Tigger transposable element-derived protein 1

Overview
NameTigger transposable element-derived protein 1
Smed IDSMED30008652
Length (bp)808
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tigger transposable element-derived protein 1 (SMED30008652) t-SNE clustered cells

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30008652) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008652

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008652SMESG000041850.1 Contig1223newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008652SMESG000041850.1 Contig1223uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: TIGD1 (tigger transposable element derived 1 [Source:HGNC Symbol;Acc:HGNC:14523])

HSP 1 Score: 102.449 bits (254), Expect = 4.823e-24
Identity = 63/156 (40.38%), Postives = 81/156 (51.92%), Query Frame = 1
Query:  118 FKIKPLLIYHSENPSATKGFSK-----V*NLNNHCL*FG*QTEKPG*LLYCFRFYPVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESK------QCSIKEFWKKITI 552
            FK+KP+LIYHSENP A K ++K     +   N+        T       +   F P V  YC    + FK LL+IDNAP HP  L  +++Y  + VI    +  SILQPMDQGVI TFK+Y  R T    L  ++S       Q  +K FWK  TI
Sbjct:  231 FKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKAR----MTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRAL--MEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKGFTI 380          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 56.9954 bits (136), Expect = 1.155e-8
Identity = 40/105 (38.10%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  262 FYPVVNLYCE*NNLKFKALLIIDNAPGHPH-NLAK------LQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRIT-LKNLLETVESKQCSIKEFWKKITI 552
            F P V  Y     L+ KA+L++DN+P HP+ N+ +         YLP       P+  S++QP DQGVI T K  N+R   L+N LE    +   +K FWKK+T+
Sbjct:  270 FVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLP-------PNVASLIQPSDQGVIATMK-RNYRAGLLQNNLE----EGNDLKSFWKKLTL 362          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrkl (Jrk-like [Source:MGI Symbol;Acc:MGI:1924782])

HSP 1 Score: 52.373 bits (124), Expect = 2.709e-7
Identity = 38/106 (35.85%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  262 FYPVVNLYCE*NNLKFKALLIIDNAPGHPH-NLAK------LQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITL--KNLLETVESKQCSIKEFWKKITI 552
            F P V  Y     L+ KA+L++DN+P HP+ N+ +         YLP       P+  S++QP+ QGVI   K  N+R  L   NL E  +     +K FWKK+T+
Sbjct:  270 FVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLP-------PNVASLIQPLGQGVIAAMK-RNYRAGLLHNNLEEGND-----LKSFWKKLTL 362          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.316e-23
Identity = 63/156 (40.38%), Postives = 81/156 (51.92%), Query Frame = 1
Query:  118 FKIKPLLIYHSENPSATKGFSK-----V*NLNNHCL*FG*QTEKPG*LLYCFRFYPVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESK------QCSIKEFWKKITI 552
            FK+KP+LIYHSENP A K ++K     +   N+        T       +   F P V  YC    + FK LL+IDNAP HP  L  +++Y  + VI    +  SILQPMDQGVI TFK+Y  R T    L  ++S       Q  +K FWK  TI
Sbjct:  231 FKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKAR----MTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRAL--MEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKGFTI 380          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y4A0|JERKL_HUMAN (Jerky protein homolog-like OS=Homo sapiens OX=9606 GN=JRKL PE=2 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 5.546e-8
Identity = 40/105 (38.10%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  262 FYPVVNLYCE*NNLKFKALLIIDNAPGHPH-NLAK------LQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRIT-LKNLLETVESKQCSIKEFWKKITI 552
            F P V  Y     L+ KA+L++DN+P HP+ N+ +         YLP       P+  S++QP DQGVI T K  N+R   L+N LE    +   +K FWKK+T+
Sbjct:  270 FVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLP-------PNVASLIQPSDQGVIATMK-RNYRAGLLQNNLE----EGNDLKSFWKKLTL 362          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|B2RRL2|JERKL_MOUSE (Jerky protein homolog-like OS=Mus musculus OX=10090 GN=Jrkl PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 1.418e-6
Identity = 38/106 (35.85%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  262 FYPVVNLYCE*NNLKFKALLIIDNAPGHPH-NLAK------LQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITL--KNLLETVESKQCSIKEFWKKITI 552
            F P V  Y     L+ KA+L++DN+P HP+ N+ +         YLP       P+  S++QP+ QGVI   K  N+R  L   NL E  +     +K FWKK+T+
Sbjct:  270 FVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLP-------PNVASLIQPLGQGVIAAMK-RNYRAGLLHNNLEEGND-----LKSFWKKLTL 362          

