QL ++E+ ALFVASLCHDIDHRGTNNSFQVQS S+ AALYSSEGSVLERHHFSQT+C+LNTEGCN+FE++ +++Y + LD IRDIILATDL+HHL+I  K+E+++ +GYD   SE+H LLLCLLMTSADLSDQTK+W NT  VA+LIY+EFF+QGD+EK++G+ P + MDRERA VP+LQI+FLD I++PLY+VL+ L+PQ   I  TIE   +NW  I + V   +IKGN  EIF + L+E
Sbjct:    7 DVSVLLGSIISRREMLEQSQNAAKILFPSCWLAELVISNRHQPSVNCPLEVLIREIRNSTDQEI-SVKEVTTSFINQLASVSKIQNQSNFNTTNNNQH------MISFELNKDNKYGEYAAHFVLSSTLNRIIRLEQF-NEFSSTSSLLKQRYPCCSQGTEASTWISREDNALILKLCESLWDKEANRLQHKVLRYIMERTNSENGFIVMRNIDTSELVCHCTGNEIFDESTYI--ENDSFFNEIMQSRKTFKASQLNSKQEHTLLSILSVRNAYMNNENYITNQNTDIQIHSVLCSPVFTRSSDNPIAVVCLINKRD-SQFTQSDERIIEECFRFVAPILLSSLAYQNERYIRDRTEDMLKVARNIFTHMMDLTNLLLKIMQEAQNLTKAERCSVFLLESETNVLVAKVLDGLPTAPNKNNKPKSYDGPTLFLTLKPYHLSFKLFFMLPEEIRLSLNQGIAGYVATTGELLNIKDAYAHPLFYRGVDKETGFRTRNILCFPIKNEKDGIVGVAQLCNKINHPFFTRADEDVAKTFSIYCCISIVHSLMYKNVQDAQHRTKLANELMMYHMKVDEDRKNWLSTCEIKDINTFLPNTSSFESLPRNIQPENETYLCTLSMFHNLNLINRWRISRRTLAQFILMVRRGYRTPAYHNWMHAFSVAHFVYVCIKNLPLANNQLDDIEILALFVASLCHDIDHRGTNNSFQVQSKSVFAALYSSEGSVLERHHFSQTICVLNTEGCNIFENVSKEDYGQLLDHIRDIILATDLSHHLRIMPKLEELSHRGYDGTKSEDHYLLLCLLMTSADLSDQTKSWNNTVYVAKLIYEEFFQQGDMEKSLGHNPVDSMDRERACVPHLQISFLDYIITPLYKVLNNLYPQCSSILDTIEINSDNWKIILELVEKGDIKGNGSEIFNHNLIE 914          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A4Z2CVF2 (Phosphodiesterase OS=Schistosoma japonicum OX=6182 GN=EWB00_007250 PE=3 SV=1)

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 437/870 (50.23%), Postives = 592/870 (68.05%), Query Frame = 1
Query:  169 EVSSLLGVVISYDEFLSKSKYAAKILFPLATAVQM-----HQVS-----EIKHPKIRAM---CTIRRTSFLYVSDLEDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESLILTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMR------------------------IHPNKIISNQINQ-ILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKS-KTGINLGCLTEAQ--LREISEIMNAS----------KQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVK-DRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPL-DKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVL 2619
            +VS LLG +IS  E L +S+ AAKILFP     ++     HQ S     E+   +I +     T++  +  ++  L  +S+  +    +   +N Y  ++   +++   +   +  F        +    +    + Q+S TL+R++R                        I  +  I+ + N+ IL+LC SL+D    +LQ KVL YL+Q T++E GF+++   DT EL+C  IG  I ++      E + +F+++++S KT  +    +E +  L  +  I NA            +E +I + LC PV  + +   I +VCLINK   +QFT  DE +I ECF+YT  +L ++++ QNER ++ +TE ML VA+NIF+ M +L  LLL IMQEA+NLT+AERCSVFL+D ++N LVAKV DGLPT+ +KN      DG  +  P EIR    QGIAGHVATTGE+LNIK AY HPLFYRGVD ETGF+T+NILCFPI+++    VGVAQLCNKI   FFT+ DE++AK FSIYCCISI HSLMYK V+DAQHR++LANELMMYHM++ ED   WLST  I  ++ FL +  SF S+PRN++ + +T +  +SMF  + LI+RWRI+RRTL +FI MV+R YR+P YHNWMHAF+VAHFI++CIKNLPL +KQL ++E+ ALFVASLCHDIDHRGTNNSFQVQS S+LAALYSSEGSVLERHHFSQT+C+LNT+GCN+FE++ +++Y + LD IRDIILATDL+HHL+I SK+E+M+ +GYD   SE+H LLLCLLMTSADLSDQTK W NT  VA+LIY+EFF+QGD+EK++G+ P + MDRERA VPNLQI+FLD I+ PLYR++
Sbjct:   17 DVSILLGSIISRREMLEQSQNAAKILFPSCWIAELVISNRHQPSINCPLEVLMREISSSNQEITVKEVTTSFIVHLASVSKNQNMSNFNTKNTNQY--MISFELNNEDKRSDYVAHFVMILESLPKAHLHKAQLFKSQLSCTLNRIIRLEQFNELSSTLSSLKQRYPCCSQGIEASTWINRKDNELILKLCESLWDTQTNRLQHKVLRYLMQRTNSENGFIVMRNTDTSELVCYCIGDEIFDESTYI--ENDSLFNEIMQSGKTFTSTTPNSEQKQVLLSVLSIHNAYMNNEHPITNLHEEMEINSFLCSPVFTRSSEYPIGVVCLINKKD-SQFTQSDEFIIEECFRYTAPILLSSLSCQNERYIRDRTEDMLKVARNIFTHMMDLTNLLLKIMQEAQNLTKAERCSVFLLDSETNVLVAKVLDGLPTAPNKNTHFTTTDGKIVTLPEEIRLSLNQGIAGHVATTGELLNIKDAYAHPLFYRGVDKETGFRTRNILCFPIKNEKDGIVGVAQLCNKINHPFFTRADEDVAKTFSIYCCISIVHSLMYKNVQDAQHRTKLANELMMYHMKVDEDKKNWLSTCEIKDINSFLPNTSSFESLPRNIQPENETYLCTLSMFHNLNLINRWRISRRTLAQFILMVRRGYRNPAYHNWMHAFTVAHFIYVCIKNLPLANKQLEDIEILALFVASLCHDIDHRGTNNSFQVQSKSVLAALYSSEGSVLERHHFSQTICVLNTDGCNIFENVSKEDYSQLLDHIRDIILATDLSHHLRIMSKLEEMSHRGYDVTKSEDHYLLLCLLMTSADLSDQTKPWNNTVYVAKLIYEEFFQQGDMEKSLGHNPIDSMDRERACVPNLQISFLDYIILPLYRLV 881          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde11a (phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-070912-207])

HSP 1 Score: 310.457 bits (794), Expect = 1.749e-90
Identity = 191/599 (31.89%), Postives = 329/599 (54.92%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKS-GPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELV--AKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKA-IGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQK 2700
            K ++ LC+P+R+    ++I +   INKS G A FT  DE+V+     +    +     +   R+   ++  +L V  ++F    +L +++  IM  A+ L + ERCSV L+++  + +V   K F+ L      +     +D  E     +     +  IA  VA+TG  +NI  AY  P F    D  +GF  +++LC PI +   + +GVAQ+ N++ G  F   D+ + +AF I+C + I +++MY +V+ +  +  +A +++ YH    + ++      +IP V     D  SF+    +V     + A + MF  +G++ +++I+  TL +++  V++NYR   YHNW HAF+V   +F  +      + L+ELE+ AL V  +CHD+DHRGTNN+FQ ++ S L+ LY +  + LE HHF+  V IL +EG N+F +L  ++Y   + L++  ILATDL  + +  +   ++ ++G  N + + H ++   +LMT+ DL   TK W  +R VAEL+  EFF QGD E++ +   P+   DR R   +P+LQ+ ++DGI SPLY  L+ L+P+   +   I+  R  W ++ Q+
Sbjct:  297 KTKSLLCMPIRN-SDGEIIGVAQAINKSPGGALFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVKFTKSFELLSPKCSADTENSFKDSMEKSSYSDWLINNS--IAELVASTGLPVNISDAYQDPRFDAEADQFSGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKTEVDKFKAANIPLVCELGIDKLSFDDFSLDVDA--MITAALRMFMELGMLQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQCMFSLLTTAGFQETLSELEILALIVGCVCHDLDHRGTNNAFQAKTGSALSLLYGTSAT-LEHHHFNHAVMILQSEGHNIFSNLSSRDYGDLMQLLKQSILATDLTLYFENRNSFFELVKKGEYNWNVKEHRDMFRSMLMTACDLGAVTKPWDISRKVAELVTSEFFEQGDRERSELKLTPSAIFDRNRKDELPSLQLEWIDGICSPLYETLAKLNPKLQPMVDVIQANRAKWDELHQR 889          

HSP 2 Score: 97.8265 bits (242), Expect = 2.981e-20
Identity = 65/198 (32.83%), Postives = 106/198 (53.54%), Query Frame = 1
Query: 1120 QTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNE--LVAKVFDGLPTSSDKNERLRLQDGTEIQQPV----EIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIK-GHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSR 1692
            + E  L + K+I + +D L  L   I+     +  A+RCS+FLV+  +N+  LV+K FD             +  GT +   +    E++ P  +GI G+VA  GE +NI  AY    F   +D  TG+KTK++LC PI++  G+ +GVAQ  NK   G  FT+ DE++ + +  +C I+I+++ ++        RSR
Sbjct:  182 EREFFLELVKDISNDLD-LTSLSYKILVFVCIMVDADRCSLFLVEGTANKKTLVSKFFD-------------VHAGTTVLPSLSNSDEVQVPWGKGIIGYVAEHGETVNIPDAYQDHRFSDEIDKLTGYKTKSLLCMPIRNSDGEIIGVAQAINKSPGGALFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSR 365          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 291.582 bits (745), Expect = 2.377e-84
Identity = 205/596 (34.40%), Postives = 314/596 (52.68%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEK---MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIP-PVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKI 2691
            ++ + LC+P+      D+IA++ L    G   F    ++V      + +  +      Q  R L  QTE    +L V+K  F  +  ++ LL  IM  A+NL  A+RC++F VD ++ EL + +FD      ++NE   +      ++  EIRF   +GIAG VA TGE+LNI  AY  P F R VD  TG+ T+NILC PI    G  +GV Q+ NK+ G  FTK DE   K F+++C +++  + MY ++  ++   R+  E + YH     ++   L+  S+P P+     + E F+    ++   + L   + ++       +       L +F   V++NYR  PYHNW HA +VAH ++  ++        TELE   L +A LCHD+DHRG +NS+  + +  LAALYS+  S +E+HHFSQTV IL  EG N+F +L   EY + L++IR  I+ATDLA +     +I ++   G  +L++  H + ++ L+MT+ DL   TK W  TR  A  IY EF+ +GD  K IG QP   MDR++   VP  Q+ F + +  P Y  L  L P +  +          W KI
Sbjct:  217 RVHSVLCLPIL-TAIGDLIAVLELHRHLGQEPFNLSHQEVATANLAWASVAIHQV---QVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD----IGEENEGKPV-----FRKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDHYTGYTTRNILCMPIVSR-GTVIGVVQMVNKLSGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLSLPDPI---YKEIELFHF---DISPYEELWPAVFVYMIHNSCGKSSFELEKLCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQK--TSGIFTELEKKGLLIACLCHDLDHRGYSNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQ-EGHNIFSNLTSSEYEQVLEIIRKAIIATDLALYFGNRKQIAELLSTGALDLNNHAHRDRVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWSEGDEMKKIGMQPIPMMDRDKKDEVPQGQVGFYNAVAIPCYTTLVELFPPSAPLLSACRENLGQWEKI 787          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde11a (phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-070912-207])