HSP 2 Score: 21.1718 bits (43), Expect = 1.418e-6
Identity = 7/20 (35.00%), Postives = 13/20 (65.00%), Query Frame = 3
Query:  201 SLPVIWMTNRKAWMTAILFQ 260
            +LPV + + + AWM   +F+
Sbjct:  244 NLPVSYFSQKGAWMDLSIFR 263          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A3Q0HKR4 (centrosomal protein of 89 kDa isoform X2 OS=Alligator sinensis OX=38654 GN=CEP89 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 6.765e-29
Identity = 63/152 (41.45%), Postives = 80/152 (52.63%), Query Frame = 1
Query:  118 FKIKPLLIYHSENPSATKGFSKV*NLNNHCL*FG*QTEKPG*LLYCFR------FYPVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESKQC-SIKEFWKKITI 552
            FK+KPLL+YHSENP A KG+     L +         +K    +  F+      F P V  YC  NNL  KALLI+DNAPGHP  L  L     V+V+    +   I+QPMDQGVI  FKAY  R T    +   + +   ++KEFWK   I
Sbjct:  401 FKLKPLLVYHSENPRALKGY-----LKSSLPVIWKSNKKAWVTISVFQSWFRDYFCPAVEKYCAENNLSHKALLILDNAPGHPTTLDDLSDN--VKVVFLPRNTTCIIQPMDQGVIAAFKAYYIRKTFAQAVRATDGEGAPTLKEFWKGYNI 545          

HSP 2 Score: 55.0694 bits (131), Expect = 6.765e-29
Identity = 34/87 (39.08%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  540 KNYNIMNAI--ISTSWIEMKSSCLQNCLNRLLIKASKNELVNDAPHVVTE--ITEIANQIGFDEVDEEYVQELIQNDQHDLSNEDLI 788
            K YNI  AI  IS++W E+ S  +     +L     ++    + P V     I E+  +IGFDE++ E VQELI  ++ +LSNEDLI
Sbjct:  541 KGYNIRKAIDNISSAWDEVASKTMNGVWRKLWADCVQDSQEFEEPVVTIRDNIVELGRKIGFDELEPEDVQELIDFNREELSNEDLI 627          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A401T1F0 (HTH CENPB-type domain-containing protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0014986 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 6.616e-27
Identity = 61/152 (40.13%), Postives = 77/152 (50.66%), Query Frame = 1
Query:  118 FKIKPLLIYHSENPSATKGFSK----V*NLNNHCL*FG*QTEKPG*LLYCFRFY--PVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLL-ETVESKQCSIKEFWKKITI 552
            FK KPL++Y SE P A +G SK    +   N      G   ++       F  Y  P    YC   NL FK LL++DN PGHP NL  L     V+VI   P+  S+LQPM QG + TFKAY  R T   L+ ET      S++EFW+   I
Sbjct:  565 FKFKPLVVYQSETPRALRGHSKEHPVIWRSNKKAWMTGALFQE------WFSVYAIPAWREYCARENLSFKILLLLDNCPGHPINLDDLSE--NVKVIFLPPNTASLLQPMVQGAVATFKAYYLRRTFSQLIYETDGENAPSVREFWRGYNI 708          

HSP 2 Score: 58.9214 bits (141), Expect = 6.616e-27
Identity = 34/87 (39.08%), Postives = 51/87 (58.62%), Query Frame = 3
Query:  540 KNYNIMNAI--ISTSWIEMKSSCLQNCLNRLLIK--ASKNELVNDAPHVVTEITEIANQIGFDEVDEEYVQELIQNDQHDLSNEDLI 788
            + YNI+  I  I+ SW E+ SSCL +   +L  +  + K    +  P +  EI  +A  +GFDEVDE  V EL+++   +LSNEDL+
Sbjct:  704 RGYNILEGINNIADSWNEVTSSCLNSVWRKLWPECVSDKGGSPDTVPEIQREIIALARAVGFDEVDETDVVELLESHGEELSNEDLM 790          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: G3W5F6 (HTH CENPB-type domain-containing protein OS=Sarcophilus harrisii OX=9305 GN=LOC105749117 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.938e-26
Identity = 62/151 (41.06%), Postives = 86/151 (56.95%), Query Frame = 1
Query:  118 FKIKPLLIYHSENPSATKGFSK-----V*NLNNHCL*FG*QTEKPG*LLYCFRFYPVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESK-QCSIKEFWKKITI 552
            FK+KPLL+YHSENP A KG+SK     +   N         T       +   F P V  YC  NNL  KALLI++NAPGHP NL+ L   + VE ++   +  + +QPM QGVI TFKA+  R T ++LL   + + + +++EFW+   I
Sbjct:  133 FKLKPLLVYHSENPQAMKGYSKPNLPVIWRSNKKAWI----TRSIFHEWFTHFFCPAVEKYCAQNNLANKALLILENAPGHPVNLSDLSDNVRVEYLVE--NKANPMQPMGQGVISTFKAHYLRKTFQHLLGGTDGEDRSTVREFWRNYNI 277          

HSP 2 Score: 45.8246 bits (107), Expect = 1.938e-26
Identity = 28/88 (31.82%), Postives = 51/88 (57.95%), Query Frame = 3
Query:  540 KNYNIMNAI--ISTSWIEMKSSCLQNCLNRLL---IKASKNELVNDAPHVVTEITEIANQIGFDEVDEEYVQELIQNDQHDLSNEDLI 788
            +NYNIMNA+  I+ +W E++ S + +   ++    + A     + +   +  +I  +AN IGF E+ E  V +L+Q+   +LSNE+L+
Sbjct:  273 RNYNIMNAVDNIAEAWDELEPSLMNSVWKKIWPECVHAHDVSQIENITQIQQDILALANDIGFAELVEADVDQLLQSHDEELSNEELM 360          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A4X2M0F7 (Uncharacterized protein OS=Vombatus ursinus OX=29139 GN=CENPBD1 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 4.550e-26
Identity = 60/151 (39.74%), Postives = 85/151 (56.29%), Query Frame = 1
Query:  118 FKIKPLLIYHSENPSATKGFSK-----V*NLNNHCL*FG*QTEKPG*LLYCFRFYPVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESK-QCSIKEFWKKITI 552
            FK+KPLL+YHSENP A KG+SK     +   N         T       + + F P V  YC  NNL  KALLI++NAP HP NL+ L   + VE ++   +    +QPM QGVI TFKA+  R T ++L+   + + + +++EFW+   I
Sbjct:  243 FKLKPLLVYHSENPKAMKGYSKPNLPVIWRSNKKAW----VTRSIFHEWFTYFFCPAVEKYCAQNNLANKALLILENAPCHPVNLSDLSDNVRVEYLIE--NKADPIQPMGQGVISTFKAHYLRKTFQHLIGGADGEDKGTVREFWRNYNI 387          

HSP 2 Score: 49.2914 bits (116), Expect = 4.550e-26
Identity = 28/87 (32.18%), Postives = 50/87 (57.47%), Query Frame = 3
Query:  540 KNYNIMNAI--ISTSWIEMKSSCLQNCLNRLL---IKASKNELVNDAPHVVTEITEIANQIGFDEVDEEYVQELIQNDQHDLSNEDL 785
            +NYNIMNA+  I+ +W E++ S + +   ++    + A  +  +     +  ++  +AN IGF E+ E  V +L+Q+   DLSNE+L
Sbjct:  383 RNYNIMNAVDNIAEAWDELEPSLMNSVWKKIWPECVHARDDSQIETVTQIQQDVVALANDIGFGELVEADVGQLLQSHDEDLSNEEL 469          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A2Y9DNC6 (CENPB DNA-binding domain-containing protein 1 OS=Trichechus manatus latirostris OX=127582 GN=LOC101351415 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.038e-25
Identity = 63/151 (41.72%), Postives = 88/151 (58.28%), Query Frame = 1
Query:  118 FKIKPLLIYHSENPSATKGFSK-----V*NLNNHCL*FG*QTEKPG*LLYCFRFYPVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESK-QCSIKEFWKKITI 552
            FK+KPLL+YHSENPSA KG+SK     +   N         T+      + + F P V  YC  N+L  KALLI+D+AP HP NL+ L   + VE +    S   I+QPM QGV  TFKA+  + T ++LLET + + + +++EFW+   I
Sbjct:  236 FKLKPLLVYHSENPSALKGYSKPNLPVIWRSNKKAW----ATKGIFHEWFTYFFCPAVEKYCAQNDLTNKALLILDSAPCHPVNLSDLSDNVRVEYLHD--STADIVQPMSQGVASTFKAHYLKRTFEHLLETTDGEDKATVREFWRNYDI 380          