HSP 1 Score: 290.041 bits (741), Expect = 2.659e-83
Identity = 184/598 (30.77%), Postives = 312/598 (52.17%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKS-GPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELV--AKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKA-IGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQK 2700
            K ++ LC+P+R+    ++I +   INKS G A FT  DE+V+     +    +     +   R+   ++  +L V  ++F    +L +++  IM  A+ L + ERCSV L+++  + +V   K F+ L      +     +D  E     +     +  IA  VA+TG  +NI  AY  P F    D  +GF  +++LC PI +   + +GVAQ+ N++ G  F   D+ + +AF I+C + I +++MY +V+ +  +  +A +++ YH    + ++      +IP V     D  SF+    +V     + A + MF  +G++ +++I+  TL +++  V++NYR   YHNW HAF+V   +F  +      + L+ELE+ AL V  +CHD+DHRGTNN+FQ ++ S L+ LY +  + LE HHF+  V IL +E   V            L +     L +     L   S  E + +  Y+    E+ ++   +LMT+ DL   TK W  +R VAEL+  EFF QGD E++ +   P+   DR R   +P+LQ+ ++DGI SPLY  L+ L+P+   +   I+  R  W ++ Q+
Sbjct:  275 KTKSLLCMPIRN-SDGEIIGVAQAINKSPGGALFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVKFTKSFELLSPKCSADTENSFKDSMEKSSYSDWLINNS--IAELVASTGLPVNISDAYQDPRFDAEADQFSGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKTEVDKFKAANIPLVCELGIDKLSFDDFSLDVDA--MITAALRMFMELGMLQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQCMFSLLTTAGFQETLSELEILALIVGCVCHDLDHRGTNNAFQAKTGSALSLLYGTSAT-LEHHHFNHAVMILQSEVGTV----------NNLQMFMHSRLHSCFKGQLNRNSFFELVKKGEYNWNVKEHRDMFRSMLMTACDLGAVTKPWDISRKVAELVTSEFFEQGDRERSELKLTPSAIFDRNRKDELPSLQLEWIDGICSPLYETLAKLNPKLQPMVDVIQANRAKWDELHQR 856          

HSP 2 Score: 97.4413 bits (241), Expect = 3.901e-20
Identity = 65/198 (32.83%), Postives = 106/198 (53.54%), Query Frame = 1
Query: 1120 QTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNE--LVAKVFDGLPTSSDKNERLRLQDGTEIQQPV----EIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGH-FFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSR 1692
            + E  L + K+I + +D L  L   I+     +  A+RCS+FLV+  +N+  LV+K FD             +  GT +   +    E++ P  +GI G+VA  GE +NI  AY    F   +D  TG+KTK++LC PI++  G+ +GVAQ  NK  G   FT+ DE++ + +  +C I+I+++ ++        RSR
Sbjct:  160 EREFFLELVKDISNDLD-LTSLSYKILVFVCIMVDADRCSLFLVEGTANKKTLVSKFFD-------------VHAGTTVLPSLSNSDEVQVPWGKGIIGYVAEHGETVNIPDAYQDHRFSDEIDKLTGYKTKSLLCMPIRNSDGEIIGVAQAINKSPGGALFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSR 343          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde11al (dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A-like [Source:NCBI gene;Acc:103024879])

HSP 1 Score: 288.115 bits (736), Expect = 2.043e-82
Identity = 191/621 (30.76%), Postives = 324/621 (52.17%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQ-FTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELV--AKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKA-IGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSK----------ISQKVASHEIKGNSEE 2736
            K Q+ LC+ + +    +VI +V  INK+     FT  DE+V+     +    +     +   R+   ++  +L V  ++F    +L +++  IMQ A  L Q ERCSV L+++  + +V  +K F+ +      +  + ++  +     +         IA  VA+TG  +NI      P F    D  +GF  +++LC PI +   + +GVAQ+ N++    F   D+ + +AF I+C + I +++MY +V+    +  +A +++ YH    + ++  L    IP  S    D   FN    ++ +   + A + MF  +G++ +++I+   L +++  V++NYR   YHNW HAF+V+  +F+ I      + LT+ E  AL V  LCHD+DHRGTNN+FQ +S S LA LY +  + LE HHF+  V IL +EG N+F +L  KEY   + L++  IL+TDL  + Q  +K  +    G  +   + H ++L  +LMT+ DL   T+ W  ++ VAEL+  EFF QGD E+A +   P+   DR R   +P LQ+ ++DGI  PLY  L  L+ +   +   I+  R+ W +          IS+  +  +++G  EE
Sbjct:  272 KTQSILCMAICN-SDGEVIGVVQAINKNPKGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMQRALTLLQCERCSVLLLEDIHSPVVKFSKTFELMSPLCSVDHDISMEKVSCSDWLIN------NSIAELVASTGLPVNISDVCQDPRFDAEADQASGFHIRSVLCVPIWNRTHQIIGVAQILNRLDRKTFNDADQRLFEAFVIFCGLGINNTMMYNQVKKTWAKQSVALDMLSYHATCSKVEVDRLKAAKIPLSSELGIDKFHFNDF--SLDNDAMITASLRMFLELGVVQKFKIDYEVLCRWLLTVRKNYRTVAYHNWRHAFNVSQCMFVMITTAGFQEVLTDTETLALMVGCLCHDLDHRGTNNAFQAKSGSALALLYGTSAT-LEHHHFNHAVMILQSEGHNIFANLCSKEYSHMMQLLKQAILSTDLTLYFQRRTKFFECVLSGEFSWSIQEHRDVLRSMLMTACDLGAVTRPWEISKQVAELVTSEFFEQGDRERAELKLTPSAIFDRNRKDELPALQLEWIDGICKPLYEALVKLNRKLQPMVDGIDANRKKWEELCLSYQQACSISEPSSPCQVEGEGEE 882          

HSP 2 Score: 95.1301 bits (235), Expect = 2.085e-19
Identity = 68/205 (33.17%), Postives = 109/205 (53.17%), Query Frame = 1
Query: 1108 RLKLQTEK--MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNE--LVAKVFDGLPTSSDKNERLRLQDGTEIQ-----QPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNK-IKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSR 1692
            RLK   E+   L + K+I + +D  N L   I+     +  A+RCS+FLV+  S++  LV+K FD             +  GT ++        E++ P  +GI G+VA  GE +NI  AY+   F   +D  TG+KT++ILC  I +  G+ +GV Q  NK  KG  FT+ DE++ + +  +C ISI+++ ++ +      RSR
Sbjct:  150 RLKENNEREFFLELVKDISNELDMTN-LSYKILINVCIMVSADRCSLFLVEGPSHKRTLVSKFFD-------------VHSGTTVRPSSSMNSSEVQVPWGKGIIGYVAEHGETVNIPNAYEDHRFSDEIDKLTGYKTQSILCMAICNSDGEVIGVVQAINKNPKGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYDRSR 340          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde11al (dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A-like [Source:NCBI gene;Acc:103024879])

HSP 1 Score: 283.108 bits (723), Expect = 4.655e-81
Identity = 184/572 (32.17%), Postives = 304/572 (53.15%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQ-FTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELV--AKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLM-ACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKA-IGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRV 2616
            K Q+ LC+ + +    +VI +V  INK+     FT  DE+V+     +    +     +   R+   ++  +L V  ++F    +L +++  IMQ A  L Q ERCSV L+++  + +V  +K F+ +      +  + ++  +     +         IA  VA+TG  +NI      P F    D  +GF  +++LC PI +   + +GVAQ+ N++    F   D+ + +AF I+C + I +++MY +V+    +  +A +++ YH    + ++  L    IP  S    D   FN       D D ++ A + MF  +G++ +++I+   L +++  V++NYR   YHNW HAF+V+  +F+ I      + LT+ E  AL V  LCHD+DHRGTNN+FQ +S S LA LY +  + LE HHF+  V IL +EG N+F +L  KEY   + L++  IL+TDL  + Q  +K  +    G  +   + H ++L  +LMT+ DL   T+ W  ++ VAEL+  EFF QGD E+A +   P+   DR R   +P LQ+ ++DGI  PLY V
Sbjct:  272 KTQSILCMAICN-SDGEVIGVVQAINKNPKGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMQRALTLLQCERCSVLLLEDIHSPVVKFSKTFELMSPLCSVDHDISMEKVSCSDWLIN------NSIAELVASTGLPVNISDVCQDPRFDAEADQASGFHIRSVLCVPIWNRTHQIIGVAQILNRLDRKTFNDADQRLFEAFVIFCGLGINNTMMYNQVKKTWAKQSVALDMLSYHATCSKVEVDRLKAAKIPLSSELGIDKFHFNDFSL---DNDAMITASLRMFLELGVVQKFKIDYEVLCRWLLTVRKNYRTVAYHNWRHAFNVSQCMFVMITTAGFQEVLTDTETLALMVGCLCHDLDHRGTNNAFQAKSGSALALLYGTSAT-LEHHHFNHAVMILQSEGHNIFANLCSKEYSHMMQLLKQAILSTDLTLYFQRRTKFFECVLSGEFSWSIQEHRDVLRSMLMTACDLGAVTRPWEISKQVAELVTSEFFEQGDRERAELKLTPSAIFDRNRKDELPALQLEWIDGICKPLYEV 832          

HSP 2 Score: 95.1301 bits (235), Expect = 1.774e-19
Identity = 68/205 (33.17%), Postives = 109/205 (53.17%), Query Frame = 1
Query: 1108 RLKLQTEK--MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNE--LVAKVFDGLPTSSDKNERLRLQDGTEIQ-----QPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNK-IKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSR 1692
            RLK   E+   L + K+I + +D  N L   I+     +  A+RCS+FLV+  S++  LV+K FD             +  GT ++        E++ P  +GI G+VA  GE +NI  AY+   F   +D  TG+KT++ILC  I +  G+ +GV Q  NK  KG  FT+ DE++ + +  +C ISI+++ ++ +      RSR
Sbjct:  150 RLKENNEREFFLELVKDISNELDMTN-LSYKILINVCIMVSADRCSLFLVEGPSHKRTLVSKFFD-------------VHSGTTVRPSSSMNSSEVQVPWGKGIIGYVAEHGETVNIPNAYEDHRFSDEIDKLTGYKTQSILCMAICNSDGEVIGVVQAINKNPKGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYDRSR 340          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 315/593 (53.12%), Postives = 435/593 (73.36%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQK 2700
            ++ + L VP+  + T+ V+ + C+ NK     +T  DE+ I  CF +T++VL +TIA+Q E++LK + + +L VAKN+F+ +D+++ LL  I+QEARNL+ AERCSVFL+D  S+ELVAKVFDG               G    +  E+R P  QGIAGHVATTGE+LNIK AY HPLFYRGVDD TGF+T++ILCFPI+D+  + +GVA+LCNKI G +F+K DE++A AFSIYC ISI +SL+YKKV +AQ RS+L+NE+MMYHM++  +++  +    I  V+    DF  F   PR++ +  T+ A + M + +G I+ ++++ RTLT++  MV++ YRDPPYHNWMHA+SV+HF ++  KNL L K L ++E+FALFV+ LCHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + I+N+ GCN+ E+L +KEY R LDL+RDIILATDLAHHL+IF  + K+A  GY+  +   H+LLLCLLMTS DLSDQTK W+ TR +AELIYKEFF QGDLEKA+GN+P+E MDRE+A +P LQI+F++ I  PL+++L  + P    +   +   +E+W ++S K
Sbjct:    8 RVNSMLSVPIVARATSQVVTLACVFNKLHGQSYTETDERKIQHCFCFTSTVLTSTIAFQKEQKLKFECQALLQVAKNLFTHLDDVSVLLHEIIQEARNLSNAERCSVFLLDRSSHELVAKVFDG---------------GVVSDESYEVRIPADQGIAGHVATTGEVLNIKDAYSHPLFYRGVDDSTGFRTRSILCFPIKDENEEVIGVAELCNKINGPWFSKFDEDLATAFSIYCGISIANSLLYKKVAEAQQRSQLSNEMMMYHMKVSPEEMNKVLNSRIQTVTDIHPDFAKFTYTPRSLGEDQTITAILGMVEDMGFINNYKLDLRTLTRWCLMVRKGYRDPPYHNWMHAYSVSHFCYLLYKNLDLGKYLQDMEIFALFVSCLCHDLDHRGTNNSFQVDSKSVLAALYSSEGSVMERHHFAQAIAIINSAGCNILENLSRKEYQRMLDLMRDIILATDLAHHLRIFKDLRKIADAGYNPDNGHQHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPSEMMDREKAYIPELQISFMEHIAMPLFKLLKDMLPGAAELYERVAANKEHWMRVSHK 585          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 447.203 bits (1149), Expect = 9.399e-149
Identity = 228/399 (57.14%), Postives = 300/399 (75.19%), Query Frame = 1
Query: 1168 DNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQI-----PEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMA 2349
            D+++ LL  I+QEARNL+ AERCSVFL+D  S+ELVAKVFDG   S             E  +  E+R P  QGIAGHVATTGE+LNIK AY HPLFYRGVDD TGF+T++ILCFPI+D+  + +GVA+LCNKI G +F+K DE++A AFSIYC ISI +SL+YKKV +AQ RS+L+NE+MMYHM++     PE+    L++  I  V+    DF  F   PR++ +  T+ A + M + +G I+ ++++ RTLT++  MV++ YRDPPYHNWMHA+SV+HF ++  KNL L K L ++E+FALFV+ LCHD+DHRGTNNSFQV S S+LAALYSSEGSV+ERHHF+Q + I+N+ GCN+ E+L +KEY R LDL+RDIILATDLAHHL+IF  + K+A
Sbjct:    5 DDVSVLLHEIIQEARNLSNAERCSVFLLDRSSHELVAKVFDGGVVSD------------EFMKSYEVRIPADQGIAGHVATTGEVLNIKDAYSHPLFYRGVDDSTGFRTRSILCFPIKDENEEVIGVAELCNKINGPWFSKFDEDLATAFSIYCGISIANSLLYKKVAEAQQRSQLSNEMMMYHMKVGTQVSPEEMNKVLNS-RIQTVTDIHPDFAKFTYTPRSLGEDQTITAILGMVEDMGFINNYKLDLRTLTRWCLMVRKGYRDPPYHNWMHAYSVSHFCYLLYKNLDLGKYLQDMEIFALFVSCLCHDLDHRGTNNSFQVDSKSVLAALYSSEGSVMERHHFAQAIAIINSAGCNILENLSRKEYQRMLDLMRDIILATDLAHHLRIFKDLRKIA 390          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde5ab (phosphodiesterase 5A, cGMP-specific, b [Source:ZFIN;Acc:ZDB-GENE-060824-4])

HSP 1 Score: 243.432 bits (620), Expect = 5.021e-68
Identity = 189/621 (30.43%), Postives = 318/621 (51.21%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSG--PAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIR-FPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQD-DCGKTVGVAQLCNKIK---GHF--FTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIA-----WLSTFSIPPV-SIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYR-DPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSF-QVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEK-AIGNQPAEQMDRE-RAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKG 2724
            K Q+ LC+P++     +++ +   INK G    +FT  DE+       +   VL     Y++      + + +L +A  +     +L EL+  I+    +    +RC+VF+ D+DS  + ++VF         ++ L +    E     E R  P +   A  V     +LNI   +    F   V++   ++TK++LC PIQ+    + +GV QL NK++   G    F + DE+  +AF+I+C ++I ++ MY+ V  A  +  +  E++ YH    ED+ A      L+T S+P   S+ L DF +F+     + +  T +  + M   + L+  + I      ++I  V++NYR +  YHNW HAF+    +F  +        LT LE+  L +A+L HD+DHRG NNS+ + +S+  LA LY    S+LE HHF Q + +LN+ G  +  SL  +EY  A+ +I   IL+TDLA + +   +   + +    NL+ ++H  LL  ++MT+ D+S  TK W   + +AEL+  EFF QGD E+  +  +P + M+RE R  +P +Q+ F+DGI  PLY  LS + P    +    +  R+NW K++       +KG
Sbjct:  216 KTQSVLCLPIK-DNKGEIVGVAQAINKKGNNEGKFTEKDEREFGAYLAFCGIVLHNAQLYEDSLLENRRNQVLLELASLVCEEQSSLEELVGRIIDIILSFMPCQRCAVFIADKDSPNIFSRVF---------HKSLEVPGVAENTSQSESRSHPVSFIYAEFVMKMLTLLNIPDVHRDNRFNLPVEERGDYRTKSLLCAPIQNRKKNEVIGVCQLVNKLEEGAGEVRPFNRNDEQFVEAFAIFCGMAIRNTRMYEAVARAVAKQTVTLEVLSYHAIAHEDECAKLQSQHLTTTSVPSAQSLNLLDF-TFSDF--GMAEELTAVGSLRMLLDLSLLQTFSIPNEVACRWILSVRKNYRRNIAYHNWRHAFNTGQCMFTVLVTGQAQNVLTPLEMLCLIIAALSHDLDHRGFNNSYIKNRSDHPLATLYGH--SMLEHHHFDQCLMLLNSPGNEMLSSLSVQEYRSAVGMIEHAILSTDLATYCKNRGEFFSLVKDRTFNLEDQHHRKLLRAMMMTACDVSAITKPWPVQQKIAELVASEFFDQGDRERQELHVEPTDMMNREKRDKIPTIQVGFIDGICLPLYEALSCVFPACAPLLSGCQSNRQNWEKLTTSPQGTIVKG 821          

HSP 2 Score: 100.138 bits (248), Expect = 9.888e-22
Identity = 66/187 (35.29%), Postives = 103/187 (55.08%), Query Frame = 1
Query: 1120 QTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNE---LVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGH---FFTKMDEEIAKAFSIYCCISITHSLMYK 1662
            + E+ L + K+I  R+D +  L   I+     +  A+RCS+F+V EDS++   LV+ +FD           + L    E  +   +R    +GI G+VA TG  +NI  AY  P F   VD  TG+KT+++LC PI+D+ G+ VGVAQ  NK KG+    FT+ DE    A+  +C I + ++ +Y+
Sbjct:  102 ERERFLELVKDIACRLDVVT-LCHRILLHVNQVLTADRCSLFIVREDSSQERCLVSTLFD-----------VSLGSTPEQARTSWLRLAWGKGIVGYVAATGNGVNIPNAYQDPRFNVEVDLMTGYKTQSVLCLPIKDNKGEIVGVAQAINK-KGNNEGKFTEKDEREFGAYLAFCGIVLHNAQLYE 275          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 140.198 bits (352), Expect = 1.057e-35
Identity = 115/388 (29.64%), Postives = 180/388 (46.39%), Query Frame = 1
Query:  592 ISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVI------GQ--VIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNAS-KQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEK---MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYH 1719
            +++ I Q L++ G        KL    L Y+I N +   GF L    +    LC         GQ  +I   P+ F A  +    KV ++        L E  L +             ++++ LC+P+      D++ ++ L  + G   FT   ++V      + +  +      Q    L  QTE    +L V+K  F  +  ++ LL  IM  A+NL  A+RC++F VD  +NEL + +FD      +K  +   +   EI      RF   +GIAG VA TG +LNI  AY  P F R VD  TG+ T+NILC PI    G  +GV Q+ NK+ G  FTK DE   K F+++C +++  + MY ++  ++   R+  E + YH
Sbjct:   25 LNSHIEQRLDMGGD------SKLLLHELCYIIHNATNADGFSLYFLGECNNSLCLFTPTGAKEGQQRLIPAGPVGFGATVSAYVAKVRQT-------VLVEDILGDERFPQGVGLDPGAQVRSVLCLPLI-TANGDLLGVLELQRRWGKEPFTIRHQEVATALLAWASVAIHQV---QVSHGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNNELYSDLFD---IGEEKEGQPVFRKTKEIT----CRFSIEKGIAGQVAKTGMVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVSR-GSVIGVVQMVNKLSGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIFRVTLEKLSYH 387          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde1a (phosphodiesterase 1A, calmodulin-dependent [Source:ZFIN;Acc:ZDB-GENE-090831-2])

HSP 1 Score: 119.783 bits (299), Expect = 2.270e-28
Identity = 82/250 (32.80%), Postives = 133/250 (53.20%), Query Frame = 1
Query: 1879 LISRWRINRRTLTKFIFMVKRNY--RDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLS 2622
            LISR++I    L  F+  ++  Y     PYHN  HA  V   +   +    L   L+ELE  A+  A+  HD++H GT N+F +Q+ S +A LY ++ +VLE HH S    ++  +  N+F +L + ++     L+ +++LATD++ H Q    ++   QQ     +S + +  + LL+ + D+S  TK W   +   E + +EFFRQGD E  +G   +   DR   +V   QI F+D IV P + VL+
Sbjct:  182 LISRYKIPVAALVSFVEALEAGYSKHKNPYHNLAHAADVTQTVHYLLLQSGLMHWLSELETLAVIFAAAIHDLEHTGTTNNFHIQTRSDVALLY-NDRAVLENHHVSAAYRLMQDDDMNIFINLSKDDWRELRALVVEMVLATDMSCHFQQIKTMKSALQQP----ESIDKSKAMSLLLHAGDISHPTKEWPLHQRWTEALMEEFFRQGDREAKLGLPFSPLCDRNSTMVAQSQIGFMDFIVEPTFSVLT 426          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO38644 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC93])

HSP 1 Score: 458.373 bits (1178), Expect = 1.420e-151
Identity = 242/491 (49.29%), Postives = 333/491 (67.82%), Query Frame = 1
Query: 1234 CSVFLVDEDSNELVAKVFDG-LPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIP-PVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQK 2700
            CS+FL+D + +ELVAKVFDG +P++               Q   ++R P  QGI G VA TG++LNIK AY HPLFYRG+D +TGFKT+NILCFPI+DD G  +GVA+LCNK  G  FTK DE++ +AF+IYC ISI HS++YK+   A HRS++ +ELM+YHM + E+++  L+   I  P       F+ F+  PR ++  +T+ A + MFD +G+I RW+I R TL +F  MV++ YRDPPYHNW HAF+VAHF ++ +KN  ++ +L ++E  ALFVA LCHD+DHRGTNN+FQV SNS LAALYSSEGSV+ERHHF+QTVCILN+ GCN+F++L + E+ + LDLIR IILATDL+HHL+I   I  MA +G +  + E    L+  ++ + DLS   +  ++  ++A+   K        EK +G  P E MDRERA +P LQI FL+ I  P+Y+VL  L P+T  +  T+ +  E W  I +K
Sbjct:    1 CSLFLLDRERDELVAKVFDGEIPSN---------------QASRDLRIPTNQGIVGQVAMTGKLLNIKDAYTHPLFYRGLDVKTGFKTRNILCFPIKDDDG-VIGVAELCNKANGKCFTKFDEDLTRAFAIYCGISIFHSMLYKRAATAWHRSQVCSELMIYHMHVSEEELQRLTAHEISSPDEEIPHGFDKFSFAPRTIQMEETVRAALYMFDDLGIIDRWKIPRDTLIRFTLMVRKGYRDPPYHNWTHAFTVAHFCYLLLKNSHMESKLQDIERMALFVACLCHDLDHRGTNNAFQVSSNSTLAALYSSEGSVMERHHFAQTVCILNSSGCNIFKNLTESEFEKVLDLIRYIILATDLSHHLRILKDINNMA-KGRNKNEFEKVLDLIRYIILATDLSHHLRILKDINNMAKGRNKNV--PSLFEKVMGFTPMEMMDRERACIPKLQIDFLENIALPVYKVLHELLPETKEVIDTVHKNMECWQAIEEK 472          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO39522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9Q1])