HSP 2 Score: 41.2022 bits (95), Expect = 1.038e-25
Identity = 24/88 (27.27%), Postives = 51/88 (57.95%), Query Frame = 3
Query:  540 KNYNIMNAI--ISTSWIEMKSSCLQNCLNRLLIKASKNELVNDAPHVVT---EITEIANQIGFDEVDEEYVQELIQNDQHDLSNEDLI 788
            +NY+IM+A+  I+ +W E+K + + +   ++  +  + +  +   ++      I  +A  + F+EV E  V +L+Q+ + DLSNE+L+
Sbjct:  376 RNYDIMDAVDNIAVAWEELKPATMNSVWKKIWPECVQFQSFSQTDNITRLQQNIVTLAKNVTFEEVVEADVGQLLQSHEEDLSNEELM 463          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003106.1 (pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 gene:ENSPMAG00000002845.1 transcript:ENSPMAT00000003106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 5.590e-22
Identity = 42/103 (40.78%), Postives = 62/103 (60.19%), Query Frame = 1
Query:  256 FRFY--PVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLP-VEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESKQC-SIKEFWKKITI 552
            FR Y  P V  YC  NNL FKA+L++DNAP HP     ++ + P ++V+   P+  ++LQPMDQGV+ +FKAY  R T    +   + +   ++ EFWK  +I
Sbjct:  216 FRVYFVPAVKEYCRTNNLAFKAILVLDNAPCHP---VSVEGFDPNIKVVFLTPNTTALLQPMDQGVMSSFKAYYLRQTFAQAISATDKEGGPTLTEFWKGFSI 315          

HSP 2 Score: 38.1206 bits (87), Expect = 5.590e-22
Identity = 30/87 (34.48%), Postives = 46/87 (52.87%), Query Frame = 3
Query:  540 KNYNIMNAI--ISTSWIEMKSSCLQNCLNRLLIKASKN--ELVNDAPHVVTEITEIANQIGFDEVDEEYVQELIQNDQHDLSNEDLI 788
            K ++I++A+  I+ SW EMK S L     +L  +   N     +    V   + E+A Q+   EV  E V EL+ +  H+LSNEDL+
Sbjct:  311 KGFSILDAVKNIAASWKEMKQSNLNGVWRKLCPEFVSNFQGFTDTVEEVTENVVEMAGQLQL-EVAPEDVGELLASHAHELSNEDLL 396          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005921.1 (pep scaffold:Pmarinus_7.0:GL487978:976:2666:1 gene:ENSPMAG00000005352.1 transcript:ENSPMAT00000005921.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 1.349e-21
Identity = 43/95 (45.26%), Postives = 55/95 (57.89%), Query Frame = 1
Query:  262 FYPVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLP-VEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESKQC-SIKEFWK 540
            F P V  YC    + FK LL+IDNAP HP   A L  + P ++V+   P+A S+LQPMDQGV    KAY  R TL   LE  E     +++EFW+
Sbjct:  227 FIPDVEKYCRDEGIPFKILLVIDNAPSHP---AHLDDFHPNIKVVFLPPNATSVLQPMDQGVNAKCKAYYLRRTLAQALEATEGDTGKTVREFWE 318          

HSP 2 Score: 34.2686 bits (77), Expect = 1.349e-21
Identity = 26/92 (28.26%), Postives = 45/92 (48.91%), Query Frame = 3
Query:  546 YNIMNAI--ISTSWIEMKSSCLQNCLNRLLIK--------ASKNELVNDAPH--VVTEITEIANQIGFDEVDEEYVQELIQNDQHDLSNEDL 785
            Y++  A+  I+ +W E+  +CL     ++  +         ++    ND  H  V   I  +A ++   EVD   V+ELI++   +LSNEDL
Sbjct:  320 YDVYQAVQNIAKAWAEVTQTCLNGAWEKMCPQLAAAAAAVHARRGPQNDETHAEVAQSIVTLAAELRL-EVDAADVEELIESHGAELSNEDL 410          