HSP 1 Score: 359.377 bits (921), Expect = 1.554e-109
Identity = 225/611 (36.82%), Postives = 346/611 (56.63%), Query Frame = 1
Query:  937 LCVPVR-HQGTNDVIAIVCLINKSGPA---QFTNYDEQVINECFKYTTSVLFTTIAYQNER---RLKLQTEK---MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPV-SIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQ----IFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEK-AIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEI 2718
            LC+P++ H G  +VI +  +INK+G +    FT  DEQ+     KY   ++F  I   N     R +L+  +   +L +A+ IF    +L+ ++  IM   ++L Q ERCSV LVD  S  L A+ FD      +  + L+  D     + VE+RFP   GI GHVATTGE LNI  AY    F   VD  +GF TK ILC PI++  G  +GV QL NK+ G  F K DE + +AF+I+C ++I  ++MY+ V  A  + ++A E++ YH   P ++   L    +PP+ S+ L DF +F+ +  ++ D DTL  C++M   + ++  ++I+  TL +F+  +K+NYR   YHNW HAF+VA  ++  +K   + K  T +E +AL VA L HD+DHRGTNNSFQ++S + LA LYS+  S +E HHF Q + I+N++G  +F +L   EY + + L+   I+ATDLA + Q     F K+E    +  D  D  + +LL  ++MT+ DLS  TK W   +  A L+ +EFF+QGDLE+  + + P   MDR +   +P +Q+ F+D +  PLY+  S        +       R  W K+++   + E+
Sbjct:  238 LCMPIKDHDG--EVIGVAQVINKTGKSTDSAFTIDDEQIF---LKY---LVFCGIGINNAELYERAQLEIRRNQVLLDLARTIFEEQTSLHNIVHKIMMITQSLLQCERCSVLLVDPTSKTLFAQAFD-----LEAKDYLQNDDD---DKTVEVRFPINIGITGHVATTGETLNIPDAYADERFDPTVDQVSGFTTKTILCMPIKNASGDIIGVVQLLNKVDGTPFNKNDENLFEAFAIFCGMAIHSTVMYENVNKAMAKRKVALEVLSYHAVSPLEEAIKLKEEPLPPITSLRLIDF-AFDDM--SISDDDTLKGCLAMLCDLKIVETFQIDYLTLCRFVLTIKKNYRPVMYHNWRHAFNVAQTMYAMLKKPSIGKYFTVIEQYALIVACLSHDLDHRGTNNSFQIKSATPLAQLYST--STMEHHHFDQCIMIINSQGNEIFNTLSADEYNKIIKLLEASIIATDLALYFQRRGDFFKKVE---NRELDWSDDSSKDLLRAMMMTACDLSAITKPWLVQKRTAHLVAEEFFQQGDLEQEELHSTPLPTMDRRKKDELPQMQVGFIDAVCLPLYKAFSQFDDNLKVLKDGCRENRRQWQKLAEDHKAREV 824          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO44626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVE3])

HSP 1 Score: 330.487 bits (846), Expect = 3.965e-101
Identity = 209/578 (36.16%), Postives = 317/578 (54.84%), Query Frame = 1
Query:  919 TKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFT--KMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQT 2640
            T  Q+ LC P+  Q   +++  + L    G   F   DE+V N    +    L+    Y +  + +  TE +L V ++IF  + +++ +++ IM  A+ L  A+R S+FLVD  +NEL A++FD   +         L+D    Q   EIRFPK +G+AG+VAT+GE LNI  AY    F R +D +TG+ T+ +LC PI    G  +GV Q+ NK  G        DE+  + F+IYC +++ H+ +Y K+  ++ + R+A E++ YH +  E ++  L     P     L  +E F+S   + +    +M  + +F    L S  R +   L +F+  V++NYR  PYHNW HAF+VAH +++ I++       T LE  A+F A LCHD+DHRG  NS+     + LAA+YS+  S +E HHF+QT+ IL  EG N+F  L   EY   L  +++ ILATDLA      +K++ +  +G  + D + H  LL  + MT+ DLS  TK WR    + E+IY+EF+ +GDLEKA G QP    DR  A  +P  Q+ FL GI  P Y +L  + P T
Sbjct:   51 TTAQSILCQPIV-QSNGELVGTIELSRMVGRDPFDEEDEEVFNSYLVWGGISLYYAEMYLHMHKHRKLTEFLLNVTRSIFQDIVSMDTVIMKIMNYAQTLVDADRTSLFLVDNKTNELYARIFDIGGS---------LEDSRSSQLQKEIRFPKTKGVAGYVATSGETLNISDAYHDDRFNREIDIQTGYTTRTLLCMPIFIR-GNIIGVVQMVNKKSGVLIMCFSSDEKSFQTFAIYCGLALHHAKLYDKIRRSEQKHRVALEVLSYHSKCSEGELHRLKELDCPDPYPDLETYE-FDSYSLDSE----VMPKLVIFQTRNLFSLSRFDLDELYRFVLTVRKNYRKVPYHNWTHAFAVAHCMYLVIRS--GHNNFTGLEALAMFFACLCHDLDHRGRTNSWMKNEGTPLAAVYST--STMEHHHFNQTITILQHEGHNIFSQLNSAEYKTVLGYMKECILATDLALFFGNKAKLKDVVDKGTFSWDDQEHRRLLRAICMTACDLSACTKPWRIQYKIVEVIYQEFYAEGDLEKAQGKQPIPMKDRNTAHELPAHQVGFLVGICLPCYELLGKVIPGT 608          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW30])

HSP 1 Score: 291.197 bits (744), Expect = 8.101e-87
Identity = 199/577 (34.49%), Postives = 308/577 (53.38%), Query Frame = 1
Query:  919 TKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKY-TTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDC-GKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQ 2637
            T   + LC P+  Q    ++ +V L+   G   F   DE+++N    + + ++    I+ Q  ++  L T  +L V ++IF  +  ++ ++  IM  A+ L  A+RCS+FL+D+ S EL A +FD      D NE    + G EI      RFP ++GIAG+VA TG +LNI+ AY    F R VD +TG+ T  ILC P++  C G  +GV Q+ N   G FF+  D +  + F+ YC +++ +S MY  +  AQ + ++A E++ YH    E +              FL+  +     P             S    +  +  +R++  T+ +F   V++ YRD PYHNW HAFSVAH ++I I++   +K LT+ E  +LF+A +CHD+DHRG NN+F +   + LA LY++  S +E HHF Q V IL +EG NVF  L  + Y R L+LI++ I+ATDL        ++E + +      + E H +L+ CLLMT+ DL    K W         +++EF+ QGD E+ +G  P   MDR +   +P  Q+ FL GIV P Y +L    P+
Sbjct:   56 TTAMSVLCQPII-QSDGTLVGVVELVKALGSMPFEKEDEEILNSYLVWGSIAIHHAEISKQITKQKDLNT-FLLNVVRSIFDEVCTMDTVIEKIMAFAKKLVNADRCSLFLLDQASEELFANLFD------DGNEDGSFRCGNEI------RFPVSKGIAGYVACTGSILNIRDAYRDERFNREVDMKTGYTTHTILCVPVR--CKGSIIGVCQMVNSHNG-FFSPNDMQSFEMFAGYCGLALHYSKMYNSLFCAQQKHQVALEVISYHCCASEKE-----------TEEFLNSADLVMLPPAYYP--------FSYLSALIFVLIFRVDLETIARFSLSVRKCYRDIPYHNWCHAFSVAHSLWIVIRD---NKSLTDYEKLSLFIAGICHDVDHRGKNNAFMLHCKTPLANLYTT--STMEWHHFKQGVFILESEGQNVFGQLDAESYRRVLELIQEAIIATDLMLFFGNKKELETLQENKAFRWEEEKHRSLIRCLLMTACDLCTSAKPWDIQVVAVNKVFEEFYIQGDEERKMGLDPLPMMDRSKHDDLPENQVGFLKGIVRPCYSLLMDFVPE 591          

HSP 2 Score: 57.3806 bits (137), Expect = 2.564e-8
Identity = 35/106 (33.02%), Postives = 53/106 (50.00%), Query Frame = 1
Query: 1351 QQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKV 1668
            +QP+     K   +A HVA TGE L IK       F +G+  E      ++LC PI    G  VGV +L   +    F K DEEI  ++ ++  I+I H+ + K++
Sbjct:   15 RQPI----GKGGTVAAHVAETGERLFIKDILGDERFPKGIGVEGMTTAMSVLCQPIIQSDGTLVGVVELVKALGSMPFEKEDEEILNSYLVWGSIAIHHAEISKQI 116          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO43657 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY89])

HSP 1 Score: 258.07 bits (658), Expect = 1.271e-73
Identity = 186/597 (31.16%), Postives = 317/597 (53.10%), Query Frame = 1
Query:  937 LCVPVRHQGTNDVIAIVCLINKS-GPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKL------QTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKA-YDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIP-PVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQG-YDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGN-QPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKI 2691
            LC PV++    +V+ +  +INK+ G   FT  DE+V   C  Y T   F  I   N +  +L      +   +L +  +IF    +L +++  IM+ A  L + E+CSV L+ +      ++VF+ L T+       R      +             +A  VA TG+ +NI  A  D  L      ++ GF    ILC PI+++  + +GVA+L N++    F + DE + +AF+I+C + I ++++Y ++  A+ + ++A E++ YH+   + ++  +    +P  V I L  F+ F+    ++   D L+A + MF   G I  + I+   L+++I  VK NYR+  YHNW HAF+VA  +F  +    +   +T+LE   L V  LCHD+DHRGTNN+FQ +++S L+ LY +  S LE HHF+  V IL+TEG   F  +   EY + +  I+  IL+TDLA + +   K   + + G +D  + ++ ++L  ++MT+ DL+  TK W   + V  L+ +EFF QGD+E+   N +P   MDR++   +P LQ+ F +    P+++VL+ L+ +   +    E  +  W K+
Sbjct:  140 LCKPVKNN-EGEVVGVAQIINKNPGGVPFTKEDEKV---CDMYLT---FCGIGITNAKLFELSAIEFNRNRALLELVHDIFEEQTSLEKVVHKIMKRALGLLKCEKCSVLLLTQPELRF-SRVFN-LKTTGRITSNTRYGFILLLVSEGHNDRSFTSRVAKLVAATGKTMNIPDASQDTRLADSSNVEKKGFSP--ILCMPIRNNKFEIIGVAELINRLDNKPFDENDETLFEAFAIFCGLGIHNTMIYDQMARAKAKQQVALEVLSYHVAAKKTEVEKIRDTQVPKAVDINLHSFK-FDDF--SLAADDMLIASLRMFKDCGFIEEFHIDYEVLSRWILTVKNNYRNVIYHNWRHAFNVAQSMFCMLTTGGMASVITKLECLGLIVGCLCHDLDHRGTNNAFQAKTDSPLSKLYGT--STLEHHHFNHAVIILSTEG---FSPILSDEYRQVISYIKHSILSTDLATNFKQRPKFFALVESGEFDPYNMDHRDMLKAMMMTACDLNGTTKPWEIQKEVVNLVTREFFEQGDMERERYNMEPMAIMDRQKIDELPKLQVQFFETTGLPVFKVLAKLNNKLQPLVDGAESNKRRWQKL 717          

HSP 2 Score: 108.997 bits (271), Expect = 2.670e-24
Identity = 72/197 (36.55%), Postives = 109/197 (55.33%), Query Frame = 1
Query: 1141 VAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNE--LVAKVFD----GLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHF-FTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELM 1710
            + ++I + +D L  L   I+     LT A+RCS+FLV+    +  LV+KVFD     L  SS K           I    EIR P   G+ G+ A TGE +NI  AY  P F + VD +TG+ TK++LC P++++ G+ VGVAQ+ NK  G   FTK DE++   +  +C I IT++ +++      +R+R   EL+
Sbjct:   23 IVRDIANDLD-LKTLSYKILVNVGILTNADRCSLFLVEGPKGKQWLVSKVFDVHIGSLNVSSAKEA---------IDHQREIRVPLGVGLVGYAAETGETVNIPDAYADPRFNQDVDKQTGYHTKSLLCKPVKNNEGEVVGVAQIINKNPGGVPFTKEDEKVCDMYLTFCGIGITNAKLFELSAIEFNRNRALLELV 209          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde11a (phosphodiesterase 11A [Source:NCBI gene;Acc:101163533])

HSP 1 Score: 298.516 bits (763), Expect = 3.950e-86
Identity = 188/602 (31.23%), Postives = 320/602 (53.16%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQ-FTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELV--AKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEK-AIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVAS 2709
            K ++ LC+P+ H    ++I +   INK+   + FT  DE+V+     +    +     +   R+   ++  +L V  ++F    +L +++  IM  A+ L + ERCSV L+++  + +V   K F+ L      +     +D  E     +        IA  VA+TG  +NI  AY  P F    D  + F  +++LC PI +   + +GVAQ+ N++ G  F   D+ + +AF I+C + I +++MY +V+ +  +  +A +++ YH    + ++      +IP V     D  SF+    +V     + A + MF  +G++ +++I+  TL +++  V++NYR   YHNW HAF+V   +F  +      + LT+LE+ AL V  +CHD+DHRGTNN+FQ ++ S LA LY +  + LE HHF+  V IL +EG N+F +L   EY   + L++  ILATDL  + +  +    +  +G  N + + H ++   ++MT+ DL   TK W  +R VAEL+  EFF QGD E+  +   P+   DR R   +P LQ+ ++DGI +PLY  L  L+P+   +   I   R  W ++++K  S
Sbjct:  278 KTKSLLCMPI-HNSDGEIIGVAQAINKTSNGELFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVRFTKSFELLSPKCSADAESSFKDSMEKSSYSDWLI--NNRIAELVASTGLPVNISDAYQDPRFDAEADQFSDFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKTEVDKFKAANIPLVCELGIDKLSFDDFSLDVDA--MITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQCMFAMLTTAGFQEVLTDLEILALIVGCVCHDLDHRGTNNAFQAKTGSALALLYGTSAT-LEHHHFNHAVMILQSEGHNIFSNLSSTEYSDLMQLLKLSILATDLTLYFENRNMFFDLVSKGEYNWNVKAHRDMCRSMMMTACDLGAVTKPWDISRKVAELVTSEFFEQGDRERLELKLTPSAIFDRNRKDELPGLQLEWIDGICAPLYETLVKLNPKLQPMFDRIRANRSKWEELNKKRQS 873          

HSP 2 Score: 97.8265 bits (242), Expect = 2.768e-20
Identity = 65/197 (32.99%), Postives = 103/197 (52.28%), Query Frame = 1
Query: 1120 QTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNE--LVAKVFDGLPTSSDKNERLRLQDGTEI---QQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIK-GHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSR 1692
            + E  L + K+I + +D L  L   I+     +  A+RCS+FLV+   N+  LV+K FD             +  GT +       E++ P  +GI G+VA  GE +NI  AY    F   +D  TG+KTK++LC PI +  G+ +GVAQ  NK   G  FT+ DE++ + +  +C I+I+++ ++        RSR
Sbjct:  164 EREFFLELVKDISNDLD-LTSLSYKILVFVCIMVDADRCSLFLVEGTGNKKTLVSKFFD-------------VHAGTTVLISMNSDEVQVPWGKGIIGYVAEHGETVNIPDAYQDRRFSDEIDKLTGYKTKSLLCMPIHNSDGEIIGVAQAINKTSNGELFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSR 346          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde10a (phosphodiesterase 10A [Source:NCBI gene;Acc:101162470])

HSP 1 Score: 293.893 bits (751), Expect = 1.601e-85
Identity = 198/597 (33.17%), Postives = 316/597 (52.93%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEK---MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQ 2697
            ++ + LC+P+      D++AI+ L    G   F    ++V      + +  +      Q  R L  QTE    +L V+K  F  +  ++ LL  IM  A+NL  A+RC++F VD ++ EL + +FD      +K  +         ++  EIRF   +GIAG VA TGE+LNI  AY  P F R VD +TG+ T+NILC PI    G  +GV Q+ NK+ G  FTK DE   K F+++C +++  + MY ++  ++   R+  E + YH     ++   L+  ++P  +    + E+F     ++   + +   + ++               L +F   V++NYR  PYHNW HA +VAH ++  ++  P     TELE   L +A LCHD+DHRG +N++  + +  LAALYS+  S +E+HHFSQTV IL  EG N+F +L   EY + L++IR  I+ATDLA +     ++ ++      + ++ +H + ++ L+MT+ DL   TK W+ TR  A  IY EF+ +GD  K IG QP   MDR++   VP  Q+ F + +  P Y  LS L P +  +         +W +I++
Sbjct:  194 RVHSVLCLPIV-TAIGDLVAILELRRHWGKEPFNLSHQEVATANLAWASVAIHQV---QVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD---IGEEKEGK------PVFRKTKEIRFSIDKGIAGQVARTGEVLNIPDAYADPRFNREVDLKTGYTTRNILCMPIVSR-GTVIGVVQMVNKLCGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLNLP--TPIYKEIETFQF---DISPFEEIWPAVFIYMVHNSCGENSFELEKLCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQKTP--DSFTELEKKGLLIACLCHDLDHRGYSNAYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLNSSEYEQVLEIIRKAIIATDLALYFNNHQQLTELLSTSALDFNNHSHRDRVIGLMMTACDLCSVTKQWQITRLTANDIYAEFWAEGDEMKKIGIQPIPMMDRDKKDEVPEGQVGFYNSVAIPCYTTLSKLFPPSSPLLKACRENLSHWERIAR 767          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde10a (phosphodiesterase 10A [Source:NCBI gene;Acc:101162470])

HSP 1 Score: 293.893 bits (751), Expect = 1.666e-85
Identity = 199/598 (33.28%), Postives = 318/598 (53.18%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEK---MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEI-QQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQ 2697
            ++ + LC+P+      D++AI+ L    G   F    ++V      + +  +      Q  R L  QTE    +L V+K  F  +  ++ LL  IM  A+NL  A+RC++F VD ++ EL + +FD      +K       +G  + ++  EIRF   +GIAG VA TGE+LNI  AY  P F R VD +TG+ T+NILC PI    G  +GV Q+ NK+ G  FTK DE   K F+++C +++  + MY ++  ++   R+  E + YH     ++   L+  ++P  +    + E+F     ++   + +   + ++               L +F   V++NYR  PYHNW HA +VAH ++  ++  P     TELE   L +A LCHD+DHRG +N++  + +  LAALYS+  S +E+HHFSQTV IL  EG N+F +L   EY + L++IR  I+ATDLA +     ++ ++      + ++ +H + ++ L+MT+ DL   TK W+ TR  A  IY EF+ +GD  K IG QP   MDR++   VP  Q+ F + +  P Y  LS L P +  +         +W +I++
Sbjct:  197 RVHSVLCLPIV-TAIGDLVAILELRRHWGKEPFNLSHQEVATANLAWASVAIHQV---QVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD---IGEEK-------EGKPVFRKTKEIRFSIDKGIAGQVARTGEVLNIPDAYADPRFNREVDLKTGYTTRNILCMPIVSR-GTVIGVVQMVNKLCGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLNLP--TPIYKEIETFQF---DISPFEEIWPAVFIYMVHNSCGENSFELEKLCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQKTP--DSFTELEKKGLLIACLCHDLDHRGYSNAYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLNSSEYEQVLEIIRKAIIATDLALYFNNHQQLTELLSTSALDFNNHSHRDRVIGLMMTACDLCSVTKQWQITRLTANDIYAEFWAEGDEMKKIGIQPIPMMDRDKKDEVPEGQVGFYNSVAIPCYTTLSKLFPPSSPLLKACRENLSHWERIAR 770          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde10a (phosphodiesterase 10A [Source:NCBI gene;Acc:101162470])

HSP 1 Score: 294.278 bits (752), Expect = 2.355e-85
Identity = 199/598 (33.28%), Postives = 318/598 (53.18%), Query Frame = 1
Query:  922 KIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEK---MLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEI-QQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENH-NLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERA-VVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQ 2697
            ++ + LC+P+      D++AI+ L    G   F    ++V      + +  +      Q  R L  QTE    +L V+K  F  +  ++ LL  IM  A+NL  A+RC++F VD ++ EL + +FD      +K       +G  + ++  EIRF   +GIAG VA TGE+LNI  AY  P F R VD +TG+ T+NILC PI    G  +GV Q+ NK+ G  FTK DE   K F+++C +++  + MY ++  ++   R+  E + YH     ++   L+  ++P  +    + E+F     ++   + +   + ++               L +F   V++NYR  PYHNW HA +VAH ++  ++  P     TELE   L +A LCHD+DHRG +N++  + +  LAALYS+  S +E+HHFSQTV IL  EG N+F +L   EY + L++IR  I+ATDLA +     ++ ++      + ++ +H + ++ L+MT+ DL   TK W+ TR  A  IY EF+ +GD  K IG QP   MDR++   VP  Q+ F + +  P Y  LS L P +  +         +W +I++
Sbjct:  225 RVHSVLCLPIV-TAIGDLVAILELRRHWGKEPFNLSHQEVATANLAWASVAIHQV---QVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD---IGEEK-------EGKPVFRKTKEIRFSIDKGIAGQVARTGEVLNIPDAYADPRFNREVDLKTGYTTRNILCMPIVSR-GTVIGVVQMVNKLCGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLNLP--TPIYKEIETFQF---DISPFEEIWPAVFIYMVHNSCGENSFELEKLCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQKTP--DSFTELEKKGLLIACLCHDLDHRGYSNAYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLNSSEYEQVLEIIRKAIIATDLALYFNNHQQLTELLSTSALDFNNHSHRDRVIGLMMTACDLCSVTKQWQITRLTANDIYAEFWAEGDEMKKIGIQPIPMMDRDKKDEVPEGQVGFYNSVAIPCYTTLSKLFPPSSPLLKACRENLSHWERIAR 798          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde5ab (phosphodiesterase 5A [Source:NCBI gene;Acc:101173207])