HSP 3 Score: 25.7942 bits (55), Expect = 1.349e-21
Identity = 9/22 (40.91%), Postives = 14/22 (63.64%), Query Frame = 3
Query:  195 KQSLPVIWMTNRKAWMTAILFQ 260
            K +LPV +  N  AW+T  +F+
Sbjct:  199 KATLPVYFRANPTAWVTVAIFE 220          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000018.1 (pep scaffold:Pmarinus_7.0:GL482463:8529:10142:1 gene:ENSPMAG00000000016.1 transcript:ENSPMAT00000000018.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 7.591e-20
Identity = 39/98 (39.80%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  262 FYPVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNL-LETVESKQCSIKEFWKKITI 552
            F P V  +C  N L+ KALL++D+AP HP NL  L     V V+   P+A S LQP+ + V  T KAY  R  +  L  ET    + +  EFW+   I
Sbjct:  202 FCPFVRDHCARNKLENKALLVLDSAPEHPANLDDLAEN--VRVVFLPPNATSPLQPVGRVVTATLKAYYLRRLVGQLAAETDGEGKPTFGEFWRGYDI 297          

HSP 2 Score: 39.6614 bits (91), Expect = 7.591e-20
Identity = 21/84 (25.00%), Postives = 37/84 (44.05%), Query Frame = 3
Query:  528 GILEKNYNIMNAI--ISTSWIEMKSSCLQNCLNRLLIKA--SKNELVNDAPHVVTEITEIANQIGFDEVDEEYVQELIQNDQHD 767
            G   + Y+I  A+  +  +W E+  + +     ++  +            P +  EI  +A + GFD VDE  VQEL Q  + +
Sbjct:  289 GEFWRGYDIRKAVDNVGAAWREVTPAHMNGAWRQIWPECVDGSTGFAKTVPEIRREIVGLARRAGFDGVDEGDVQELYQQKKKE 372          

HSP 3 Score: 30.8018 bits (68), Expect = 7.591e-20
Identity = 14/28 (50.00%), Postives = 19/28 (67.86%), Query Frame = 3
Query:  195 KQSLPVIWMTNRKAWMTAILFQ-ILSSC 275
            K SLPVIW  N++A +T  +FQ   +SC
Sbjct:  174 KNSLPVIWRANKEARVTTAVFQDWFTSC 201          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006798.1 (pep scaffold:Pmarinus_7.0:GL478691:31611:33359:1 gene:ENSPMAG00000006139.1 transcript:ENSPMAT00000006798.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 3.189e-19
Identity = 42/92 (45.65%), Postives = 58/92 (63.04%), Query Frame = 1
Query:  283 YCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQ-GVIGTFKAYNFRITLKNLLETVES-KQCSIKEFWKKITI 552
            YC   NL FK LLI+DNAPG+P +LA +     V V+L  P+  S+LQP+DQ GV+ TFKAY  R T+  LLE  +   + ++++ WK   I
Sbjct:  222 YCRKENLAFKVLLILDNAPGYPKHLANINPN--VRVLLLPPNTASLLQPLDQGGVVSTFKAYYLRRTISQLLEGTDGPDKPTVRDCWKAYNI 311          

HSP 2 Score: 26.5646 bits (57), Expect = 3.189e-19
Identity = 9/15 (60.00%), Postives = 10/15 (66.67%), Query Frame = 3
Query:  204 LPVIWMTNRKAWMTA 248
            LPV W  N+ AWMT 
Sbjct:  190 LPVHWTANKMAWMTG 204          

HSP 3 Score: 26.1794 bits (56), Expect = 3.189e-19
Identity = 27/91 (29.67%), Postives = 46/91 (50.55%), Query Frame = 3
Query:  540 KNYNIMNAI--ISTSWIEMKSSCLQNCLNRLLIKASKNELVNDAPHVVTEITEIA------NQIGFDEVDEEYVQELIQNDQHDLSNEDLI 788
            K YNI +AI  I +SW ++K S + NC    + K     L N  P + T + ++          GF ++ E+ V EL+ +   +L+ +DL+
Sbjct:  307 KAYNIRDAINNIKSSWDDVKQSTM-NCAWNAIWKECVIYL-NCFPEMSTAVQDVVDLGRELGGEGFSDMREDDVLELLDSYNEELTVDDLM 395          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003283.1 (pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gene:ENSPMAG00000003000.1 transcript:ENSPMAT00000003283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 3.702e-18
Identity = 51/152 (33.55%), Postives = 76/152 (50.00%), Query Frame = 1
Query:  118 FKIKPLLIYHSENPSATKGFSKV*NLNNHCL*FG*QTEKPG*LL-YCFRFYPVVNL------YCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESKQCSIKEFWKKITI 552
            +++KP++++HS NP   KGF +  +L  H      ++ K G +    F  Y +  L      YC+  N  FK LL++DNAP HP  +  L     ++V+   P   S+LQPM QGVI  FKAY  R T   L+E  + +       W+   I
Sbjct:  202 YRLKPVVVHHSANPRTLKGFVRA-DLGVHF-----RSSKRGWMTDQMFTDYVLETLQDELRRYCKRKNQDFKILLVVDNAPSHPPYIVDLSEQ--IKVVFLPPHTTSLLQPMGQGVIAAFKAYYLRRTFAMLIEATDGENSQASVTWRSFNI 345          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO44738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ6])