HSP 1 Score: 255.373 bits (651), Expect = 2.237e-71
Identity = 199/612 (32.52%), Postives = 321/612 (52.45%), Query Frame = 1
Query:  922 KIQNALCVPVR-HQGTNDVIAIVCLINKS--GPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLR--LQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVD--DETGFKTKNILCFPIQD-DCGKTVGVAQLCNKI---KGHF--FTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPV-SIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDP-PYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHL---QIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGN-QPAEQMDRE-RAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQ 2697
            K Q+ LC+P++ H+G  +V+ +   INK+      FT  D++  +    ++  VL     Y+  +    +   +L +A  IF     L  LL  I     +  QA+ C+VF+ DE+S    + VF        ++E L   L+D        +I +  AQ    +V +T + LNI        F    D  D    + K++LC PI++    K +GV QL NK+    G    F + DE+  +AF+I+C + I ++ MY+ VE A  +  +  E++ YH    E++   L   ++P   S+ L DF SF+    ++ D +T +A I MF  + L+  +++   +L ++I  VK+NYR    YHNW HAF+ A  +F  +K+  L   L++LE+ AL +A+L HD+DHRG NNS+  +S   LA LY    S +E HHF Q + ILNT G  +   L   EY   L +I   ILATDLA ++   + F ++ K  Q  +  +D  + +LL  +LMT+ D+S  TK W   + VAEL+  EFF QGD E+   N +P + M+RE R  +P++Q++F+D I   LY  L+ L      +    ++ R++W ++++
Sbjct:  243 KTQSILCLPIKNHRG--EVVGVAQAINKTCGEDGAFTEQDQKDFSAYLAFSGIVLHNAQLYETSQLENKRNRVLLDLATLIFEEQQCLEVLLRKIAGTILSFMQAQACTVFIADEESMNSFSGVFHM------EHEELSEVLEDPKRNCDVKQINYMFAQ----YVKSTMQPLNISDVTKDQRFPWTSDCPDHMSNQIKSLLCAPIRNRKKDKVIGVCQLVNKLDEASGSIKSFNRNDEQFLEAFAIFCGLGIQNTQMYETVERAMAKQEVTLEVLSYHASATEEESQELQVATVPSAQSLRLLDF-SFSDF--DLSDTETTLATIRMFTDLNLVQNFQMKYTSLCQWILSVKKNYRKSVAYHNWRHAFNTAQCMFALLKSGRLQNNLSDLEILALMIATLSHDLDHRGVNNSYIQRSEHPLAQLYCH--STMEHHHFDQCLMILNTPGNQILSGLSLDEYKATLKMIEKAILATDLALYMKKREDFFELTKNNQ--FVWVDEHHRDLLRSMLMTACDISAITKPWPVQKRVAELVATEFFEQGDKERRELNIEPTDLMNREKRDKIPSMQVSFIDAICIQLYETLAGLLEHCSPLLEGCQKNRQHWKRLAE 835          

HSP 2 Score: 97.8265 bits (242), Expect = 2.487e-20
Identity = 78/243 (32.10%), Postives = 130/243 (53.50%), Query Frame = 1
Query: 1129 KMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNE---LVAKVFDGLPTSSDKNERLRLQDGTEIQQPVE--IRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGH--FFTKMDEEIAKAFSIYCCISITHSLMYK--KVEDAQHRSRLANELMMYH----MQIPEDDIAW--LSTFSIPPVSIFLSDFESFNS 1812
            ++L + K++ S +D +  L   I      L  A+R S+FLV EDS+    LV+++FD             + +G+ +++     IR    +GI GHVA TG+ LNIK AY  P F   VD  TG+KT++ILC PI++  G+ VGVAQ  NK  G    FT+ D++   A+  +  I + ++ +Y+  ++E+ ++R  L    +++     +++    IA   LS       ++F++D ES NS
Sbjct:  132 RLLELVKDVSSHLD-VPALCHKIFLHINELIAADRYSLFLVGEDSSNRKFLVSRLFD-------------VAEGSTLEESSSSSIRLEWNKGIVGHVAATGQPLNIKNAYKDPRFNAEVDLITGYKTQSILCLPIKNHRGEVVGVAQAINKTCGEDGAFTEQDQKDFSAYLAFSGIVLHNAQLYETSQLENKRNRVLLDLATLIFEEQQCLEVLLRKIAGTILSFMQAQACTVFIADEESMNS 360          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000021196.1 (SMESG000021196.1)

HSP 1 Score: 1729.92 bits (4479), Expect = 0.000e+0
Identity = 851/857 (99.30%), Postives = 854/857 (99.65%), Query Frame = 1
Query:  163 AQEVSSLLGVVISYDEFLSKSKYAAKILFPLATAVQMHQVSEIKHPKIRAMCTIRRTSFLYVSDLEDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESLILTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSE 2733
            AQEVSSLLGVVISYDEFLSKSKYA KILFPLATAVQMHQVSEIKHPKIRAMCTIRRTSFLYVSDLEDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESL+LTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYI+ALDLIRDIILATDLAHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIK  +E
Sbjct:   21 AQEVSSLLGVVISYDEFLSKSKYAVKILFPLATAVQMHQVSEIKHPKIRAMCTIRRTSFLYVSDLEDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESLLLTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYIKALDLIRDIILATDLAHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKDQTE 877          

HSP 2 Score: 73.1738 bits (178), Expect = 7.409e-13
Identity = 42/84 (50.00%), Postives = 44/84 (52.38%), Query Frame = 2
Query: 2771 IRDQTENKSHNHCD*Y*KFISISNNRFSLNFHLGTSRFFVLSFALLIIYKFVAVFDFSRDFKRVFYAVGAIGSCSHRVSTNSPI 3022
            I+DQTENKSHNH                                 LI    + VFDFSRDF RVF AVGAIGSCSHRVSTNSPI
Sbjct:  872 IKDQTENKSHNH--------------------------------FLIFILELRVFDFSRDFNRVFCAVGAIGSCSHRVSTNSPI 923          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000021196.1 (SMESG000021196.1)

HSP 1 Score: 1698.72 bits (4398), Expect = 0.000e+0
Identity = 840/857 (98.02%), Postives = 843/857 (98.37%), Query Frame = 1
Query:  163 AQEVSSLLGVVISYDEFLSKSKYAAKILFPLATAVQMHQVSEIKHPKIRAMCTIRRTSFLYVSDLEDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESLILTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKGNSE 2733
            AQEVSSLLGVVISYDEFLSKSKYA KILFPLATAVQMHQVSEIKHPKIRAMCTIRRTSFLYVSDLEDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESL+LTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNE           QPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYI+ALDLIRDIILATDLAHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIK  +E
Sbjct:   21 AQEVSSLLGVVISYDEFLSKSKYAVKILFPLATAVQMHQVSEIKHPKIRAMCTIRRTSFLYVSDLEDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESLLLTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNE-----------QPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYIKALDLIRDIILATDLAHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCINHTIERTRENWSKISQKVASHEIKDQTE 866          

HSP 2 Score: 73.1738 bits (178), Expect = 7.751e-13
Identity = 42/84 (50.00%), Postives = 44/84 (52.38%), Query Frame = 2
Query: 2771 IRDQTENKSHNHCD*Y*KFISISNNRFSLNFHLGTSRFFVLSFALLIIYKFVAVFDFSRDFKRVFYAVGAIGSCSHRVSTNSPI 3022
            I+DQTENKSHNH                                 LI    + VFDFSRDF RVF AVGAIGSCSHRVSTNSPI
Sbjct:  861 IKDQTENKSHNH--------------------------------FLIFILELRVFDFSRDFNRVFCAVGAIGSCSHRVSTNSPI 912          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000051078.1 (SMESG000051078.1)

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 440/889 (49.49%), Postives = 588/889 (66.14%), Query Frame = 1
Query:  181 LLGV--VISYDEFLSKSKYAAKILFPLATAVQMHQVS--EIKHPKIRAMCTIRRTSFLYVSDL----EDLSEIISSGELDILKSNSYDILVIVSVSSSQPKESLILTFF--QKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKIISNQINQ----------------ILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEE-----NGIFDKVLKSKTGINLGCLT--EAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQ-FTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQ-TDCINHTIERTRENWSKISQKVASHEIKGNSEEIF 2742
            LLG+  ++SY+E     K     +FP + +V++  ++  E     IR+   +     +  S L    +D  +   S   D    NS +  +IV + SS+ KE      F  Q+FN+N +   K L   E Q+ +   RL R+  +K  + Q +                 IL LC  L D+D G LQ K++ +L Q    E+ F+L +  + +EL+CQ      Q++ I FD E+     + IF++++K K    L  +   + +L E+  + N      K  + LCVP+ +Q    V A+VC+INK G  Q FT  D  +    F+YT +VL +++A+Q ERRLK+QTE ML VA NIF ++ +L  LL  IM EA+ LT AERCSVFLVD D+ ELV+KVFDGLPT S+++           Q PVEIR P  QG+AG VATTGEMLNI  AY HPLFYRGVD+ETG+KT+NILCFPI+D+  K VGVAQLCNKI G  FT  DE+IAKAFS+YCCISI HSLMYKKV+DAQHR++LANELM+YHMQ+ ED + WL++   P +     DF SF  IPR++K+ D+ +A + MF+ +G IS+WR++R TL++FI M+KR YRDPPYHNW HAFSVAHFI++CI NLPL  QL  +EL ALFVASLCHDIDHRGTNNSFQV S S+LAALYSSEGSVLERHHFSQT+C+LN+EGCN+FE+  +++Y   LDLIRDIILATDLAHHL+I S   KM    YD+  + +H LL+ LLMTSADLSDQ+KNW+NTR+VA+LIY+EFF QGD+EK+IG +PAEQMDRERA VP+LQ++FLDGI  P +++ + L+P     +   I   R+ W K+++ + + +I  N  ++F
Sbjct:   18 LLGLSNIVSYEEIPDAVKTTINRVFPNSNSVRLEWINTRENSTKSIRSNGWMNENKIIPQSSLIINRKDRLQEQYSDYFD--SENSDNFGIIVPLISSEMKEFQAFLSFSCQEFNQNEK---KLLQTFENQVKVMFQRLERLKNSKDSNLQQSNLQDPKLDSSDFYIDSTILSLCADLHDRDPGILQVKIIRFLKQRIHMESAFILTISNNNLELVCQA-----QDEQI-FDPEKRFRVTDSIFERIMKEKICAQLSDVNMFQDKLNELELLTN-----IKWNSFLCVPIINQSDGCVSALVCMINKIGSNQSFTAEDISITQHLFQYTAAVLTSSVAFQMERRLKIQTETMLQVAMNIFRKLGDLTGLLKEIMTEAKKLTNAERCSVFLVDNDTKELVSKVFDGLPTISEQS-----------QHPVEIRIPVTQGVAGRVATTGEMLNIVDAYSHPLFYRGVDEETGYKTRNILCFPIKDENEKVVGVAQLCNKINGPCFTNYDEDIAKAFSVYCCISIMHSLMYKKVQDAQHRNKLANELMIYHMQVNEDTVKWLTSCGYPDLMDIKEDFNSFECIPRDIKEHDSALAVLGMFNTLGFISKWRLSRPTLSRFILMIKRGYRDPPYHNWTHAFSVAHFIYLCITNLPLHGQLLPIELLALFVASLCHDIDHRGTNNSFQVTSKSVLAALYSSEGSVLERHHFSQTICVLNSEGCNIFENFSRQDYHHVLDLIRDIILATDLAHHLRIISDQRKMIDTFYDSNSNHHHVLLMDLLMTSADLSDQSKNWKNTRAVAQLIYEEFFSQGDMEKSIGQKPAEQMDRERACVPSLQMSFLDGIALPCFQLFADLYPLFGQKMIENITNNRKKWEKLNEDIKNGKISANIFQLF 879          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000051078.1 (SMESG000051078.1)

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 441/889 (49.61%), Postives = 590/889 (66.37%), Query Frame = 1
Query:  181 LLGV--VISYDEFLSKSKYAAKILFPLATAVQMHQVS--EIKHPKIRAMCTIRRTSFLYVSDL----EDLSEIISSGELDILKSNSYDILVIVSVSSSQPKE-SLILTF-FQKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKIISNQINQ----------------ILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEE-----NGIFDKVLKSKTGINLGCLT--EAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQ-FTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQ-TDCINHTIERTRENWSKISQKVASHEIKGNSEEIF 2742
            LLG+  ++SY+E     K     +FP + +V++  ++  E     IR+   +     +  S L    +D  +   S   D    NS +  +IV + SS+ KE    L+F  Q+FN+N +   K L   E Q+ +   RL R+  +K  + Q +                 IL LC  L D+D G LQ K++ +L Q    E+ F+L +  + +EL+CQ      Q++ I FD E+     + IF++++K K    L  +   + +L E+  + N      K  + LCVP+ +Q    V A+VC+INK G  Q FT  D  +    F+YT +VL +++A+Q ERRLK+QTE ML VA NIF ++ +L  LL  IM EA+ LT AERCSVFLVD D+ ELV+KVFDGLPT S+++           Q PVEIR P  QG+AG VATTGEMLNI  AY HPLFYRGVD+ETG+KT+NILCFPI+D+  K VGVAQLCNKI G  FT  DE+IAKAFS+YCCISI HSLMYKKV+DAQHR++LANELM+YHMQ+ ED + WL++   P +     DF SF  IPR++K+ D+ +A + MF+ +G IS+WR++R TL++FI M+KR YRDPPYHNW HAFSVAHFI++CI NLPL  QL  +EL ALFVASLCHDIDHRGTNNSFQV S S+LAALYSSEGSVLERHHFSQT+C+LN+EGCN+FE+  +++Y   LDLIRDIILATDLAHHL+I S   KM    YD+  + +H LL+ LLMTSADLSDQ+KNW+NTR+VA+LIY+EFF QGD+EK+IG +PAEQMDRERA VP+LQ++FLDGI  P +++ + L+P     +   I   R+ W K+++ + + +I  N  ++F
Sbjct:   26 LLGLSNIVSYEEIPDAVKTTINRVFPNSNSVRLEWINTRENSTKSIRSNGWMNENKIIPQSSLIINRKDRLQEQYSDYFD--SENSDNFGIIVPLISSEMKEFQAFLSFSCQEFNQNEK---KLLQTFENQVKVMFQRLERLKNSKDSNLQQSNLQDPKLDSSDFYIDSTILSLCADLHDRDPGILQVKIIRFLKQRIHMESAFILTISNNNLELVCQA-----QDEQI-FDPEKRFRVTDSIFERIMKEKICAQLSDVNMFQDKLNELELLTN-----IKWNSFLCVPIINQSDGCVSALVCMINKIGSNQSFTAEDISITQHLFQYTAAVLTSSVAFQMERRLKIQTETMLQVAMNIFRKLGDLTGLLKEIMTEAKKLTNAERCSVFLVDNDTKELVSKVFDGLPTISEQS-----------QHPVEIRIPVTQGVAGRVATTGEMLNIVDAYSHPLFYRGVDEETGYKTRNILCFPIKDENEKVVGVAQLCNKINGPCFTNYDEDIAKAFSVYCCISIMHSLMYKKVQDAQHRNKLANELMIYHMQVNEDTVKWLTSCGYPDLMDIKEDFNSFECIPRDIKEHDSALAVLGMFNTLGFISKWRLSRPTLSRFILMIKRGYRDPPYHNWTHAFSVAHFIYLCITNLPLHGQLLPIELLALFVASLCHDIDHRGTNNSFQVTSKSVLAALYSSEGSVLERHHFSQTICVLNSEGCNIFENFSRQDYHHVLDLIRDIILATDLAHHLRIISDQRKMIDTFYDSNSNHHHVLLMDLLMTSADLSDQSKNWKNTRAVAQLIYEEFFSQGDMEKSIGQKPAEQMDRERACVPSLQMSFLDGIALPCFQLFADLYPLFGQKMIENITNNRKKWEKLNEDIKNGKISANIFQLF 887          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000075722.1 (SMESG000075722.1)

HSP 1 Score: 750.74 bits (1937), Expect = 0.000e+0
Identity = 402/778 (51.67%), Postives = 535/778 (68.77%), Query Frame = 1
Query:  472 LTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKI--------ISNQI-NQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMN-----ASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNER--LRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYXXXXXXXXXXXXXXXXXHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQT-DCINHTIERTRENWSKISQKVASHEIKGNSEEIFRNKL 2754
            LTF+   N+     +K LD LEKQ+ +   RL  ++ + +        ISN+  N IL LCG LFD+D   LQ K++++L      +TGF+L+V  +  E  CQVI   I    +  +   N I + ++K        C+ + +  EI   +       S    K  + L +P+     N ++AIV L++K     F + D ++I   F++T  VL +++AY  E++ K+QTE ML VA NIF ++DNL  LL  IM EA+ LT AERCSVFL++E++NELV+KVFDGLPT S+ +        +G E +QP EIR   +QGIAG VATTGE+LNI  AY HPLFYRGVD+ TG++T+NILCFPI+D+  K VGVAQLCNK+ G  FT  DE++AKAFS+YCCISI HSLMYK V++AQHR++LANELM YHMQI E++  WLST  IP VS+FL DF SF+SIPR + + ++++A +SMF  +  ISRWRI R  L +FI MVKR YRDPPYHNW HA SVAHF ++C KNL L  QL ELE+F+ FVA LCHDIDHRGTNNSFQV SNS+LAALYSSEGSVLERHHF+QT+CILN+EG N+FE+L ++EY +ALDLIRDIILATDLAHH +I ++  +M + GYD  + ++  LLL LLMT ADLSDQ K+W N R+VA LIY+EFF QGDLEKAIG +PAEQMDRERA +P+LQI+FLDG+  P ++  + L+ Q  + +   ++  R+ W K++  +   +I  N  ++F+  +
Sbjct:  130 LTFY--CNQWDSKSTKTLDHLEKQIKIMFQRLTVMNGSLMSPSISSAEISNETRNAILTLCGELFDRDPCVLQMKIINFLKGMIHVKTGFILIVSTEISEFGCQVIDSTIVNPELRCEIR-NSIIESIVKE------NCVKKVKSSEIQNKLGDLKVLQSLTGFKWDSLLLIPILSSLNNSLVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLISSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDM 898          
The following BLAST results are available for this feature:
BLAST of Phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE2A0.000e+051.11phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE2A0.000e+051.54phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE2A0.000e+051.54phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE2A0.000e+051.11phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE2A0.000e+051.11phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde-28.954e-9736.07Probable 3',5'-cyclic phosphodiesterase pde-2 [So... [more]
pde-29.160e-9736.07Probable 3',5'-cyclic phosphodiesterase pde-2 [So... [more]
pde-52.305e-9034.67Probable 3',5'-cyclic phosphodiesterase pde-5 [So... [more]
pde-41.838e-2829.90Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
pde-43.096e-2829.90Probable 3',5'-cyclic phosphodiesterase pde-4 [So... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde112.259e-9133.89gene:FBgn0085370 transcript:FBtr0303163[more]
Pde112.910e-9133.89gene:FBgn0085370 transcript:FBtr0303162[more]
Pde118.685e-9033.89gene:FBgn0085370 transcript:FBtr0343831[more]
Pde118.685e-9033.89gene:FBgn0085370 transcript:FBtr0112545[more]
Pde119.129e-9033.89gene:FBgn0085370 transcript:FBtr0112544[more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde11a1.504e-8631.55phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
pde10a6.163e-8635.23phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pde10a2.344e-8535.00phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pde10a9.167e-8535.00phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pde11al2.646e-8231.73phosphodiesterase 11a, like [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde2a2.846e-10547.61phosphodiesterase 2A [Source:NCBI gene;Acc:780063][more]
pde2a6.864e-10046.92phosphodiesterase 2A [Source:NCBI gene;Acc:780063][more]
PDE10A2.647e-8834.66phosphodiesterase 10A [Source:NCBI gene;Acc:100485... [more]
ENSXETT00000053056.12.525e-8631.16phosphodiesterase 11A [Source:NCBI gene;Acc:100379... [more]
PDE10A8.991e-8434.99phosphodiesterase 10A [Source:NCBI gene;Acc:100485... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm458370.000e+051.17predicted gene 45837 [Source:MGI Symbol;Acc:MGI:58... [more]
Pde2a0.000e+051.17phosphodiesterase 2A, cGMP-stimulated [Source:MGI ... [more]
Pde2a0.000e+051.17phosphodiesterase 2A, cGMP-stimulated [Source:MGI ... [more]
Pde2a0.000e+051.17phosphodiesterase 2A, cGMP-stimulated [Source:MGI ... [more]
Pde2a0.000e+050.89phosphodiesterase 2A, cGMP-stimulated [Source:MGI ... [more]
back to top
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P14099|PDE2A_BOVIN0.000e+052.25cGMP-dependent 3',5'-cyclic phosphodiesterase OS=B... [more]
sp|O00408|PDE2A_HUMAN0.000e+051.11cGMP-dependent 3',5'-cyclic phosphodiesterase OS=H... [more]
sp|Q01062|PDE2A_RAT0.000e+051.63cGMP-dependent 3',5'-cyclic phosphodiesterase OS=R... [more]
sp|Q922S4|PDE2A_MOUSE0.000e+050.89cGMP-dependent 3',5'-cyclic phosphodiesterase OS=M... [more]
sp|P30645|PDE2_CAEEL1.165e-9536.07Probable 3',5'-cyclic phosphodiesterase pde-2 OS=C... [more]
back to top
BLAST of Phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KMK50.000e+049.73Phosphodiesterase OS=Schistosoma mansoni OX=6183 P... [more]
A0A4Z2CV850.000e+050.27Phosphodiesterase OS=Schistosoma japonicum OX=6182... [more]
A0A5K4ENT00.000e+057.32Phosphodiesterase OS=Schistosoma mansoni OX=6183 P... [more]
A0A094ZED40.000e+049.73Phosphodiesterase OS=Schistosoma haematobium OX=61... [more]
A0A4Z2CVF20.000e+050.23Phosphodiesterase OS=Schistosoma japonicum OX=6182... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde11a1.749e-9031.89phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
pde10a2.377e-8434.40phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pde11a2.659e-8330.77phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
pde11al2.043e-8230.76dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 1... [more]
pde11al4.655e-8132.17dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 1... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE2A0.000e+053.12phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE2A9.399e-14957.14phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
pde5ab5.021e-6830.43phosphodiesterase 5A, cGMP-specific, b [Source:ZFI... [more]
pde10a1.057e-3529.64phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pde1a2.270e-2832.80phosphodiesterase 1A, calmodulin-dependent [Source... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO386441.420e-15149.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395221.554e-10936.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446263.965e-10136.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320888.101e-8734.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436571.271e-7331.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde11a3.950e-8631.23phosphodiesterase 11A [Source:NCBI gene;Acc:101163... [more]
pde10a1.601e-8533.17phosphodiesterase 10A [Source:NCBI gene;Acc:101162... [more]
pde10a1.666e-8533.28phosphodiesterase 10A [Source:NCBI gene;Acc:101162... [more]
pde10a2.355e-8533.28phosphodiesterase 10A [Source:NCBI gene;Acc:101162... [more]
pde5ab2.237e-7132.52phosphodiesterase 5A [Source:NCBI gene;Acc:1011732... [more]
back to top
BLAST of Phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021196.17.409e-1399.30SMESG000021196.1[more]
SMESG000021196.17.751e-1398.02SMESG000021196.1[more]
SMESG000051078.10.000e+049.49SMESG000051078.1[more]
SMESG000051078.10.000e+049.61SMESG000051078.1[more]
SMESG000075722.10.000e+051.67SMESG000075722.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008671 ID=SMED30008671|Name=Phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=3096bp
GATGCTATAAAGCGCGTTAATTTTAAATTTAATCTCAGTCTTCATTAAAT
TTTCTTTCAGAATTCAAAGAAGACTTTAAAAGTCCCGATAATATCCTCTC
TTATGTCACTTAAAAAATCTTTAAAAAATAATAGTAATAAAGATGATGAC
TTTTCTTCTAAAGCTCAGGAAGTTTCTTCTCTGTTAGGAGTTGTGATAAG
CTATGACGAATTTTTATCGAAATCAAAGTATGCTGCGAAGATTCTCTTTC
CACTTGCAACAGCCGTACAAATGCACCAAGTATCAGAAATTAAACATCCG
AAAATTCGAGCAATGTGTACAATCAGACGGACAAGTTTTCTATATGTCTC
TGATTTGGAAGATCTGAGCGAGATTATTTCATCAGGAGAACTGGACATAT
TGAAATCTAACAGTTATGATATCTTGGTCATAGTGTCGGTTTCGTCCAGC
CAGCCAAAGGAAAGCCTAATATTAACTTTTTTTCAAAAATTCAATGAAAA
TTCTGAAAATCGGTCTAAAAGATTGGATTTCCTGGAGAAACAAATGTCTT
TGACACTATCGAGACTGATGAGAATTCATCCAAACAAAATAATTTCCAAT
CAAATAAATCAAATACTAGAATTGTGTGGTTCATTATTTGATCAGGATGC
GGGCAAACTACAAAAGAAAGTTCTCAGTTATCTCATTCAAAATACATCAG
CCGAAACAGGCTTCTTATTGCTTGTTTGTATGGATACAGTTGAATTGTTG
TGTCAGGTTATCGGTCAAGTCATTCAAGAAGATCCAATTAACTTTGATGC
TGAAGAAAATGGAATATTTGATAAGGTTTTGAAATCGAAGACTGGCATTA
ATTTGGGTTGTTTAACCGAGGCACAACTACGAGAAATTTCAGAAATAATG
AATGCCAGTAAACAAGAAACCAAAATACAAAACGCTCTGTGCGTTCCAGT
GCGTCATCAGGGTACCAATGACGTGATTGCTATTGTTTGCCTGATCAACA
AATCTGGGCCAGCTCAATTCACAAATTACGATGAACAAGTCATTAATGAA
TGTTTCAAGTACACCACCTCGGTTCTTTTCACAACAATCGCTTATCAAAA
CGAACGCCGGCTGAAACTACAGACTGAAAAAATGCTAGTAGTAGCCAAAA
ATATCTTTAGTCGCATGGATAACCTGAATGAGCTTCTTCTTATGATAATG
CAAGAAGCGCGCAATCTCACTCAAGCTGAACGATGTTCAGTGTTTCTCGT
TGATGAAGACTCGAATGAACTCGTCGCCAAGGTCTTCGACGGATTACCGA
CTTCAAGCGACAAGAACGAGCGGCTCCGTCTCCAAGATGGGACTGAAATT
CAGCAGCCAGTTGAAATCCGATTCCCTAAGGCTCAAGGAATAGCAGGCCA
CGTAGCAACGACGGGAGAAATGCTTAACATTAAAAAAGCGTATGATCATC
CGCTTTTCTATCGAGGTGTAGACGACGAAACCGGATTTAAGACTAAAAAC
ATTCTCTGCTTTCCAATTCAAGATGATTGTGGTAAAACAGTGGGTGTCGC
TCAACTGTGTAATAAGATCAAAGGGCATTTCTTTACTAAAATGGACGAAG
AAATAGCGAAAGCCTTTTCAATTTATTGTTGTATTAGCATTACCCACTCA
CTGATGTATAAGAAAGTTGAAGACGCTCAGCACCGAAGTCGACTTGCCAA
TGAATTGATGATGTATCATATGCAGATTCCTGAAGATGATATTGCTTGGC
TATCAACATTCTCCATACCGCCCGTTTCTATTTTTCTCAGTGATTTTGAA
TCATTTAATTCCATTCCCAGAAATGTTAAAGACCGAGATACTCTGATGGC
ATGTATAAGTATGTTCGATGGTATTGGTCTGATTTCCCGTTGGAGAATCA
ACAGGCGCACTTTGACGAAATTTATTTTTATGGTCAAGCGAAATTATCGC
GATCCGCCATATCACAATTGGATGCACGCATTCTCTGTTGCTCATTTCAT
ATTTATTTGTATCAAAAATTTACCTTTAGATAAACAACTTACTGAATTAG
AATTGTTTGCGTTATTTGTTGCGTCACTTTGTCATGACATTGATCATAGA
GGAACGAATAATTCTTTTCAAGTTCAATCTAATTCTATTTTGGCCGCGTT
ATATAGTTCCGAAGGCTCGGTTTTAGAGCGGCATCATTTCTCTCAGACGG
TTTGTATTTTGAATACCGAAGGGTGTAATGTATTTGAATCTCTTCCTCAG
AAGGAATATATAAGGGCTTTGGATCTGATAAGAGACATAATTCTTGCGAC
AGATTTGGCCCATCATCTGCAGATATTTTCGAAAATCGAAAAGATGGCTC
AACAGGGATATGATAACCTTGACAGTGAAAATCATAATCTTTTACTTTGT
CTGTTGATGACTTCGGCCGATTTAAGTGATCAAACTAAAAACTGGAGAAA
TACTCGCTCAGTTGCCGAACTTATTTATAAAGAATTCTTTAGGCAGGGTG
ATTTAGAAAAAGCCATAGGTAATCAACCCGCGGAACAAATGGATCGTGAA
AGGGCAGTTGTTCCTAATTTGCAGATTGCATTTCTCGATGGAATAGTGTC
CCCTCTTTATCGAGTTTTATCTCTCCTTCATCCTCAAACCGACTGCATCA
ATCATACAATTGAAAGAACTAGAGAAAATTGGAGTAAAATCAGCCAGAAA
GTTGCAAGCCATGAAATCAAAGGTAACAGCGAAGAAATATTCAGAAATAA
ACTCGTTGAGGATGATTTTGATTAGAGATCAAACGGAAAACAAATCTCAC
AATCATTGTGATTAATATTGAAAGTTTATATCGATATCTAACAATAGATT
TAGTCTTAATTTTCATCTTGGAACTTCGAGGTTCTTTGTTTTGAGCTTTG
CATTATTGATAATTTACAAATTTGTGGCAGTCTTTGATTTTTCAAGGGAT
TTTAAGCGGGTTTTCTATGCTGTTGGTGCCATCGGATCGTGTTCACATCG
AGTTTCTACGAATTCTCCAATTTAGCATGGATTTGATTAGATATTTGGCC
TATCGCAAAAATGGCGATTCACCGTTTTTAATCCTTTGCATAAATC
back to top

protein sequence of SMED30008671-orf-1

>SMED30008671-orf-1 ID=SMED30008671-orf-1|Name=SMED30008671-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=891bp
MSLKKSLKNNSNKDDDFSSKAQEVSSLLGVVISYDEFLSKSKYAAKILFP
LATAVQMHQVSEIKHPKIRAMCTIRRTSFLYVSDLEDLSEIISSGELDIL
KSNSYDILVIVSVSSSQPKESLILTFFQKFNENSENRSKRLDFLEKQMSL
TLSRLMRIHPNKIISNQINQILELCGSLFDQDAGKLQKKVLSYLIQNTSA
ETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGIN
LGCLTEAQLREISEIMNASKQETKIQNALCVPVRHQGTNDVIAIVCLINK
SGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKN
IFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPT
SSDKNERLRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHP
LFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEE
IAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWL
STFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRIN
RRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELE
LFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTV
CILNTEGCNVFESLPQKEYIRALDLIRDIILATDLAHHLQIFSKIEKMAQ
QGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGD
LEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQTDCIN
HTIERTRENWSKISQKVASHEIKGNSEEIFRNKLVEDDFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036971PDEase_catalytic_dom_sf
IPR023088PDEase
IPR003018GAF
IPR003607HD/PDEase_dom
IPR002073PDEase_catalytic_dom
IPR029016GAF-like_dom_sf
IPR023174PDEase_CS
Vocabulary: molecular function
TermDefinition
GO:0008081phosphoric diester hydrolase activity
GO:0005515protein binding
GO:00041143',5'-cyclic-nucleotide phosphodiesterase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 355..375
NoneNo IPR availablePANTHERPTHR11347CYCLIC NUCLEOTIDE PHOSPHODIESTERASEcoord: 159..316
NoneNo IPR availablePANTHERPTHR11347:SF102PHOSPHODIESTERASEcoord: 159..316
NoneNo IPR availablePANTHERPTHR11347CYCLIC NUCLEOTIDE PHOSPHODIESTERASEcoord: 317..877
NoneNo IPR availablePANTHERPTHR11347:SF102PHOSPHODIESTERASEcoord: 317..877
NoneNo IPR availableSUPERFAMILYSSF55781GAF domain-likecoord: 351..540
NoneNo IPR availableSUPERFAMILYSSF109604HD-domain/PDEase-likecoord: 564..872
NoneNo IPR availableSUPERFAMILYSSF55781GAF domain-likecoord: 167..352
IPR0230883'5'-cyclic nucleotide phosphodiesterasePRINTSPR00387PDIESTERASE1coord: 647..660
score: 43.14
coord: 661..676
score: 60.0
coord: 689..705
score: 45.65
coord: 616..629
score: 55.86
coord: 769..782
score: 49.57
coord: 786..802
score: 53.88
IPR003607HD/PDEase domainSMARTSM00471hd_13coord: 618..787
e-value: 2.8E-7
score: 40.2
IPR003607HD/PDEase domainCDDcd00077HDccoord: 620..796
e-value: 7.80864E-19
score: 82.002
IPR003018GAF domainSMARTSM00065gaf_1coord: 182..335
e-value: 0.001
score: 28.4
coord: 357..523
e-value: 3.1E-32
score: 123.1
IPR003018GAF domainPFAMPF01590GAFcoord: 357..508
e-value: 5.4E-13
score: 49.7
coord: 190..314
e-value: 3.9E-5
score: 24.3
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPFAMPF00233PDEase_Icoord: 620..851
e-value: 2.1E-74
score: 250.3
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPROSITEPS51845PDEASE_I_2coord: 523..867
score: 108.856
IPR029016GAF-like domain superfamilyGENE3DG3DSA:3.30.450.40coord: 159..334
e-value: 4.1E-27
score: 96.7
IPR029016GAF-like domain superfamilyGENE3DG3DSA:3.30.450.40coord: 335..515
e-value: 3.0E-53
score: 181.6
IPR0369713'5'-cyclic nucleotide phosphodiesterase, catalytic domain superfamilyGENE3DG3DSA:1.10.1300.10coord: 542..883
e-value: 2.5E-113
score: 380.3
IPR0231743'5'-cyclic nucleotide phosphodiesterase, conserved sitePROSITEPS00126PDEASE_I_1coord: 661..672