HSP 1 Score: 35.8094 bits (81), Expect = 8.247e-6
Identity = 28/84 (33.33%), Postives = 44/84 (52.38%), Query Frame = 1
Query:  310 KALLIIDNAPGHPHNLAKLQMYLPVEVILTLPS--AVSILQPMDQGVIGTFK-AYNFRITLKNLLETVESKQ-CSIKEFWKKIT 549
            + LL +DN+P HP  L    + L   V L  PS   V+ LQP+ QG++  F+ AY  ++    L +  +S    S K+  ++IT
Sbjct:  262 RILLFLDNSPPHPPTLQLTNVKL---VFLIKPSNNTVNQLQPLTQGIVEAFRMAYRRKVLFSTLAKLDDSNSPRSAKQLMQEIT 342          

HSP 2 Score: 30.4166 bits (67), Expect = 8.247e-6
Identity = 11/20 (55.00%), Postives = 15/20 (75.00%), Query Frame = 3
Query:  198 QSLPVIWMTNRKAWMTAILF 257
            + LPVIW  NR+AW+T  +F
Sbjct:  226 ECLPVIWRANRRAWITTSIF 245          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031980.1 (pep primary_assembly:ASM223467v1:3:6881985:6888319:-1 gene:ENSORLG00000025652.1 transcript:ENSORLT00000031980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 1.497e-18
Identity = 60/159 (37.74%), Postives = 88/159 (55.35%), Query Frame = 1
Query:  118 FKIKPLLIYHSENPSATKGFSKV*NLNNHCL*FG*QTEKPG*L-LYCFR--FYPVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESKQ-CSIKEFWKKITIS*TLLLVHRG 582
            F IKP LIY S+NP A K  +K  +  + C  +  +      L L  F+  F P V  Y     L FK LL++DNA GH  +LA    Y  V++    P+  S++QPMDQG+I  FKA   R TL++L++ ++S Q  S+K++W+  TI+  L  + R 
Sbjct:  158 FMIKPGLIYRSKNPRALKNKNK--DDLHVCWMYNAKAWMTKALNLDWFKNCFIPQVKCYLRGKGLDFKVLLLVDNAGGHADDLA----YDCVQIKFLPPNTTSLIQPMDQGIIRAFKALYTRNTLQHLVDAMDSDQDSSLKDYWRGYTIASCLQNIQRA 310          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036785.1 (pep primary_assembly:ASM223467v1:22:11796267:11802170:-1 gene:ENSORLG00000024024.1 transcript:ENSORLT00000036785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 7.458e-15
Identity = 42/108 (38.89%), Postives = 64/108 (59.26%), Query Frame = 1
Query:  262 FYPVVNLYCE*NNLKFKALLIIDNAPGHPHNLAKLQMYLPVEVILTLPSAVSILQPMDQGVIGTFKAYNFRITLKNLLETVESKQC-SIKEFWKKITIS*TLLLVHRG 582
            F P V  Y     L FK LL+IDNA G   +L+    +  V++    P+  S++QPMDQG+I TFKA   R TL++L++ ++S Q  S K++W++ TI+  L  + R 
Sbjct:  246 FIPEVKGYLTEKGLDFKVLLLIDNAGGFADDLS----HDGVQIEFLPPNTSSLIQPMDQGIIRTFKALYTRNTLQHLVDAMDSDQNFSFKDYWREYTIASCLQHIQRA 349          

HSP 2 Score: 25.409 bits (54), Expect = 7.458e-15
Identity = 11/18 (61.11%), Postives = 12/18 (66.67%), Query Frame = 3
Query:  201 SLPVIWMTNRKAWMTAIL 254
            +LPV WM N  AWMT  L
Sbjct:  220 ALPVYWMHNTMAWMTKAL 237          
The following BLAST results are available for this feature:
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TIGD14.823e-2440.38tigger transposable element derived 1 [Source:HGNC... [more]
JRKL1.155e-838.10JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Jrkl2.709e-735.85Jrk-like [Source:MGI Symbol;Acc:MGI:1924782][more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q96MW7|TIGD1_HUMAN2.316e-2340.38Tigger transposable element-derived protein 1 OS=H... [more]
sp|Q9Y4A0|JERKL_HUMAN5.546e-838.10Jerky protein homolog-like OS=Homo sapiens OX=9606... [more]
sp|B2RRL2|JERKL_MOUSE1.418e-635.85Jerky protein homolog-like OS=Mus musculus OX=1009... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0HKR46.765e-2941.45centrosomal protein of 89 kDa isoform X2 OS=Alliga... [more]
A0A401T1F06.616e-2740.13HTH CENPB-type domain-containing protein OS=Chilos... [more]
G3W5F61.938e-2641.06HTH CENPB-type domain-containing protein OS=Sarcop... [more]
A0A4X2M0F74.550e-2639.74Uncharacterized protein OS=Vombatus ursinus OX=291... [more]
A0A2Y9DNC61.038e-2541.72CENPB DNA-binding domain-containing protein 1 OS=T... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003106.15.590e-2240.78pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 g... [more]
ENSPMAT00000005921.11.349e-2145.26pep scaffold:Pmarinus_7.0:GL487978:976:2666:1 gene... [more]
ENSPMAT00000000018.17.591e-2039.80pep scaffold:Pmarinus_7.0:GL482463:8529:10142:1 ge... [more]
ENSPMAT00000006798.13.189e-1945.65pep scaffold:Pmarinus_7.0:GL478691:31611:33359:1 g... [more]
ENSPMAT00000003283.13.702e-1833.55pep scaffold:Pmarinus_7.0:GL479064:1419:3178:1 gen... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO447388.247e-633.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000031980.11.497e-1837.74pep primary_assembly:ASM223467v1:3:6881985:6888319... [more]
ENSORLT00000036785.17.458e-1538.89pep primary_assembly:ASM223467v1:22:11796267:11802... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008652 ID=SMED30008652|Name=Tigger transposable element-derived protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=808bp
GTTAAACGTATTAATTTCGTACTAACTTTAAACCGGAAGTCTGTATTTTC
TTCTCTATATAAGTTATTTTTTTTGATGGCATTTTTTCCATAAAAGTTCG
ATCTCATCAACTGTCGATTTAAGATTAAACCTCTATTAATTTACCATTCA
GAAAATCCTAGTGCGACTAAAGGATTTTCTAAAGTTTAGAATTTAAACAA
TCATTGCCTGTGATTTGGATGACAAACCGAAAAGCCTGGATGACTGCTAT
ATTGTTTCAGATTTTATCCAGTTGTAAATTTATATTGTGAGTAAAATAAT
TTGAAATTCAAAGCTTTGCTGATTATTGACAATGCTCCTGGTCATCCGCA
CAATTTAGCAAAACTTCAAATGTATTTACCAGTTGAAGTTATTCTCACAC
TTCCAAGTGCTGTATCGATATTGCAGCCAATGGATCAAGGTGTGATAGGT
ACCTTCAAGGCTTACAACTTTCGCATTACTTTAAAAAACCTTCTCGAAAC
AGTTGAAAGTAAGCAATGTAGCATAAAGGAATTTTGGAAAAAAATTACAA
TATCATGAACGCTATTATTAGTACATCGTGGATCGAAATGAAATCATCTT
GTCTTCAAAATTGTTTGAATCGGTTGCTAATTAAAGCAAGTAAAAATGAA
TTAGTTAATGATGCGCCACATGTTGTTACTGAAATAACTGAAATAGCTAA
CCAAATTGGATTTGATGAGGTTGATGAGGAATATGTGCAAGAATTAATTC
AAAACGATCAGCATGATCTCTCTAATGAAGATCTTATTGATAGTTTGGTA
AAGACCAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR004875DDE_SF_endonuclease_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus