Guanylate cyclase

Overview
NameGuanylate cyclase
Smed IDSMED30008651
Length (bp)3660
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanylate cyclase (SMED30008651) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30008651) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase (SMED30008651) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30008651) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008651

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30008651SMESG000019264.1 SmedASXL_017237SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008651SMESG000019264.1 dd_Smed_v4_9453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008651SMESG000019264.1 dd_Smed_v4_9453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008651SMESG000019264.1 dd_Smed_v4_9453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008651SMESG000019264.1 dd_Smed_v4_9453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30008651SMESG000019264.1 dd_Smed_v4_9453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008651SMESG000019264.1 dd_Smed_v4_9453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008651SMESG000019264.1 dd_Smed_v4_9453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30008651SMESG000019264.1 dd_Smed_v6_9453_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30008651SMESG000019264.1 SMED30008651smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30008651SMESG000019264.1 dd_Smed_v6_9453_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 313/557 (56.19%), Postives = 397/557 (71.27%), Query Frame = 2
Query: 1850 DIDPMVAIRNGKHRGS-----ASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGC-HGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            D++P    R+ +  GS         +Y SL+T  G         QVF KTA +KGN+VA+K++N  ++ E T+++L ++K ++D+ N+H+ RF+G C +P +  ++ EYCP+GSL+D+LENE I LDWMFR SL  DIV+GM++LH+   C HG+LKSSNCVVD RFVLK+TD+GL   R++  E       H  Y K LWT+PE+LR  + P  G+  GDVYSF II QEI  R GVF V+  D   PKEI+E V   +  PFRPSL  +     +L  ++++ W EDP  RP F  I+ ++RK ++ + S NILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD++I+NFDVYKVETIGDAYMVVSGLP  NGR HA E+ARM L  L A+  F I HRP  QL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S  T  VL+ F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:  514 DVEPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEG-------QFQVFAKTAYYKGNLVAVKRVNR-KRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDLDPEQG-----HTVYAKKLWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLD-LSPKEIIERVTRGEQPPFRPSL-ALQSHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNR-ENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGE 1054          

HSP 2 Score: 179.874 bits (455), Expect = 3.535e-45
Identity = 122/429 (28.44%), Postives = 208/429 (48.48%), Query Frame = 2
Query:  458 FIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLK---NYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFT-----GLNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTL---DRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDG--SLCKKDGTSTGLIFGCTTAALFVIGV-IGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
            F+GP  + +   + R +   +   L++ G     F  KD  +Y   TR   ++  L +F+  L +   W  R    +  +   D+ +   F+  + +  R++   N   +  +     L      L+ +    RVI IC +    R +ML A+E  L   ++VF H+D+F      G  P P    +  D  + S R AF++  I+  K P N EY        L+ +A E++NF+     +N +  SF++ ++LY  A+ +  A   T+   + IT  MWNR+F G    +KID+ G+R +DFSL+D+DP++G F+ V  YNG+++    + G+ + W      PP D PKC FD     C +D  ST  +      +L ++G+ I  FF YR+++ + EL +  W + WE ++     +H +S  SR
Sbjct:  113 FLGPGCVYAAAPVGRFT-AHWRVPLLTAGAPALGFGVKD--EYALTTRAGPSYAKLGDFVAALHRRLGW-ERQALMLYAYRPGDEEHC--FFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDVSARQAFQAAKIITYKDPDNPEYLE--FLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQELVAVSGRKLNW--PLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLAL-VGSLSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSR 530          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 311/550 (56.55%), Postives = 391/550 (71.09%), Query Frame = 2
Query: 1886 HRGSAS-------NESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNY-GCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEP--SHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESG-NILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            H+G+ S         SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RFIG C++P +  +V EYCP+GSL+D+LEN+ INLDWMFR SLI D+V+GM +LH++    HG LKSSNCVVDSRFVLK+TD+GL   R      S  EP  SH  Y K LWT+PE+L    LP  G  K DVYSF II QEI  R G F ++  D   PKEIV+ V++ +   FRPS+D     + +L+ ++++ W +DP  RPDF  IK  +R+ +K  E G +ILDNLL RMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HA EIARM L  L A+  F I HRP+ QL LRIGVH+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S +T + L     F +  RG+VEMKGKGK  TYWL GE
Sbjct:  508 HKGAGSRLTLSLRGSSYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFR------STAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLD-LSPKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPAERPDFGQIKGFIRRFNK--EGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGE 1039          

HSP 2 Score: 147.517 bits (371), Expect = 3.791e-35
Identity = 112/431 (25.99%), Postives = 194/431 (45.01%), Query Frame = 2
Query:  458 FIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYS-DYFYSAKEMMERLKNYK-TEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF--------TGLNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLD---RITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFD--GSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
             +GP  +    ++AR + + +   L++ G     F  K+   Y+ L R   +   L  F+  L   + W  R      + Y+D ++    ++++ + + E L+    +  ++  A       +    + +  R++ ICG  +    I+L A    L   ++VF ++D+F        T    RPW D ++ ++  +++R AF+++L++  + P N EY      N L   ARE +        +N +   FY+ I+LYA  LN+   +  T +   RI   M  R ++G    V +D   +R +DF L+ + D  SG+FQ    Y+G+ E      G+ I W   K  PP D P CAFD     C K   ST  I    T   F++  +  F  +R+L  + EL +M W I WE L      ++ +   SR
Sbjct:   96 LLGPGCVYPAASVARFA-SHWRLPLLTAGAVASGFSAKND-HYRTLVRTGPSAPKLGEFVVTLHGHFNWTAR----AALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTREQA-QALREAFQTVLVITYREPPNPEY--QEFQNRLLIRAREDFGVELGPSLMNLIAGCFYDGILLYAEVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGA-EKQIWWTGRPIPW--VKGAPPSDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERYHKGAGSR 514          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:HGNC Symbol;Acc:HGNC:4691])

HSP 1 Score: 436.802 bits (1122), Expect = 2.588e-133
Identity = 238/520 (45.77%), Postives = 340/520 (65.38%), Query Frame = 2
Query: 1985 ALFKGNIVALKKINTGR--KFETTKEMLLDI-KKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSF-QTFIMSERGEVEMKGKGKQLTYWLHGENDFIVD-PVP 3529
            A+++G+ V LKK + G     ++ K    D+ + +KDL +++I   +G   +     +V E+C +GSLED+L N+ + LDWMF+ SL+ D+++GM YLH     HG LKS NCVVD RFVLK+TD+G N + E+ + +  E       +++LWT+PE+LR      +G+  GDVYSFAII QE++ R   F + +  ++   EI+  +K  K  P    +   +    + ++++KQ W E    RP F  I N  +  +KGK++ NI+D++L  +EQY++NLE L+ +RT+E   EK++ E LL  MLP SVA  L K  +V  E ++ VT+YFSDIVGFT++SA S P++V++LLN LYT FD+II + DVYKVETIGDAYMV SGLP  NG  HA EIA M L  LS++  F + H P   + +RIG+HSGPV AGVVG  MPRYCLFGDTVNT+SRMES GLP +IH+S ST+ +L++  + + +  RG  E+KGKG + T+WL G+  F+   PVP
Sbjct:  564 AIYEGDWVWLKKFSLGDFGDLKSIKSRASDVFEMMKDLRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKYLHHREFVHGRLKSRNCVVDGRFVLKVTDYGFNDILEMLRLSEEESSM----EELLWTAPELLRAPRGSRLGSFAGDVYSFAIIMQEVMVRGTPFCMMDLPAQ---EIINRLK--KPPPVYRPVVPPEHAPPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKT-NIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIGKKGFMKPLPVP 1073          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2D (guanylate cyclase 2D, retinal [Source:HGNC Symbol;Acc:HGNC:4689])

HSP 1 Score: 427.943 bits (1099), Expect = 5.474e-130
Identity = 236/531 (44.44%), Postives = 331/531 (62.34%), Query Frame = 2
Query: 1985 ALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVE-----PLHQY-----LVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSE-RGEVEMKGKGKQLTYWLHGENDFIVDPVPESAKI 3544
             +++G+ V LKK    +             K+++L ++++  ++G+ +      P   +     +V E+C +GSL+DLL   +I LDWMF+ SL+ D+++G+ YLH     HG LKS NC+VD RFVLK+TD G   L E QK    E P  E     LWT+PE+LR   L   GT+ GDV+S AII QE++ R   +A+       P+E+V+ V+S    P    L  +D    + I ++KQ W E P  RP      +  + I+KG+++ NI+D++L  +EQY++NLE L+ +RT+E   EK++ + LL  MLP SVA  L     V  E +EQVT+YFSDIVGFT++SA S P++V++LLN LYT FD+II + DVYKVETIGDAYMV SGLP  NG+ HA EIA M L  LSA+  F + H P   + +RIG+HSGP  AGVVG  MPRYCLFGDTVNT+SRMES GLP +IH++ ST+ +L++  +    E RG  E+KGKG + T+WL G   F   P+P+   +
Sbjct:  553 GVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDLLAQREIKLDWMFKSSLLLDLIKGIRYLHHRGVAHGRLKSRNCIVDGRFVLKITDHGHGRLLEAQKVLP-EPPRAE---DQLWTAPELLRDPALERRGTLAGDVFSLAIIMQEVVCRSAPYAMLELT---PEEVVQRVRSPP--PLCRPLVSMDQAPVECILLMKQCWAEQPELRPSMDHTFDLFKNINKGRKT-NIIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGRRGF-NKPIPKPPDL 1072          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2C (guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:4688])

HSP 1 Score: 414.461 bits (1064), Expect = 2.525e-125
Identity = 233/532 (43.80%), Postives = 329/532 (61.84%), Query Frame = 2
Query: 2048 TKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQIN------LDWMFRLSLIQDIVRGMIYLHSNYG-CHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSL--DEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKI-----DKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQT-FIMSERGEVEMKGKGKQLTYWLHGEND----FIVDPVPESAKIIQCE*KMIIIKIVQ 3586
            T++  +++ K+  ++  ++ +F G        + V EYC +GSL ++L N+ I+      +DW F++S++ DI +GM YLHS+    HG LKS+NCVVDSR V+K+TDFG N +   +K+              LWT+PE LR   +    + KGDVYS+ IIAQEII R+  F   +C  ++ K I     S+   PFRP L  +  +    ++  ++K  W+EDP  RPDF  I+ ++ KI     D+  ES   +D L+ R++ Y+ NLE LV +RTQ Y  E+ RA+ L + +LP+ V   L +   V  E YE+VTIYFSDIVGFT++   STPM+V+++LN +Y +FD I+++ DVYKVETIGDAYMV SGLP  NG  HA +IA+M L+ LS +  F + H P   + +RIGVHSGP  AGVVG KMPRYCLFGDTVNT+SRMES GLPL+IH+S ST+ +LK  +  F+   RGE  +KG+G + TYWL G  D        P  E+ + +Q E   +I   +Q
Sbjct:  526 TEKQKIELNKLLQIDYYNLTKFYGTVKLDTMIFGVIEYCERGSLREVL-NDTISYPDGTFMDWEFKISVLYDIAKGMSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKD--------------LWTAPEHLRQANI----SQKGDVYSYGIIAQEIILRKETFYTLSCRDRNEK-IFRVENSNGMKPFRPDLFLETAEEKELEVYLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNES--YMDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEILSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQ 1035          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 302/547 (55.21%), Postives = 391/547 (71.48%), Query Frame = 2
Query: 1916 MSLVTISGVQLENI--QNTQVFIKTALFKGNIVALKKINTGRK----FETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVK---SSKHVPFRPSLDEI------DGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEND 3508
            +S  + SG  +E I   NTQ++ KTA+FKG +VA+KK+N   K     + ++  L+++KK+KDL +DHI RF G C++  H  +V EYCPKGSLED+LENE+I LD + + SL+ D+V+G+ +LH S    HG LKSSNCVVDSRFVLK+TDFGL+ L  +++ N  E   H YYKKMLWT+PE+LR    P +GT KGD+YSFAII  E+++R+GVFA++N D   P EIV+ V+   S    P RP + E       D  +  L+ ++   W EDP+ RP+   ++ ++R +++  E+ N++DNLL RMEQYANNLEGLV +RTQEYL EKK+ E+LL+ +LP ++A  LI  ++V AESY+ VTIYFSDIVGFTSLS+ STPMQV+ LLN LY  FD +++NF VYKVETIGDAYMVVSGLP     +HA +IA+M L  L  +  FVI HRP+ QL+LRIG+HSG V AGVVG KMPRYCLFGDTVNTSSRMESNGLPLKIH+S  T ++L     F +  RG VEMKGKG Q TYWL G  D
Sbjct:  721 VSFKSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDLS-PNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRD-DHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRGYKD 1265          

HSP 2 Score: 159.844 bits (403), Expect = 3.323e-39
Identity = 149/524 (28.44%), Postives = 241/524 (45.99%), Query Frame = 2
Query:  272 KKLGPITDLALARIEKLKKKGELQGFAN--------YSLKLFFSESSTVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIG------VFYIDDK-------------------SYSDYF--YSAKE-MMERLKNYKTE--------GYKADASSLKE-IREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLS-EFVFIHIDLFTGLNP-RPWF-DQKSSDEVNESVRNAFRSMLIVKLPLNS--EYWNSSIGNDLRKIAREKYNFSY---PKEELNYVTTSFYESIMLYALALNDLYAKNDTLD-----RITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKR 1669
            +K  P+ D+A+  + K KK     G+ N        Y   L     +TV     +++ +    LD    A +G      L T+ +++    N  +  L  +G       K +Y  LTR+ G++  L + M +L+ ++        N        +F+  DK                   S   YF  Y+ K    E+ K +K E         +  D    +E  ++ L+ +S  S VII+C +    R IMLAA ++ +  S E+VFI+ID+ TG +  +PW     +++E NE  + A+R++  + L  +   EY N  +   +++ A +KYN++       E+N   ++FY++++LYA+ALN+       LD      IT+ MW RTF G    V ID  G+R SD+SL DLDP    F +V +Y+G++     +    + W   K  PP D P C +D S C        L+ G     L ++G+    F +RR K + EL AM+W I WE LD  E +
Sbjct:   62 QKAMPVIDIAVQEVIKAKKLPP--GWINLTYWDSRLYEDILLAERHATVG----VIQAYCEHRLD----AILGFADNYGLATVTKVTAG-LNGGIPILTTSGMPSLLNSKKEYPFLTRMQGSYRLLADSMYQLIAYHDEDSVSKSNSSLNYLNLIFFYHDKRRAVNRVIAQDESQETGATSSHCYFSLYAIKRYFTEKSKTFKREWALNTPQFPFDEDLVIERETFKQWLREISLQSNVIILCASPDTVREIMLAAHDLGMATSGEYVFINIDVSTGSHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFEL--RVKERADQKYNYTNITGKDYEMNNFISAFYDAVLLYAIALNETIQSG--LDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTV--GQLHWVGGK--PPTDLPICGYDKSKCPGYPLHVYLLMGSFLLILVLVGLF--IFFWRRYKLEQELAAMSWKIRWEELDGEESQ 564          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 302/547 (55.21%), Postives = 391/547 (71.48%), Query Frame = 2
Query: 1916 MSLVTISGVQLENI--QNTQVFIKTALFKGNIVALKKINTGRK----FETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVK---SSKHVPFRPSLDEI------DGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEND 3508
            +S  + SG  +E I   NTQ++ KTA+FKG +VA+KK+N   K     + ++  L+++KK+KDL +DHI RF G C++  H  +V EYCPKGSLED+LENE+I LD + + SL+ D+V+G+ +LH S    HG LKSSNCVVDSRFVLK+TDFGL+ L  +++ N  E   H YYKKMLWT+PE+LR    P +GT KGD+YSFAII  E+++R+GVFA++N D   P EIV+ V+   S    P RP + E       D  +  L+ ++   W EDP+ RP+   ++ ++R +++  E+ N++DNLL RMEQYANNLEGLV +RTQEYL EKK+ E+LL+ +LP ++A  LI  ++V AESY+ VTIYFSDIVGFTSLS+ STPMQV+ LLN LY  FD +++NF VYKVETIGDAYMVVSGLP     +HA +IA+M L  L  +  FVI HRP+ QL+LRIG+HSG V AGVVG KMPRYCLFGDTVNTSSRMESNGLPLKIH+S  T ++L     F +  RG VEMKGKG Q TYWL G  D
Sbjct:  662 VSFKSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDLS-PNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRD-DHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRGYKD 1206          

HSP 2 Score: 174.866 bits (442), Expect = 6.956e-44
Identity = 147/509 (28.88%), Postives = 248/509 (48.72%), Query Frame = 2
Query:  233 EKNNGNNMIVENSKKLGPITDLALARIEKLKKKGELQGFANYSLKLFFSESSTVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKW----------LPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTEGYKA------DASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLS-EFVFIHIDLFTGLNP-RPWF-DQKSSDEVNESVRNAFRSMLIVKLPLNS--EYWNSSIGNDLRKIAREKYNFSY---PKEELNYVTTSFYESIMLYALALNDLYAKNDTLD-----RITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKD-GTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKR 1669
            E + G N  +    K  P+ D+AL  +  L+           SLK+ F E+S +S+     K   ++  ++ V A +G   + +L  +AR+S   + + +          E  D+ ++  LTR+ G+++SL   + ++ + ++W          + R  +N        K  S+ ++S   +   + N KT  +        +A  L + R  L   S MS +II+C +    R IMLAA ++ +  S E+VFI+ID+ TG +  +PW     +++E NE  + A+R++  + L  +   EY N  +   +++ A +KYN++       E+N   ++FY++++LYA+ALN+       LD      IT+ MW RTF G    V ID  G+R SD+SL DLDP    F +V +Y+G++     +    + W   K  PP D P C +D S C +       L+ G     L ++G+    F +RR K + EL AM+W I WE LD  E +
Sbjct:   38 EGDRGKNPFLLTLAKSKPVFDVALQDVYHLRI------LPYGSLKVTF-ENSALSDAVGPQKMIEHYC-NKTVDAIMGLPYVYALAPVARISKF-WGQGVPVFTTTALVDELGDRNEFPLLTRMMGSYKSLGKLVTRIAERFEWQHYFFMFNDEVARGPRN--------KGRSECYFSLSAIKNLIMNNKTSTWNVKMFSEFEADRL-QYRALLSEASVMSNLIILCASPDTVREIMLAAHDLGMATSGEYVFINIDVSTGSHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFEL--RVKERADQKYNYTNITGKDYEMNNFISAFYDAVLLYAIALNETIQSG--LDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTV--GQLHWVGGK--PPTDLPICGYDKSKCPQGYPLHVYLLMGSFLLILVLVGLF--IFFWRRYKLEQELAAMSWKIRWEELDGEESQ 518          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 302/547 (55.21%), Postives = 391/547 (71.48%), Query Frame = 2
Query: 1916 MSLVTISGVQLENI--QNTQVFIKTALFKGNIVALKKINTGRK----FETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVK---SSKHVPFRPSLDEI------DGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEND 3508
            +S  + SG  +E I   NTQ++ KTA+FKG +VA+KK+N   K     + ++  L+++KK+KDL +DHI RF G C++  H  +V EYCPKGSLED+LENE+I LD + + SL+ D+V+G+ +LH S    HG LKSSNCVVDSRFVLK+TDFGL+ L  +++ N  E   H YYKKMLWT+PE+LR    P +GT KGD+YSFAII  E+++R+GVFA++N D   P EIV+ V+   S    P RP + E       D  +  L+ ++   W EDP+ RP+   ++ ++R +++  E+ N++DNLL RMEQYANNLEGLV +RTQEYL EKK+ E+LL+ +LP ++A  LI  ++V AESY+ VTIYFSDIVGFTSLS+ STPMQV+ LLN LY  FD +++NF VYKVETIGDAYMVVSGLP     +HA +IA+M L  L  +  FVI HRP+ QL+LRIG+HSG V AGVVG KMPRYCLFGDTVNTSSRMESNGLPLKIH+S  T ++L     F +  RG VEMKGKG Q TYWL G  D
Sbjct:  683 VSFKSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDLS-PNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRD-DHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRGYKD 1227          

HSP 2 Score: 183.726 bits (465), Expect = 1.098e-46
Identity = 150/508 (29.53%), Postives = 253/508 (49.80%), Query Frame = 2
Query:  239 NNGNNMIVENSKKLGPITDLALARIEKLKKKGELQGFANYSLKLFFSES---STVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKW---------LPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKT--EGYKADASSLK---EIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLS-EFVFIHIDLFTGLNP-RPWF-DQKSSDEVNESVRNAFRSMLIVKLPLNS--EYWNSSIGNDLRKIAREKYNFSY---PKEELNYVTTSFYESIMLYALALNDLYAKNDTLD-----RITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKD-GTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKR 1669
            ++G N  + +S K+ P+ DLAL   E++ ++G L    N S+ L + +S     +  +  + +     +L + +   IG     +L  +ARMS   +   +  +   G      DK +YQ +TRI   ++ +++ +  L   YKW            P   +G  ++   S     +  +++ME   N+ T  E + A+ S  +   + R  L+  S+M+ VII+C +    R IMLAA ++ +  S E+VFI+ID+ TG +  +PW     +++E NE  + A+R++  + L  +   EY N  +   +++ A +KYN++       E+N   ++FY++++LYA+ALN+       LD      IT+ MW RTF G    V ID  G+R SD+SL DLDP    F +V +Y+G++     +    + W   K  PP D P C +D S C +       L+ G     L ++G+    F +RR K + EL AM+W I WE LD  E +
Sbjct:   57 SDGKNPFLFSSHKVKPLADLAL---ERVYREGIL---PNNSVNLIYRDSKLSDAIGPNVAVEQ-----LLRKQIDCIIGYAYGYALAPVARMS-PYWKNGIPIITPIGLTMSLDDKREYQLMTRINSPYKVVSSAVSTLFNTYKWKRHIFMFHHAKAPSVAVGECFLLMASLQ---HPLRKVMEMQHNFFTFNEDHGANISKAERHNQFRNYLRASSNMANVIILCASPDTVREIMLAAHDLGMATSGEYVFINIDVSTGSHAEQPWIRANDTNNEENEKAKEAYRALKTISLRRSDLDEYKNFEL--RVKERADQKYNYTNITGKDYEMNNFISAFYDAVLLYAIALNETIQSG--LDPRNGHNITSRMWGRTFVGITGNVSIDHNGDRYSDYSLLDLDPVQNRFVEVAYYSGASNQLKTV--GQLHWVGGK--PPTDLPICGYDKSKCPQGYPLHVYLLMGSFLLILVLVGLF--IFFWRRYKLEQELAAMSWKIRWEELDGEESQ 539          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 285/539 (52.88%), Postives = 379/539 (70.32%), Query Frame = 2
Query: 1916 MSLVTISGVQLENI--QNTQVFIKTALFKGNIVALKKINTGRK----FETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVK---SSKHVPFRPSLDEI------DGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQT-----FIMSERGEVEMKGK 3469
            +S  + SG  +E I   NTQ++ KTA+FKG +VA+KK+N   K     + ++  L+++KK+KDL +DHI RF G C++  H  +V EYCPKGSLED+LENE+I LD + + SL+ D+V+G+ +LH S    HG LKSSNCVVDSRFVLK+TDFGL+ L  +++ N  E   H YYKKMLWT+PE+LR    P +GT KGD+YSFAII  E+++R+GVFA++N D   P EIV+ V+   S    P RP + E       D  +  L+ ++   W EDP+ RP+   ++ ++R +++  E+ N++DNLL RMEQYANNLEGLV +RTQEYL EKK+ E+LL+ +LP ++A  LI  ++V AESY+ VTIYFSDIVGFTSLS+ STPMQV+ LLN LY  FD +++NF VYKVETIGDAYMVVSGLP     +HA +IA+M L  L  +  FVI HRP+ QL+LRIG+HSG V AGVVG KMPRYCLFGDTVNTSSRMESNGL +  + S   +   K F+      F+ +E+  +E +GK
Sbjct:   94 VSFKSGSGGSVETIAQNNTQIYTKTAIFKGVVVAIKKLNIDPKKYPRLDLSRAQLMELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEINLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFAIILHEMMFRKGVFALENEDL-SPNEIVQRVRKPVSEDQEPLRPWVSETGEGEGDDALNDTLLSLMVACWSEDPHERPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRD-DHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLRMFWNFSLYKIYKFKVFKNKIELDFLKNEKESIEFEGK 630          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-21 (Receptor-type guanylate cyclase gcy-21 [Source:UniProtKB/Swiss-Prot;Acc:O16715])

HSP 1 Score: 450.284 bits (1157), Expect = 1.382e-138
Identity = 267/706 (37.82%), Postives = 401/706 (56.80%), Query Frame = 2
Query: 1415 EGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQIS-RKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSN-YGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQT-LPFIGTV---KGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHV---PFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            EG SI++ N+    P DTP C F G  C     +T +I      A+ +   I   F Y+R +++  L ++ ++I    +  ++K  +  SQ S R  ++++ +++                     +  +   ++   +   N+ S I+       G    +           ++G   +   +        L++G  VALK+I      E T+ + L+I K+++  N ++  F+GM V+    ++VYE   +GSL+D+L+N+ + LD +FR  + +DI+ G+ YLHS+  GCHG LKS+NC++D+R++++L+ FGL  LR   +E   +E   +  K  LWTSPE+LR  T L   G +   K DVYS AI+  E+  R G +     +  +P+EIV  VK        PFRP +  +      + + +  AW EDP NRP    IK  ++ +  G +   I+DN++S +E+Y + LE  +A+R +E   EK ++E LL  MLP+ VA  L    +VSAES+E  T++FSD  GF  +SA S P+ +++ LN LYT FD II+ FDVYKVETI DAYMV SGLP  NG +HA EIA + L  L A+  F I H PN ++ LRIG++SGP  AGVVG KMPRYCLFGDTVNT+SRMESNG+PL+I+ S +  E+L     + + ERG VEMKGKGKQ+TY++ GEN
Sbjct:  345 EGLSIDFVNKS--APKDTPVCGFYGENCGPPANNTFIIVISVGVAVLIGLAIAAAFLYKRYRYERRLHSLFFMIDRNQI-ILKKHTNLMSQQSLRSMASIHGSVV---------------------AASQTLRDSHFFIEDYNNASSINASSIFNTGSTARAGPFGPIPGFGGVTGASEDEKWHQIPDFGVGLYEGRTVALKRIYRS-DVEFTRSIRLEIAKLQESVNSNVIEFVGMVVQSPDVFVVYELAQRGSLKDILDNDDMPLDDVFRSQMTKDIIAGLEYLHSSPIGCHGRLKSTNCLIDARWMVRLSSFGLRELR--GEETWQQEDDVQEGKDQLWTSPELLRWSTGLSQCGVLLVQKSDVYSLAIVLYELFGRLGPWG---DEPMEPREIVSLVKREALAGKKPFRPDMAVLKESPRIVQETVVAAWTEDPLNRPSLHQIKRKLKPLTIGLKR-TIMDNMVSMIEKYTDKLEKDIAERNEELEGEKAKSEALLKMMLPEVVADSLKLGSNVSAESFENCTVFFSDCPGFVEMSATSKPIDIVQFLNDLYTVFDRIIDQFDVYKVETIADAYMVASGLPVPNGNHHAGEIASLGLALLKAVESFKIRHLPNEKVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPLRINCSGTAKEILDQLGGYEIEERGIVEMKGKGKQMTYFVRGEN 1019          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG3216 (gene:FBgn0034568 transcript:FBtr0273396)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 409/1129 (36.23%), Postives = 590/1129 (52.26%), Query Frame = 2
Query:  272 KKLGPITDLALARIEK----------LKKKGELQGFANYSLKLFFSESSTVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFE-----------------------FKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTEGYKADASSL----KEIREK-LKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNPRPWFDQ--KSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYPK-EELNYVTTSFYESIMLYALALND-LYAKNDTLD--RITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGF-FAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVE-PLHQYLVY-EYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFI--GTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEND 3508
            ++ GP  DLAL  I K          LKKKG              S  S        +    YF  D  V AFIGP    +L  +AR++       +  +G+     E                       FKDK +Y  LTR++     L      +++ + W      N     +D      + ++  + +E     + EG  +    L    +E+ E  LK  S  +RV+I+       R  MLAA  + +   E+VF+ +++F       W D+  +  DE +   R A+ ++L V L   +        +++R+ A   YN+++ + EE+N+   +FY+ + L  +ALN+ L    D  D   IT  MWNRTF G    V+ID  G+R +D+S+ DLDP +G F  V  Y+G  + YS + GK I W   + EPP D P C F G+     G  + +++      LF+  V        +++K   EL  M+W +                   R D  + E                   G   GSK  ++              D++ +   + G H G AS  S+ SL              QV+     FKG  VA+KK+N  +K + T ++L +IK+ +D+++++  RF+G C++ P    L+  EYC +GSL+D+LENE I LDW FR+SLI DIV+GM YLH S+   HG L+S NC++D RFVLK++DFGL  L       S+      YY K+LW +PE+L   T+P     T +GDVYSF II +EI+ R G +  +     D   I+  V+      FRP + E + C  DL++++++ W ++   RP F  I++++R I KG    N++D+LL+RMEQYANNLE LV ++T++   EK+R E+LLY +LP+ VA QL+    V  E +  VTIYFSDIVGFT L A S+PM V+  LN LY+TFD II  +DVYKVETIGDAY+VVSGLP  NG  HAREIA M L  L A+  F + H+P  ++++RIG+HSG VCAGVVG KMP YCLFGDTVNT+SRMES G P KIH+S +T  +L  F TF M +RG+VE+KGKG   TYWL+  ++
Sbjct:  106 ERCGPAVDLALDEINKVFLKPHNITLLKKKG--------------SYPSCSGARAPGLAADMYFQDD--VIAFIGPACAFALEPVARLAAYWNKPIITGMGDQPPSSEGELTVTSGILGRIHKWKNENTGMFKDKSKYPTLTRMSYCQCRLILVFASVIRQFNW------NHVALLVDRSEL--FSWTVGKNLEY--GLRQEGLLSFVKELNGNEEEVYENYLKDASMYARVVILSVRGVLVRKFMLAAHSLGMTNGEWVFLDVEIFQS---EYWGDKGWEMKDEHDAKARKAYEALLRVSLLQPTSPKFQDFADNVRENALYDYNYTFGEGEEVNFFIGAFYDGVYLLGMALNETLTEGGDIRDGVNITRRMWNRTFEGITGHVRIDDNGDRDADYSILDLDPINGKFSVVAHYSGVHKVYSAVHGKKIHWPGGREEPPPDVPPCGFLGNSTDCVGNFSTIMYSVFGLLLFLGLVFLVICLLQKQMKLSKELNNMSWRV-------------------RPDDVLIEM------------------GGMFGSKGGLQR------------LDVENISLQQFGIHSGRASIASFTSL------------PPQVYTTIGQFKGERVAIKKVNV-KKVDLTPQLLWEIKQARDVSHENTVRFVGACIDLPRPTVLILTEYCSRGSLKDVLENEAIELDWNFRMSLIHDIVKGMNYLHNSDVAAHGKLRSCNCLIDGRFVLKISDFGLRTL----TTPSDFVRDQNYYLKLLWIAPELLPLTTIPGCCPATQRGDVYSFGIILEEIVNRGGPYQ-EARQQMDVHTILHKVRQCNG--FRPLIRERE-CPPDLLELMEKCWADNQEERPTFSTIRSNIRTIMKGF-CENLMDDLLNRMEQYANNLESLVEEKTRQLSLEKQRTEELLYQILPRPVAQQLMAGDLVEPEEFSSVTIYFSDIVGFTELCARSSPMDVVNFLNDLYSTFDRIIGFYDVYKVETIGDAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVTTYWLNSTSE 1134          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0346151)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 305/539 (56.59%), Postives = 389/539 (72.17%), Query Frame = 2
Query: 1922 LVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGR-KFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHS-NYGCHGHLKSSNCVVDSRFVLKLTDFGLNILR----EIQKENSNEEPSHEYYKKMLWTSPEILRTQ-TLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCD-SKDPKEIVESVKS----SKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            +V+I+G       + Q+FI   +F+ + VA+K +     +   T+ ++L++K++KDL +DH+ +F G C++    +L+ EYCPKGSL+D+LENEQ  LDWMFRLSL+ DIVRGM +LHS +   HG+LKSSNCVVDSRFVLK+TDFGL+ LR    +++ +  N   SH Y+ K+LWT+PE+LR +   P  GT KGDVY+F II  EI  R+G F +  C   K P+EI+E VK         PFRP L+      +D+  II++ W EDP  RPDF  +K+ +R+ +K  E+GNI+DNLL RME YANNLE LV +RTQ+Y EEKK+ E LLY +LP+SVA QLI  Q V AE+++QVTIYFSDIVGFT++SA+STPMQV++ LN LYT FDSI+ENFDVYKVETIGDAYMVVSGLP  NG  HAREIAR+ L  L A+  F I HRP  +L+LRIG+H+G   AGVVG KMPRYCLFGDTVNT+SRMESNG  LKIHIS +T E L  F TF+ + RG V MKGKG+ LTYWL GE
Sbjct:  601 MVSING-------DRQIFIPVGMFRKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFLLTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCVVDSRFVLKITDFGLHTLRRTRFDLESDGGNCN-SHAYWSKLLWTAPELLRVEHNRPPEGTQKGDVYAFGIIVHEITTRQGPFYLGRCAYEKSPQEIIELVKGYNPHRMQKPFRPELEPNGDTKADINGIIRRCWAEDPAERPDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGE 1131          

HSP 2 Score: 189.504 bits (480), Expect = 2.931e-48
Identity = 145/515 (28.16%), Postives = 254/515 (49.32%), Query Frame = 2
Query:  176 KKLSPREFRIAVLMTNSNLEKNNGNNMIVENSKKLGPITDLALARIEKLKKKGELQGFANYSLKLFFSESSTVSEHQNIMKRFFYFILDEP-VHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQ-YQGLTRIAGNH-ESLTNFMGKLLKFYKWLPRPHKNIGVFYIDD----KSYSDYFYSAKEMMERLKNYKTE--GYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKL-DLSEFVFIHIDLFTG---LNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYP-KEELNYVTTSFYESIMLYALALNDLYAKNDT-LDRITN------YMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESL 1651
            ++L  R   + V +  S +E +N N+ I+    K+ P+ +LA+  ++++       G +++ ++L   ++   S++  I   FF      P V+A  G      L  I+R +       L + G A    EF  K + Y  LTR+ G    +L N +  +L  + W         + Y ++    K  S  F     + + ++ +     G+     +  +I   LK ++  SR++I+C   +  R IML A E+ + D  E+VFI+I+LF+    L  +PW+D+  +D  NE  + A+ +ML V  K P ++EY  + + N+++ IA EKYN+++   E ++   TSF++ ++LYA ALN+   ++ T L R  N       MWNR+F G    V IDA G+R+S +SL D++P +G F+ V  +  +   +     K I W  ++ E P D P C +DG+LC  +      I       + V+  +  FF YR    +AE+ +M+W +  E +
Sbjct:   78 RRLGARRQLVFVALLPS-VESDNKNDCIM---PKVLPVLELAIRHVQRMG----FVGGSHFDIQLISRDTFCSSKYGPI--GFFEIYTQWPEVNAVFGLPCEYVLAPISRYADVWQVPVLTTGGNAK---EFNKKSESYSTLTRLKGAQVNNLGNVVRAILNSFNW-----TRTALIYQNENAKVKGNSVCFLCLAAIHDTIEEHSVYQLGFDTSTWTKADITRMLKNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEY--TRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYSLLDMNPTTGRFEIVAHFLHNRLEFE--ANKEIHWAGDREEAPPDRPICGYDGALCPDNSLPGYAILSIVLGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLEDV 570          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG31183 (gene:FBgn0051183 transcript:FBtr0083187)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 305/539 (56.59%), Postives = 389/539 (72.17%), Query Frame = 2
Query: 1922 LVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGR-KFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHS-NYGCHGHLKSSNCVVDSRFVLKLTDFGLNILR----EIQKENSNEEPSHEYYKKMLWTSPEILRTQ-TLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCD-SKDPKEIVESVKS----SKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            +V+I+G       + Q+FI   +F+ + VA+K +     +   T+ ++L++K++KDL +DH+ +F G C++    +L+ EYCPKGSL+D+LENEQ  LDWMFRLSL+ DIVRGM +LHS +   HG+LKSSNCVVDSRFVLK+TDFGL+ LR    +++ +  N   SH Y+ K+LWT+PE+LR +   P  GT KGDVY+F II  EI  R+G F +  C   K P+EI+E VK         PFRP L+      +D+  II++ W EDP  RPDF  +K+ +R+ +K  E+GNI+DNLL RME YANNLE LV +RTQ+Y EEKK+ E LLY +LP+SVA QLI  Q V AE+++QVTIYFSDIVGFT++SA+STPMQV++ LN LYT FDSI+ENFDVYKVETIGDAYMVVSGLP  NG  HAREIAR+ L  L A+  F I HRP  +L+LRIG+H+G   AGVVG KMPRYCLFGDTVNT+SRMESNG  LKIHIS +T E L  F TF+ + RG V MKGKG+ LTYWL GE
Sbjct:  601 MVSING-------DRQIFIPVGMFRKSKVAIKPVEVDNVQGLLTRSLMLELKRMKDLQHDHLVKFYGACLDQRRSFLLTEYCPKGSLQDILENEQFQLDWMFRLSLMHDIVRGMQFLHSSDIRSHGNLKSSNCVVDSRFVLKITDFGLHTLRRTRFDLESDGGNCN-SHAYWSKLLWTAPELLRVEHNRPPEGTQKGDVYAFGIIVHEITTRQGPFYLGRCAYEKSPQEIIELVKGYNPHRMQKPFRPELEPNGDTKADINGIIRRCWAEDPAERPDFNTLKSMIRRFNKDNETGNIVDNLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQPVVAETFDQVTIYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDVYKVETIGDAYMVVSGLPIRNGNQHAREIARLALALLEAVHNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGE 1131          

HSP 2 Score: 189.504 bits (480), Expect = 2.931e-48
Identity = 145/515 (28.16%), Postives = 254/515 (49.32%), Query Frame = 2
Query:  176 KKLSPREFRIAVLMTNSNLEKNNGNNMIVENSKKLGPITDLALARIEKLKKKGELQGFANYSLKLFFSESSTVSEHQNIMKRFFYFILDEP-VHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQ-YQGLTRIAGNH-ESLTNFMGKLLKFYKWLPRPHKNIGVFYIDD----KSYSDYFYSAKEMMERLKNYKTE--GYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKL-DLSEFVFIHIDLFTG---LNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYP-KEELNYVTTSFYESIMLYALALNDLYAKNDT-LDRITN------YMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESL 1651
            ++L  R   + V +  S +E +N N+ I+    K+ P+ +LA+  ++++       G +++ ++L   ++   S++  I   FF      P V+A  G      L  I+R +       L + G A    EF  K + Y  LTR+ G    +L N +  +L  + W         + Y ++    K  S  F     + + ++ +     G+     +  +I   LK ++  SR++I+C   +  R IML A E+ + D  E+VFI+I+LF+    L  +PW+D+  +D  NE  + A+ +ML V  K P ++EY  + + N+++ IA EKYN+++   E ++   TSF++ ++LYA ALN+   ++ T L R  N       MWNR+F G    V IDA G+R+S +SL D++P +G F+ V  +  +   +     K I W  ++ E P D P C +DG+LC  +      I       + V+  +  FF YR    +AE+ +M+W +  E +
Sbjct:   78 RRLGARRQLVFVALLPS-VESDNKNDCIM---PKVLPVLELAIRHVQRMG----FVGGSHFDIQLISRDTFCSSKYGPI--GFFEIYTQWPEVNAVFGLPCEYVLAPISRYADVWQVPVLTTGGNAK---EFNKKSESYSTLTRLKGAQVNNLGNVVRAILNSFNW-----TRTALIYQNENAKVKGNSVCFLCLAAIHDTIEEHSVYQLGFDTSTWTKADITRMLKNVAMQSRIVIMCADPQSIRQIMLTAEELNMIDSGEYVFINIELFSRVQYLTSQPWYDKNDTDLNNERAQKAYTAMLTVTPKQPNDNEY--TRVSNEIKAIAAEKYNYTFSDNEPISAFVTSFFDGVLLYANALNESIREDPTMLTRPINGTDMVRRMWNRSFTGITGNVTIDANGDRLSAYSLLDMNPTTGRFEIVAHFLHNRLEFE--ANKEIHWAGDREEAPPDRPICGYDGALCPDNSLPGYAILSIVLGTMVVVMAVCFFFGYRHYIAEAEINSMSWKVSLEDV 570          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0304791)

HSP 1 Score: 508.834 bits (1309), Expect = 4.212e-159
Identity = 264/536 (49.25%), Postives = 358/536 (66.79%), Query Frame = 2
Query: 1919 SLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYK--KMLWTSPEILRTQTLPFI-GTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHV--PFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEND 3508
            S V++S     + + T +F    L+KG + A+KK+   +  + T+EM  ++K ++D  +D+IC FIG C +P +  ++ EYC +GSL+D+LENE + LD MF  S++ DI+RG+IYLH S    HG L +SNC+VDSR+V+KLTDFGL   ++   E+S+ +  H   K  K+L+ +PE+LR      + GT +GD YSF I+  E+  RRG F         P + ++ V   +    P+RPSL  ++     + + +++ W E P +RPDF  I+  +R + KG    NI DN+++ ME+YANNLE LV  RT +  EEKK+ + LL+ MLP+ VA QL K   V  E YEQV+IYFSDIVGFT++SA+ TP+QV++ LN LYT FDSII ++DVYKVETIGDAYMVVSGLP  NG  HA EIA M L  LSA+  F I HRP  +L LRIG+HSGPVCAGVVG KMPRYCLFGDTVNT+SRMES+G+PLKIH S    ++L     +  +ERG + MKGKG Q TYWL GE++
Sbjct:  560 SQVSLSSNPDADFRYTTIFTPIGLYKGQLYAIKKVRK-KSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLVDSRWVVKLTDFGLFAFKQ-GIEDSSTDMQHMSAKCLKLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFGETGLT---PMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRP-NIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDE 1089          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG10738 (gene:FBgn0036368 transcript:FBtr0304792)

HSP 1 Score: 508.449 bits (1308), Expect = 4.243e-159
Identity = 264/536 (49.25%), Postives = 358/536 (66.79%), Query Frame = 2
Query: 1919 SLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYK--KMLWTSPEILRTQTLPFI-GTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHV--PFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEND 3508
            S V++S     + + T +F    L+KG + A+KK+   +  + T+EM  ++K ++D  +D+IC FIG C +P +  ++ EYC +GSL+D+LENE + LD MF  S++ DI+RG+IYLH S    HG L +SNC+VDSR+V+KLTDFGL   ++   E+S+ +  H   K  K+L+ +PE+LR      + GT +GD YSF I+  E+  RRG F         P + ++ V   +    P+RPSL  ++     + + +++ W E P +RPDF  I+  +R + KG    NI DN+++ ME+YANNLE LV  RT +  EEKK+ + LL+ MLP+ VA QL K   V  E YEQV+IYFSDIVGFT++SA+ TP+QV++ LN LYT FDSII ++DVYKVETIGDAYMVVSGLP  NG  HA EIA M L  LSA+  F I HRP  +L LRIG+HSGPVCAGVVG KMPRYCLFGDTVNT+SRMES+G+PLKIH S    ++L     +  +ERG + MKGKG Q TYWL GE++
Sbjct:  558 SQVSLSSNPDADFRYTTIFTPIGLYKGQLYAIKKVRK-KSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLVDSRWVVKLTDFGLFAFKQ-GIEDSSTDMQHMSAKCLKLLYRAPELLRQGPSSLVMGTQRGDAYSFGILLYEMHVRRGPFGETGLT---PMQCLQKVLQPQDYLNPYRPSLQPLETAFDCVSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRP-NIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDE 1087          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 404/895 (45.14%), Postives = 549/895 (61.34%), Query Frame = 2
Query:  854 IIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFT-GLNPRPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDR-----ITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            + +C +    R +++   +  L   E+VF +ID+F      RP       D  +   + AF+S+ I+    P N EY       DL+  A+  +NF+     +N ++  FY+ +MLY  ALN+  + +D+ +R     ++  MWNRT+ G    V+ID  G+R +DF+L+D+ D  +G+FQ V  YNG+ +  +++ G +I+W   K   P+D P C F  +   C+    +   +       + +I      F YR+LK + EL A  W I W+ +           Q+S  +  +  T                      GSK  + +                          RGS    +Y SL+T  G       N QVF KT  FKGNIVA+K IN  R+ E T+++L ++K ++D+ N+H+ RFIG C++P +  +V EYCP+GSL+++LEN+ I LDWMF+ SLI DIV+GM +LH S    HG+LKSSNCVVD+RFVLK+TD+GL+ +R      S+ E +H YY + LW +PE+ R +  P  GT KGDVYSF II QE+  RRGVF ++  D   PKEIV+ V   +    RPSL+     S +L +++++ W E+P++RP+F  I   +RK ++   S NILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTSLSA+STP+QV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ H REIARM L  L A+  F I HRP+ QL+LRIG+HSGPVCAGVVG KMPRYCLFGDTVNTSSRMESNG PLKIH+S +T  VL+ F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:    2 VFVCCSPDVFRQLIVHFHKAGLPKEEYVFFYIDIFGHSFRSRPSQPWARGDSDDVFAKEAFQSVKILTYLEPQNQEY--KDFVTDLKSDAKRMFNFTVDDSLMNIISGGFYDGLMLYCHALNE--SLSDSHERPSGESVSKRMWNRTYYGVTGLVQIDENGDRETDFALWDMADINTGDFQIVAVYNGTQKEMNILPGMAIQWPGGK--VPMDVPTCGFKNENPACRARTIAMHQMISIVLFLILIIIFTVTVFIYRKLKLEKELVAQLWRISWDDI-----------QMSHLEKALRST----------------------GSKLTLSL--------------------------RGS----NYGSLLTTDG-------NFQVFAKTGYFKGNIVAIKYINR-RRVELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICIVTEYCPRGSLQNILENDSITLDWMFKYSLISDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSIRT----ESDTEDAHSYYARKLWLAPELSRMECFPPGGTQKGDVYSFGIILQEVALRRGVFYLEG-DLLSPKEIVDRVALGEWPYLRPSLNP-QAHSEELGQLMQRCWAEEPSDRPEFSHISVLLRKQNREHRS-NILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWLLGE 812          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 418/1043 (40.08%), Postives = 594/1043 (56.95%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMER-----LKNYKTEGYKADASSLKEIREK----------LKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFT-GLNPRPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDR-----ITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            AFIGP    +   +   +   +   +++ G     F  + ++ Y  +T     H+ L  +   L + + W                 +S   +S  +M ER     L+   TE ++ + +++  + E+          L  +    RV+ +C +    R +++   +  L   E+VF +ID+F      RP       D  +   + AF+S+ I+    P N EY       DL+  A+  +NF+     +N ++  FY+ +MLY  ALN+  + +D+ +R     ++  MWNRT+ G    V+ID  G+R +DF+L+D+ D  +G+FQ V  YNG+ +  +++ G +I+W   K   P+D P C F  +   C+    +   +       + +I      F YR+LK + EL A  W I W+ +           Q+S  +  +  T                      GSK  + +                          RGS    +Y SL+T  G       N QVF KT  FKGNIVA+K IN  R+ E T+++L ++K ++D+ N+H+ RFIG C++P +  +V EYCP+GSL+++LEN+ I LDWMF+ SLI DIV+GM +LH S    HG+LKSSNCVVD+RFVLK+TD+GL+ +R      S+ E +H YY + LW +PE+ R +  P  GT KGDVYSF II QE+  RRGVF ++  D   PKEIV+ V   +    RPSL+     S +L +++++ W E+P++RP+F  I   +RK ++     +I+      + QYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTSLSA+STP+QV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ H REIARM L  L A+  F I HRP+ QL+LRIG+HSGPVCAGVVG KMPRYCLFGDTVNTSSRMESNG PLKIH+S +T  VL+ F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:  125 AFIGPGCDYTSSPVGLFTA-HWGLPMITAGAPAVAF-LQMEI-YTSITNTGPTHKKLGEYALHLYRHFGW---------------NQHSLLMFSDTKMGERACYFALEGLYTEMHEENITTMDLVFEENKGPVNYSELLHKIQGDGRVVFVCCSPDVFRQLIVHFHKAGLPKEEYVFFYIDIFGHSFRSRPSQPWARGDSDDVFAKEAFQSVKILTYLEPQNQEY--KDFVTDLKSDAKRMFNFTVDDSLMNIISGGFYDGLMLYCHALNE--SLSDSHERPSGESVSKRMWNRTYYGVTGLVQIDENGDRETDFALWDMADINTGDFQIVAVYNGTQKEMNILPGMAIQWPGGK--VPMDVPTCGFKNENPACRARTIAMHQMISIVLFLILIIIFTVTVFIYRKLKLEKELVAQLWRISWDDI-----------QMSHLEKALRST----------------------GSKLTLSL--------------------------RGS----NYGSLLTTDG-------NFQVFAKTGYFKGNIVAIKYINR-RRVELTRKVLFELKHMRDVQNEHLTRFIGACIDPPNICIVTEYCPRGSLQNILENDSITLDWMFKYSLISDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSIRT----ESDTEDAHSYYARKLWLAPELSRMECFPPGGTQKGDVYSFGIILQEVALRRGVFYLEG-DLLSPKEIVDRVALGEWPYLRPSLNP-QAHSEELGQLMQRCWAEEPSDRPEFSHISVLLRKQNRSVPHYSIV------LSQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWLLGE 1060          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: si:dkey-37g12.1 (si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-145])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 402/1034 (38.88%), Postives = 561/1034 (54.26%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTEGYKADASSLKE-----IREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYP---KEELNYVTTSFYESIMLYALALNDLYAKN----DTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLC----KKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYL-HSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            AFIGP+        A+++   +N +++S   A  QF   DK  Y  LTR+ G    L  F  ++ K + W     ++IG+ Y    +++      K   E   N     Y+   SSL +         L  ++ ++R+I+I    K  R +++ A +  L   +FVF   + +        FD +  D  +   + A++++  + L   S+    +   ++  I+R K +F Y     E+++ +    ++++ LYA ALN+  A+N    D L  +T  MWNRT  G    V IDA G+R  ++ +  +   +   Q V  Y G   TY  ++G  I W      PP D+P C F G LC    +K   + G+I G   A    I V+     YR+ K   E   M W I   + + V   +H  S +  K                       +S   Q S E I                 D   A R   ++G           TI  V   N+++T +                           E+L ++K+ +DL + ++C+FIG  +E    +++ EYCPKGSL+D+L+NE I LDW F+ SL+ DIV+GM YL HS    HGHL SS+CVVDSRFVLK+TDFGLN +R +  E S   P  + +  +LW +PE+LR Q++P  GT KGDVYSFAIIAQE++YRRG F + N     P+EIVE V++    P RP +D  + C  +L  ++   W E P  RPDF  I+ +++K      S NILD+LLSRMEQYA NLE +V++RT E  EEKKRAE LL  MLP+SVA QLI  ++V AE+Y+ VTIYFSDI GFT++SA  TPMQV+ +LN LYT FD+II+  +VYKVETIGDAYMVVSGLP  NG +HA+EIARM L  +  +  F  PH P  QL +RIGVHSGP  AGVVG KMPRYCLFGDTVNT+SRMES GLPLKIH+S ST  +L +F+ F    RG++ +KGKG   T+WL GE+
Sbjct:   92 AFIGPSCSNVCAVTAKLAAF-WNIAVISPVCADQQF--LDKKAYPTLTRVFGPFTKLGAFFVEICKQFGW-----QHIGIIYDGKPTWAIPVEGIKYQAEH-NNITVAKYQDIHSSLSQGSTSNWSRVLNEMAQVARIIVISAHGKVVRSLLIEAHKKGLTNGDFVFFCFEPYKQKVLFGSFDWEQGDSYDSMAKQAYQALFFLSLYKPSDKRYQAFSENV--ISRSKIDFGYTYAQTEKVSVLAAIAHDTVWLYAHALNETLAENGNPYDGL-AVTRRMWNRTIKGIQGDVTIDASGDRELNYMMKQIRGSNNQCQVVANYFG---TYKAVKGVQILWPGGLTSPPKDSPDCGFRGELCINLERKFLIALGIIAGLMAAGTLAICVL-----YRKYKLPEEASKMLWTI---NANDVIMMEHHSSTVPEKSH---------------------RSKPLQASLESIICSMQ------------DKPSAHRTAVYKG-----------TICSVSFVNLRSTHL-------------------------NSELLAELKQFRDLTHYNLCKFIGAALETSQPFILTEYCPKGSLQDILQNESIKLDWTFKFSLMLDIVKGMDYLHHSPLQYHGHLSSSSCVVDSRFVLKVTDFGLNSVRRLDTEQS---PGSDPWTALLWRAPELLR-QSIPANGTQKGDVYSFAIIAQEVVYRRGPFYIPN-SHFSPREIVERVRAGGCSPSRPYIDRAE-CVEELESLVVSCWRETPAERPDFSYIRTAIKKNSPHGVSENILDDLLSRMEQYACNLEEIVSERTAELQEEKKRAEGLLTQMLPRSVASQLIAGKTVRAETYDCVTIYFSDIEGFTAMSASLTPMQVVNVLNDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPIRNGDDHAKEIARMSLAIVQGLRSFHSPHVPEQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGDTVNTASRMESYGLPLKIHVSSSTKSLLDTFRNFRCELRGDIHIKGKGWVRTFWLLGED 1027          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: si:dkey-37g12.1 (si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-145])

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 394/1020 (38.63%), Postives = 551/1020 (54.02%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTEGYKADASSLKE-----IREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYP---KEELNYVTTSFYESIMLYALALNDLYAKN----DTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLC----KKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYL-HSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMK 3463
            AFIGP+        A+++   +N +++S   A  QF   DK  Y  LTR+ G    L  F  ++ K + W     ++IG+ Y    +++      K   E   N     Y+   SSL +         L  ++ ++R+I+I    K  R +++ A +  L   +FVF   + +        FD +  D  +   + A++++  + L   S+    +   ++  I+R K +F Y     E+++ +    ++++ LYA ALN+  A+N    D L  +T  MWNRT  G    V IDA G+R  ++ +  +   +   Q V  Y G   TY  ++G  I W      PP D+P C F G LC    +K   + G+I G   A    I V+     YR+ K   E   M W I   + + V   +H  S +  K                       +S   Q S E I                 D   A R   ++G           TI  V   N+++T +                           E+L ++K+ +DL + ++C+FIG  +E    +++ EYCPKGSL+D+L+NE I LDW F+ SL+ DIV+GM YL HS    HGHL SS+CVVDSRFVLK+TDFGLN +R +  E S   P  + +  +LW +PE+LR Q++P  GT KGDVYSFAIIAQE++YRRG F + N     P+EIVE V++    P RP +D  + C  +L  ++   W E P  RPDF  I+ +++K      S NILD+LLSRMEQYA NLE +V++RT E  EEKKRAE LL  MLP+SVA QLI  ++V AE+Y+ VTIYFSDI GFT++SA  TPMQV+ +LN LYT FD+II+  +VYKVETIGDAYMVVSGLP  NG +HA+EIARM L  +  +  F  PH P  QL +RIGVHSGP  AGVVG KMPRYCLFGDTVNT+SRMES GLPLKIH+S ST  +L +F+ F    RG++ +K
Sbjct:   92 AFIGPSCSNVCAVTAKLAAF-WNIAVISPVCADQQF--LDKKAYPTLTRVFGPFTKLGAFFVEICKQFGW-----QHIGIIYDGKPTWAIPVEGIKYQAEH-NNITVAKYQDIHSSLSQGSTSNWSRVLNEMAQVARIIVISAHGKVVRSLLIEAHKKGLTNGDFVFFCFEPYKQKVLFGSFDWEQGDSYDSMAKQAYQALFFLSLYKPSDKRYQAFSENV--ISRSKIDFGYTYAQTEKVSVLAAIAHDTVWLYAHALNETLAENGNPYDGL-AVTRRMWNRTIKGIQGDVTIDASGDRELNYMMKQIRGSNNQCQVVANYFG---TYKAVKGVQILWPGGLTSPPKDSPDCGFRGELCINLERKFLIALGIIAGLMAAGTLAICVL-----YRKYKLPEEASKMLWTI---NANDVIMMEHHSSTVPEKSH---------------------RSKPLQASLESIICSMQ------------DKPSAHRTAVYKG-----------TICSVSFVNLRSTHL-------------------------NSELLAELKQFRDLTHYNLCKFIGAALETSQPFILTEYCPKGSLQDILQNESIKLDWTFKFSLMLDIVKGMDYLHHSPLQYHGHLSSSSCVVDSRFVLKVTDFGLNSVRRLDTEQS---PGSDPWTALLWRAPELLR-QSIPANGTQKGDVYSFAIIAQEVVYRRGPFYIPN-SHFSPREIVERVRAGGCSPSRPYIDRAE-CVEELESLVVSCWRETPAERPDFSYIRTAIKKNSPHGVSENILDDLLSRMEQYACNLEEIVSERTAELQEEKKRAEGLLTQMLPRSVASQLIAGKTVRAETYDCVTIYFSDIEGFTAMSASLTPMQVVNVLNDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPIRNGDDHAKEIARMSLAIVQGLRSFHSPHVPEQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGDTVNTASRMESYGLPLKIHVSSSTKSLLDTFRNFRCELRGDIHIK 1013          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr2 (natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-141030-2])

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 309/537 (57.54%), Postives = 383/537 (71.32%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNY-GCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            S    SY SL+T  G         Q+F KT  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RFIG C++P +  +V EYCP+GSL+D+LENE INLDWMFR SLI DIV+GM YLH++Y G HG+LKSSNCVVDSRFVLK+TD+GL   R     +   E SH  Y K LWT+PE+L     P  GT KGDVYSF II QEI  R G F V+  D   PKEI++ V++ +   FRP+ D    C  +L  +++  W EDP  RPDF  IK  + K +K  +    L   LSRMEQYANNLE LV +RTQ YLEEK++AE+LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTS+SA+STP+QV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HAREIA M L  L  +  F I HRPN QL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMES G  L+IH+S +T EVL  F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:  525 SQRGSSYGSLITAHG-------KYQLFAKTGYFKGNLVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNYLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLASFRS----SCENEDSHALYAKKLWTAPELLIYDRHPPQGTQKGDVYSFGIILQEIALRNGPFYVEGMD-LSPKEIIQKVRNGQKPYFRPTTDNSRHCE-ELTILMEGCWSEDPAERPDFSHIKVFIAKFNKQHQYSQYL---LSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIAGMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALRIHMSSATKEVLDEFGYFELQLRGDVEMKGKGKMRTYWLLGE 1044          

HSP 2 Score: 140.198 bits (352), Expect = 4.708e-33
Identity = 126/475 (26.53%), Postives = 220/475 (46.32%), Query Frame = 2
Query:  314 EKLKKKGELQGFANYSLKLFFSESS-TVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYS-AKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGA-SKYTRLIMLAAVEIKLDLSEFVFIHIDLF----TGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYA----KNDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
            EK++K G L+G     L     +SS + SE++  +      +  +P  AFIGP    S+ ++ R + + +   L++ G   Y F+  +  +++ + R     + L +F+  L   + W  R          DD+ +  YF S     + R +N     +  +       ++ +  +    R++ ICG    + +++ L   E+K    ++   ++D+F    +G  P PW  Q S  + N+ ++  F+S+ +V    P + EY  ++   +L K A + +N       ++++   F++  +LYA AL++  A    +ND ++ IT  M NR   G    V ID +  R +DFSL+ + + KSG +  VG YNG+++       + I+W   K  PPLD P C F  S CK+D      I    +    +I  I  F  YR+LK + EL  M W I WE L      K+ +   SR
Sbjct:   64 EKIQKSGLLRGHTINLLNFSTEDSSGSCSENEAQIIAVDTKLYHKP-DAFIGPGCTYSVASVGRFA-SHWKLPLITAGGPAYGFDKWE--EFKTIVRTGPTTKKLGDFVNYLHGQFNWSSRALMIFHDLKQDDRPH--YFLSEGIYTVLREENITVLAFPYEDEQTYNYKDMITFIKDNGRIVYICGPLPTFFQIMKLFEDEVK-SPEDYAIFYLDVFAESLSGDVPMPW--QGSDIQWNDPIK-LFQSVFVVTYQEPDSPEY--TAFRKELHKRAIQDFNVQLEPSMMDFIAGCFHDGFVLYAKALSEALADGVSQNDGIN-ITARMQNRRLWGVTGLVSIDQKNARFTDFSLWAMTNLKSGQYAIVGHYNGTSKEILWSPTEKIQW--PKGCPPLDYPPCGF--SPCKEDHLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRIRWEELQFESPNKYHKRAGSR 521          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 308/533 (57.79%), Postives = 387/533 (72.61%), Query Frame = 2
Query: 1874 RNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGK 3469
            R  K RGS    SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RF+G C++P +  +V EYCP+GSL+D+LENE INLDWMFR SLI DIV+GM +LH S  G HG+LKSSNCVVDSRFVLK+TD+GL   R     +   + ++  Y K LWT+PE+LR    P  GT KGDVYSF II QEI  R G F +   D   PKEIV+ V++ +   FRP++D I   S +L  ++ + W E+P +RPDF  IK  + K +K + S +ILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE+LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTS+SA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ H REIARM L  L A+  F I HRPNTQL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  L+IHIS +T EVL  F  F +  RG++EMK K
Sbjct:   87 RYHKTRGS----SYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRS----SCEADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMD-LSPKEIVQKVRNGQRPYFRPTVD-ISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNK-EGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 600          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 304/526 (57.79%), Postives = 383/526 (72.81%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGK 3469
            S    SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RF+G C++P +  +V EYCP+GSL+D+LENE INLDWMFR SLI DIV+GM +LH S  G HG+LKSSNCVVDSRFVLK+TD+GL   R     +   + ++  Y K LWT+PE+LR    P  GT KGDVYSF II QEI  R G F +   D   PKEIV+ V++ +   FRP++D I   S +L  ++ + W E+P +RPDF  IK  + K +K + S +ILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE+LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTS+SA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ H REIARM L  L A+  F I HRPNTQL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  L+IHIS +T EVL  F  F +  RG++EMK K
Sbjct:  167 SLRGSSYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRS----SCEADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMD-LSPKEIVQKVRNGQRPYFRPTVD-ISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNK-EGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 677          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 304/526 (57.79%), Postives = 383/526 (72.81%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGK 3469
            S    SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RF+G C++P +  +V EYCP+GSL+D+LENE INLDWMFR SLI DIV+GM +LH S  G HG+LKSSNCVVDSRFVLK+TD+GL   R     +   + ++  Y K LWT+PE+LR    P  GT KGDVYSF II QEI  R G F +   D   PKEIV+ V++ +   FRP++D I   S +L  ++ + W E+P +RPDF  IK  + K +K + S +ILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE+LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTS+SA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ H REIARM L  L A+  F I HRPNTQL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  L+IHIS +T EVL  F  F +  RG++EMK K
Sbjct:   37 SLRGSSYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRS----SCEADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMD-LSPKEIVQKVRNGQRPYFRPTVD-ISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNK-EGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 547          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 304/526 (57.79%), Postives = 383/526 (72.81%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGK 3469
            S    SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RF+G C++P +  +V EYCP+GSL+D+LENE INLDWMFR SLI DIV+GM +LH S  G HG+LKSSNCVVDSRFVLK+TD+GL   R     +   + ++  Y K LWT+PE+LR    P  GT KGDVYSF II QEI  R G F +   D   PKEIV+ V++ +   FRP++D I   S +L  ++ + W E+P +RPDF  IK  + K +K + S +ILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE+LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTS+SA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ H REIARM L  L A+  F I HRPNTQL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  L+IHIS +T EVL  F  F +  RG++EMK K
Sbjct:  122 SLRGSSYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRS----SCEADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMD-LSPKEIVQKVRNGQRPYFRPTVD-ISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNK-EGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 632          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: NPR2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100488543])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 304/526 (57.79%), Postives = 383/526 (72.81%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGK 3469
            S    SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RF+G C++P +  +V EYCP+GSL+D+LENE INLDWMFR SLI DIV+GM +LH S  G HG+LKSSNCVVDSRFVLK+TD+GL   R     +   + ++  Y K LWT+PE+LR    P  GT KGDVYSF II QEI  R G F +   D   PKEIV+ V++ +   FRP++D I   S +L  ++ + W E+P +RPDF  IK  + K +K + S +ILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE+LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTS+SA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ H REIARM L  L A+  F I HRPNTQL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  L+IHIS +T EVL  F  F +  RG++EMK K
Sbjct:  195 SLRGSSYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFLGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRNSLINDIVKGMCFLHRSIIGSHGNLKSSNCVVDSRFVLKITDYGLASFRS----SCEADDAYALYAKKLWTAPELLRMTRPPAPGTQKGDVYSFGIILQEIALRNGCFYIQGMD-LSPKEIVQKVRNGQRPYFRPTVD-ISCHSEELGILMDRCWAEEPLDRPDFNQIKAYICKFNK-EGSTSILDNLLSRMEQYANNLEKLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTREIARMSLALLEAVRTFKIRHRPNTQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHISSATKEVLDEFSCFQLELRGDIEMKVK 705          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr1 (natriuretic peptide receptor 1 [Source:MGI Symbol;Acc:MGI:97371])

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 308/537 (57.36%), Postives = 392/537 (73.00%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSN-YGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            S    +Y SL+T  G         QVF KTA +KGN+VA+K++N  ++ E T+++L ++K ++D+ N+H+ RF+G C +P +  ++ EYCP+GSL+D+LENE I LDWMFR SL  DIV+GM++LH+   G HG+LKSSNCVVD RFVLK+TD+GL   R+ + E       H  + K LWT+PE+LR  + P  G+  GDVYSF II QEI  R GVF V+  D   PKEI+E V   +  PFRPS+D +     +L +++++ W EDP  RP F  I+ ++RK +K + S NILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD++I+NFDVYKVETIGDAYMVVSGLP  NG+ HARE+ARM L  L A+  F I HRP  QL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  L+IH+S  T  VL+ F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:  530 SGRGSNYGSLLTTEG-------QFQVFAKTAYYKGNLVAVKRVNR-KRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEPEQG-----HTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLS-PKEIIERVTRGEQPPFRPSMD-LQSHLEELGQLMQRCWAEDPQERPPFQQIRLALRKFNK-ENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE 1050          

HSP 2 Score: 166.392 bits (420), Expect = 3.388e-41
Identity = 134/500 (26.80%), Postives = 227/500 (45.40%), Query Frame = 2
Query:  275 KLGPITDLALARIEKLKKKGELQGFANYSLKLFFSES---STVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYID----DKS----YSDYFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF-------TGLNPR-PWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTL---DRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGS--LCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
            ++GP  +LAL R+   K + +L     +++++    S   + V               +     F+GP  + S   + R +   +   L++ G        KD  +Y   TR   +H  L +F+  L +   W    H+ + V Y D    D+         +   +E +    N++ E  + D     ++   L+ +    RVI IC +    R +ML A++  L   ++VF H+D+F        G  PR PW   +  D  +   R AF++  I+  K P N EY        L+ +A +K+NF+      N +  SF++ ++LY  A+ +  A+  T+   + IT  MWNR+F G    +KID  G+R +DFSL+D+DP++G F+ V  +NG+++    +    + W      PP D PKC FD     C +D  ST  +     +   V  +I  FF YR+++ + EL +  W + WE L      +H +S  SR
Sbjct:   50 RVGPAVELALGRV---KARPDL--LPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTA-HWRVPLLTAGAPALGIGVKD--EYALTTRTGPSHVKLGDFVTALHRRLGW---EHQAL-VLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQ-EFVEGDPDHYTKL---LRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPW---ERDDGQDRRARQAFQAAKIITYKEPDNPEYLE--FLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYW--PLGYPPPDIPKCGFDNEDPACNQDHFSTLEVLALVGSLSLVSFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSR 526          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 312/551 (56.62%), Postives = 392/551 (71.14%), Query Frame = 2
Query: 1886 HRGSAS-------NESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNY-GCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEP--SHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESG-NILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            H+G+ S         SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RFIG C++P +  +V EYCP+GSL+D+LEN+ INLDWMFR SLI D+V+GM +LH++    HG LKSSNCVVDSRFVLK+TD+GL   R      S  EP  SH  Y K LWT+PE+L    LP  G  K DVYSFAII QEI  R G F ++  D   PKEIV+ V++ +   FRPS+D     + +L+ ++++ W +DP  RPDF  IK  +R+ +K  E G +ILDNLL RMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HA EIARM L  L A+  F I HRP+ QL LRIGVH+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S +T + L     F +  RG+VEMKGKGK  TYWL GE 
Sbjct:  508 HKGAGSRLTLSLRGSSYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFR------STAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLS-PKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNK--EGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQ 1040          

HSP 2 Score: 151.754 bits (382), Expect = 1.150e-36
Identity = 113/431 (26.22%), Postives = 196/431 (45.48%), Query Frame = 2
Query:  458 FIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYS-DYFYSAKEMMERLKNYK-TEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF--------TGLNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLD---RITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFD--GSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
             +GP  +    ++AR + + +   L++ G     F  K++  Y+ L R   +   L  F+  L   + W  R      + Y+D ++    ++++ + + E L+    +  ++  A       +    + +  R++ ICG  +    I+L A    L   ++VF ++D+F        T    RPW D ++ ++  +++R AF+++L++  + P N EY      N L   ARE +        +N +   FY+ I+LYA  LN+   +  T +   RI   M  R ++G    V +D   +R +DF L+ + D  SG+FQ    Y+G+ E      G+ I W   K  PPLD P CAFD     C K   ST  I    T   F++  +  F  +R+L  + EL +M W I WE L      ++ +   SR
Sbjct:   96 LLGPGCVYPAASVARFA-SHWRLPLLTAGAVASGFAAKNE-HYRTLVRTGPSAPKLGEFVVTLHGHFNWTAR----AALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTQEQA-QALREAFQTVLVITYREPPNPEY--QEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGA-EKQIWWTGRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSDRYHKGAGSR 514          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 312/551 (56.62%), Postives = 392/551 (71.14%), Query Frame = 2
Query: 1886 HRGSAS-------NESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNY-GCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEP--SHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESG-NILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            H+G+ S         SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RFIG C++P +  +V EYCP+GSL+D+LEN+ INLDWMFR SLI D+V+GM +LH++    HG LKSSNCVVDSRFVLK+TD+GL   R      S  EP  SH  Y K LWT+PE+L    LP  G  K DVYSFAII QEI  R G F ++  D   PKEIV+ V++ +   FRPS+D     + +L+ ++++ W +DP  RPDF  IK  +R+ +K  E G +ILDNLL RMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HA EIARM L  L A+  F I HRP+ QL LRIGVH+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S +T + L     F +  RG+VEMKGKGK  TYWL GE 
Sbjct:   74 HKGAGSRLTLSLRGSSYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFR------STAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLD-LSPKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNK--EGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQ 606          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 497.664 bits (1280), Expect = 6.183e-157
Identity = 259/474 (54.64%), Postives = 333/474 (70.25%), Query Frame = 2
Query: 1886 HRGSAS-------NESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNY-GCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEP--SHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESG-NILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSG 3274
            H+G+ S         SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RFIG C++P +  +V EYCP+GSL+D+LEN+ INLDWMFR SLI D+V+GM +LH++    HG LKSSNCVVDSRFVLK+TD+GL   R      S  EP  SH  Y K LWT+PE+L    LP  G  K DVYSFAII QEI  R G F ++  D   PKEIV+ V++ +   FRPS+D     + +L+ ++++ W +DP  RPDF  IK  +R+ +K  E G +ILDNLL RMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HA EIARM L  L A+  F I HRP+ QL LRIGVH+G
Sbjct:  508 HKGAGSRLTLSLRGSSYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFR------STAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLS-PKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNK--EGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTG 963          

HSP 2 Score: 151.369 bits (381), Expect = 1.416e-36
Identity = 113/431 (26.22%), Postives = 196/431 (45.48%), Query Frame = 2
Query:  458 FIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYS-DYFYSAKEMMERLKNYK-TEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF--------TGLNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLD---RITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFD--GSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
             +GP  +    ++AR + + +   L++ G     F  K++  Y+ L R   +   L  F+  L   + W  R      + Y+D ++    ++++ + + E L+    +  ++  A       +    + +  R++ ICG  +    I+L A    L   ++VF ++D+F        T    RPW D ++ ++  +++R AF+++L++  + P N EY      N L   ARE +        +N +   FY+ I+LYA  LN+   +  T +   RI   M  R ++G    V +D   +R +DF L+ + D  SG+FQ    Y+G+ E      G+ I W   K  PPLD P CAFD     C K   ST  I    T   F++  +  F  +R+L  + EL +M W I WE L      ++ +   SR
Sbjct:   96 LLGPGCVYPAASVARFA-SHWRLPLLTAGAVASGFAAKNE-HYRTLVRTGPSAPKLGEFVVTLHGHFNWTAR----AALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTQEQA-QALREAFQTVLVITYREPPNPEY--QEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGA-EKQIWWTGRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSDRYHKGAGSR 514          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2g (guanylate cyclase 2g [Source:MGI Symbol;Acc:MGI:106025])

HSP 1 Score: 446.817 bits (1148), Expect = 3.280e-137
Identity = 250/560 (44.64%), Postives = 361/560 (64.46%), Query Frame = 2
Query: 1886 HRG---SASNESYMSLVTIS---GVQLENIQNTQVFIK-TALFKGNIVALKKINTGRKFETTKEMLL-DIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENS-NEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKH-VPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPE 3532
            HRG   S  N S  S V  S   G  ++  Q+ ++F     L++GN VAL  I    +    K  +  ++  + +L +++I  F G+C EP +  +V +YC KGSL+D++ N    +DW+F+LS   DIV G+++LH S    HG+LK SNC+VDS   LKL+ FGL   +      S N+E +   + ++ WT+PE+LR +  P  GT +GDVYSFAI+ +++I+++     ++ ++  P+EI+  +K  +  VP RPSL E  G    ++ ++++ WDE P  RP FP IK ++R+    +   +ILD+++ ++E YAN+LE +V +RT+E + EK++ E LL +MLP  V  QLI  +SV  E +E VTI+FSDIVGFT L + S+P+QV++LLN LY+ FD  I++ DVYKVETIGDAYMV SGLP  NG  HA EIA M L  LS    F I H P  +L+LRIG+H+GPV AGVVG  MPRYCLFGDTVN +SRMES+ LPL+IH+S ST   L +   + + +RG + +KGKG+Q T+WL G++ F V P+PE
Sbjct:  535 HRGTPVSRRNVSDTSTVKASADCGSLVKRHQDEELFFAPVGLYQGNQVALCYIGDEAEAWVKKPTVRREVCLMCELKHENIVPFFGVCTEPPNICIVTQYCKKGSLQDVMRNSDHEIDWIFKLSFAYDIVNGLLFLHGSPLRSHGNLKPSNCLVDSHMQLKLSGFGLWEFKHGSTWRSYNQEATD--HSELYWTAPELLRLRESPCSGTPQGDVYSFAILLRDLIHQQAHGPFEDLEAA-PEEIISRIKDPRAPVPLRPSLLEDKG-DGRIVALVRECWDESPELRPIFPSIKKTLREASP-RGHVSILDSMMGKLETYANHLEEVVEERTRELVAEKRKVEKLLSTMLPSFVGEQLIAGKSVEPEHFESVTIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFDHTIQSHDVYKVETIGDAYMVASGLPIRNGAQHADEIATMALHLLSVTTHFQIGHMPEERLKLRIGLHTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTAGALLAAGGYHLQKRGTISVKGKGEQTTFWLKGKDGFPV-PLPE 1088          

HSP 2 Score: 81.6481 bits (200), Expect = 4.793e-15
Identity = 114/500 (22.80%), Postives = 204/500 (40.80%), Query Frame = 2
Query:  323 KKKGELQGFANYSLKLFFSESSTVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVF--YIDDKSYS--DYFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGND-LRK-----IAREKYNFSYPKE-ELNYVTTSFYESIMLYALALNDLY-AKNDTLDR----ITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEP------PLDTPKCAFDGSLCKKDG--------TSTGLIFGCTTAALFVIGVIGGFFAYR-RLKFQAELKAMNWIIPWESLDTVEKRK--HRQSQISRKDSTVNETL 1723
            K   E  G  N S +  ++ S+  ++    +  F   +  E + A  GP    +   I  ++ + +N  L      G     KD         +    + ++  + + L++  W     ++IGVF     D S+   D  + A E   +     T   + ++SS   ++E L+ +S ++RVII+  +S+  R I+ AAV++ LD  EFVFI   L   L    W +  + D+V       + S+ ++        +   IG+D  RK     + R  +  S   E +++  +   +++++LYA  + ++  A+ D  D      T      T  G   PV +D++G R  D+S++ L         + F +     Y   +     W N+ N        P   P C F   LCK           T T +I   T   L     I G   +R R K Q+      W I ++S+  + + K  HR + +SR++ +   T+
Sbjct:   75 KLNSEPVGLGNVSWEFTYTNSTCSAKES--LAVFIDQVQKEHISALFGPACPEAAEVIGLLA-SEWNIPLFDF--VGQMAALKDHFWCDTCVTLVPPKQEISAVLRESLRYLGW-----EHIGVFGGSSADSSWEQVDEMWGAVEDGLQFHFNITASMRYNSSSSDLLQEGLRNMSYVARVIILICSSEDARRILQAAVDLGLDTGEFVFI---LLQQLEDSFWKEVLTKDKVIR-FPKVYESVFLIA----PSAYGGGIGDDGFRKQVSQELRRPPFQSSITSEDQVSPYSAYLHDALLLYAQTVEEMRKAEKDFRDGRQLISTLRAGQVTLQGITGPVLLDSQGKRHVDYSVYALQESGNRSLFLPFLH-----YDSFQKVIRPWRNDSNTSWPHGSLPEYKPGCGFHNDLCKTKPPTVAGMTVTVTAVIPTVTFLVLASAAAITGLMLWRLRGKVQSHPGDTWWQIRYDSITLLPQHKLSHRGTPVSRRNVSDTSTV 551          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18910|ANPRA_RAT (Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1)

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 309/537 (57.54%), Postives = 392/537 (73.00%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGC-HGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            S    +Y SL+T  G         QVF KTA +KGN+VA+K++N  ++ E T+++L ++K ++D+ N+H+ RF+G C +P +  ++ EYCP+GSL+D+LENE I LDWMFR SL  DIV+GM++LH+   C HG+LKSSNCVVD RFVLK+TD+GL   R+ + E       H  + K LWT+PE+LR  + P  G+  GDVYSF II QEI  R GVF V+  D   PKEI+E V   +  PFRPS+D +     +L +++++ W EDP  RP F  I+ ++RK +K + S NILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD++I+NFDVYKVETIGDAYMVVSGLP  NG+ HARE+ARM L  L A+  F I HRP  QL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S  T  VL+ F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:  530 SGRGSNYGSLLTTEG-------QFQVFAKTAYYKGNLVAVKRVNR-KRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEPEQG-----HTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLS-PKEIIERVTRGEQPPFRPSMD-LQSHLEELGQLMQRCWAEDPQERPPFQQIRLALRKFNK-ENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE 1050          

HSP 2 Score: 171.014 bits (432), Expect = 8.511e-42
Identity = 136/500 (27.20%), Postives = 229/500 (45.80%), Query Frame = 2
Query:  275 KLGPITDLALARIEKLKKKGELQGFANYSLKLFFSES---STVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYID----DKS----YSDYFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF-------TGLNP-RPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTL---DRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGS--LCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
            ++GP  +LALAR+   K + +L     +++++    S   + V               +     F+GP  + S   + R +   +   L++ G        KD  +Y   TR   +H  L +F+  L +   W    H+ + V Y D    D+         +   +E +    N++ E  + D     ++   L+ +    RVI IC +    R +ML A+   L   ++VF H+D+F        GL P +PW   +  D  + S R AF++  I+  K P N EY        L+ +A +K+NF+      N +  SF++ ++LY  A+ +  A+  T+   + IT  MWNR+F G    +KID  G+R +DFSL+D+DP++G F+ V  YNG+++    +    + W      PP D PKC FD     C +D  ST  +     +   +  +I  FF YR+++ + EL +  W + WE L      +H +S  SR
Sbjct:   50 RVGPAVELALARV---KARPDL--LPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTA-HWRVPLLTAGAPALGIGVKD--EYALTTRTGPSHVKLGDFVTALHRRLGW---EHQAL-VLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQ-EFVEGDPDHYPKL---LRAVRRKGRVIYICSSPDAFRNLMLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPW---ERGDGQDRSARQAFQAAKIITYKEPDNPEYLE--FLKQLKLLADKKFNFTVEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYW--PLGYPPPDVPKCGFDNEDPACNQDHFSTLEVLALVGSLSLISFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSR 526          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18293|ANPRA_MOUSE (Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 308/537 (57.36%), Postives = 392/537 (73.00%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSN-YGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            S    +Y SL+T  G         QVF KTA +KGN+VA+K++N  ++ E T+++L ++K ++D+ N+H+ RF+G C +P +  ++ EYCP+GSL+D+LENE I LDWMFR SL  DIV+GM++LH+   G HG+LKSSNCVVD RFVLK+TD+GL   R+ + E       H  + K LWT+PE+LR  + P  G+  GDVYSF II QEI  R GVF V+  D   PKEI+E V   +  PFRPS+D +     +L +++++ W EDP  RP F  I+ ++RK +K + S NILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD++I+NFDVYKVETIGDAYMVVSGLP  NG+ HARE+ARM L  L A+  F I HRP  QL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  L+IH+S  T  VL+ F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:  530 SGRGSNYGSLLTTEG-------QFQVFAKTAYYKGNLVAVKRVNR-KRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEPEQG-----HTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLS-PKEIIERVTRGEQPPFRPSMD-LQSHLEELGQLMQRCWAEDPQERPPFQQIRLALRKFNK-ENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE 1050          

HSP 2 Score: 166.392 bits (420), Expect = 2.370e-40
Identity = 134/500 (26.80%), Postives = 227/500 (45.40%), Query Frame = 2
Query:  275 KLGPITDLALARIEKLKKKGELQGFANYSLKLFFSES---STVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYID----DKS----YSDYFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF-------TGLNPR-PWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTL---DRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGS--LCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
            ++GP  +LAL R+   K + +L     +++++    S   + V               +     F+GP  + S   + R +   +   L++ G        KD  +Y   TR   +H  L +F+  L +   W    H+ + V Y D    D+         +   +E +    N++ E  + D     ++   L+ +    RVI IC +    R +ML A++  L   ++VF H+D+F        G  PR PW   +  D  +   R AF++  I+  K P N EY        L+ +A +K+NF+      N +  SF++ ++LY  A+ +  A+  T+   + IT  MWNR+F G    +KID  G+R +DFSL+D+DP++G F+ V  +NG+++    +    + W      PP D PKC FD     C +D  ST  +     +   V  +I  FF YR+++ + EL +  W + WE L      +H +S  SR
Sbjct:   50 RVGPAVELALGRV---KARPDL--LPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTA-HWRVPLLTAGAPALGIGVKD--EYALTTRTGPSHVKLGDFVTALHRRLGW---EHQAL-VLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQ-EFVEGDPDHYTKL---LRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPW---ERDDGQDRRARQAFQAAKIITYKEPDNPEYLE--FLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYW--PLGYPPPDIPKCGFDNEDPACNQDHFSTLEVLALVGSLSLVSFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSR 526          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P16066|ANPRA_HUMAN (Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 313/557 (56.19%), Postives = 397/557 (71.27%), Query Frame = 2
Query: 1850 DIDPMVAIRNGKHRGS-----ASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGC-HGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            D++P    R+ +  GS         +Y SL+T  G         QVF KTA +KGN+VA+K++N  ++ E T+++L ++K ++D+ N+H+ RF+G C +P +  ++ EYCP+GSL+D+LENE I LDWMFR SL  DIV+GM++LH+   C HG+LKSSNCVVD RFVLK+TD+GL   R++  E       H  Y K LWT+PE+LR  + P  G+  GDVYSF II QEI  R GVF V+  D   PKEI+E V   +  PFRPSL  +     +L  ++++ W EDP  RP F  I+ ++RK ++ + S NILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD++I+NFDVYKVETIGDAYMVVSGLP  NGR HA E+ARM L  L A+  F I HRP  QL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S  T  VL+ F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:  514 DVEPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEG-------QFQVFAKTAYYKGNLVAVKRVNR-KRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDYGLESFRDLDPEQG-----HTVYAKKLWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLD-LSPKEIIERVTRGEQPPFRPSL-ALQSHLEELGLLMQRCWAEDPQERPPFQQIRLTLRKFNR-ENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGE 1054          

HSP 2 Score: 179.874 bits (455), Expect = 1.698e-44
Identity = 122/429 (28.44%), Postives = 208/429 (48.48%), Query Frame = 2
Query:  458 FIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLK---NYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFT-----GLNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTL---DRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDG--SLCKKDGTSTGLIFGCTTAALFVIGV-IGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
            F+GP  + +   + R +   +   L++ G     F  KD  +Y   TR   ++  L +F+  L +   W  R    +  +   D+ +   F+  + +  R++   N   +  +     L      L+ +    RVI IC +    R +ML A+E  L   ++VF H+D+F      G  P P    +  D  + S R AF++  I+  K P N EY        L+ +A E++NF+     +N +  SF++ ++LY  A+ +  A   T+   + IT  MWNR+F G    +KID+ G+R +DFSL+D+DP++G F+ V  YNG+++    + G+ + W      PP D PKC FD     C +D  ST  +      +L ++G+ I  FF YR+++ + EL +  W + WE ++     +H +S  SR
Sbjct:  113 FLGPGCVYAAAPVGRFT-AHWRVPLLTAGAPALGFGVKD--EYALTTRAGPSYAKLGDFVAALHRRLGW-ERQALMLYAYRPGDEEHC--FFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDVSARQAFQAAKIITYKDPDNPEYLE--FLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLYIQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAFRVVLNYNGTSQELVAVSGRKLNW--PLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLAL-VGSLSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSR 530          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|Q6VVW5|ANPRB_MOUSE (Atrial natriuretic peptide receptor 2 OS=Mus musculus OX=10090 GN=Npr2 PE=1 SV=2)

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 312/551 (56.62%), Postives = 392/551 (71.14%), Query Frame = 2
Query: 1886 HRGSAS-------NESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNY-GCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEP--SHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESG-NILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            H+G+ S         SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RFIG C++P +  +V EYCP+GSL+D+LEN+ INLDWMFR SLI D+V+GM +LH++    HG LKSSNCVVDSRFVLK+TD+GL   R      S  EP  SH  Y K LWT+PE+L    LP  G  K DVYSFAII QEI  R G F ++  D   PKEIV+ V++ +   FRPS+D     + +L+ ++++ W +DP  RPDF  IK  +R+ +K  E G +ILDNLL RMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HA EIARM L  L A+  F I HRP+ QL LRIGVH+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S +T + L     F +  RG+VEMKGKGK  TYWL GE 
Sbjct:  508 HKGAGSRLTLSLRGSSYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFR------STAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLS-PKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNK--EGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQ 1040          

HSP 2 Score: 151.754 bits (382), Expect = 8.042e-36
Identity = 113/431 (26.22%), Postives = 196/431 (45.48%), Query Frame = 2
Query:  458 FIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYS-DYFYSAKEMMERLKNYK-TEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF--------TGLNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLD---RITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFD--GSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
             +GP  +    ++AR + + +   L++ G     F  K++  Y+ L R   +   L  F+  L   + W  R      + Y+D ++    ++++ + + E L+    +  ++  A       +    + +  R++ ICG  +    I+L A    L   ++VF ++D+F        T    RPW D ++ ++  +++R AF+++L++  + P N EY      N L   ARE +        +N +   FY+ I+LYA  LN+   +  T +   RI   M  R ++G    V +D   +R +DF L+ + D  SG+FQ    Y+G+ E      G+ I W   K  PPLD P CAFD     C K   ST  I    T   F++  +  F  +R+L  + EL +M W I WE L      ++ +   SR
Sbjct:   96 LLGPGCVYPAASVARFA-SHWRLPLLTAGAVASGFAAKNE-HYRTLVRTGPSAPKLGEFVVTLHGHFNWTAR----AALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTQEQA-QALREAFQTVLVITYREPPNPEY--QEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGA-EKQIWWTGRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSDRYHKGAGSR 514          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P16067|ANPRB_RAT (Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 312/550 (56.73%), Postives = 392/550 (71.27%), Query Frame = 2
Query: 1886 HRGSAS-------NESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNY-GCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEP--SHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESG-NILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            H+G+ S         SY SL+T  G         Q+F  T  FKGN+VA+K +N  ++ E T+++L ++K ++D+  +H+ RFIG C++P +  +V EYCP+GSL+D+LEN+ INLDWMFR SLI D+V+GM +LH++    HG LKSSNCVVDSRFVLK+TD+GL   R      S  EP  SH  Y K LWT+PE+L    LP  G  K DVYSFAII QEI  R G F ++  D   PKEIV+ V++ +   FRPS+D     + +L+ ++++ W +DP  RPDF  IK  +R+ +K  E G +ILDNLL RMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HA EIARM L  L A+  F I HRP+ QL LRIGVH+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S +T + L     F +  RG+VEMKGKGK  TYWL GE
Sbjct:  508 HKGAGSRLTLSLRGSSYGSLMTAHG-------KYQIFANTGHFKGNVVAIKHVNK-KRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLASFR------STAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLD-LSPKEIVQKVRNGQRPYFRPSIDRTQ-LNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNK--EGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGE 1039          

HSP 2 Score: 150.599 bits (379), Expect = 2.018e-35
Identity = 113/434 (26.04%), Postives = 200/434 (46.08%), Query Frame = 2
Query:  458 FIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYS-DYFYSAKEMMERLK----NYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF--------TGLNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLD---RITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFD--GSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
             +GP  +    ++AR + + ++  L++ G     F  K++  Y+ L R   +   L  F+  L   + W  R      + Y+D ++    ++++ + + E L+    + + + Y  +    ++       + +  R++ ICG  +    I+L A    L   ++VF ++D+F        T    RPW D ++ ++  +++R AF+++L++  + P N EY      N L   ARE +        +N +   FY+ I+LYA  LN+   +  T +   RI   M  R ++G    V +D   +R +DF L+ + D +SG+FQ    Y+G+ E      G+ I W   K  PPLD P CAFD     C K   ST  I    T   F++  +  F  +R+L  + EL +M W I WE L      ++ +   SR
Sbjct:   96 LLGPGCVYPAASVARFA-SHWHLPLLTAGAVASGFAAKNE-HYRTLVRTGPSAPKLGEFVVTLHGHFNWTAR----AALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVYTREPGGPEQ---ATHFIRANGRIVYICGPLEMLHEILLQAQRENLTNGDYVFFYLDVFGESLRAGPTRATGRPWQDNRTQEQA-QALREAFQTVLVITYREPPNPEY--QEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAQVLNETIQEGGTREDGLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLESGDFQPAAHYSGA-EKQIWWTGRPIPW--VKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSDRYHKGAGSR 514          
BLAST of Guanylate cyclase vs. TrEMBL
Match: G4V651 (Guanylate cyclase OS=Schistosoma mansoni OX=6183 GN=Smp_142620 PE=3 SV=1)

HSP 1 Score: 964.526 bits (2492), Expect = 0.000e+0
Identity = 506/1053 (48.05%), Postives = 672/1053 (63.82%), Query Frame = 2
Query:  449 VHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTE------GYKADASSLKE---IREK-LKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNP--RPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDR---ITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDG-TSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRT--QTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPESAKII 3547
            V+   GP +  +L   AR S   +N  +V+   AG+  +  DK++Y  LTR+   +  L    G  LK Y WLP     I +    +    +       M    ++   +       YK  + +L +   + ++ LK L   +R+II+C   +  R IML A ++ +   ++ F ++DL +      RPW+ + SS E NE  R A+R+++ V L  P + EY   +   ++R  A   Y+FSY   E+     +F++++ LYALALND  AK  T+     IT  MWNRTF G    V+IDA G+R +D+SL D++P +G+F+ V  Y G+ ++ S + G++I+W N  N+PPL TP C FDGS C        G++       L  + ++ G   YRR KFQAEL+AMNWIIPW++L   EK   R     R++S +                                        SPN  SD  P+  I +     +A+N                   +Q+F +TA +  +IVALK +    + E +K + +++KK+KDLN DHICR IG+C+E  HQ +VYEYCPKGSL+D+LENEQI LDWMF+ SL+QDI RG++YLH  +G HG+LKSSNC+VDSRFVLK+TDFGL  +R      S E  S  +++ +LWT+PE+L     T+    ++KGDVYSFAI+ QEI+YR+GVF + N  + +P  IV+ VK+ +  PFRP+LD ++GCS DL+++I QAWD+DP+ RPDF  IK SMRK++K  +S N+LDNLLSRMEQYANNLE LV QRT +YLEEKK+ EDLLYSMLP+SVA QL +NQ V+AES+E VTIYFSDIVGFTSLSA+STPMQV+ELLNRLYT FD IIENFD YKVETIGDAYMV SGLP  NG  HARE+ARM + FL AIF F IPHRP  +LELRIG+HSGPVCAGVVG KMPRYCLFGDTVNTSSRMESNGLPLKIHIS  T +VLK+F++FIM+ERG VEMKGKG+Q TYWLHGE+ +IVDP+P  A+I+
Sbjct:  145 VNVIFGPLNDFTLANAARFSTAMYNVPIVA--PAGFAHQLSDKLEYGMLTRVLFTYSDLEWVFGNTLKHYGWLPDQQTPIAIVTTRNVRRREGVVGHTGMAGVFQHLILQKFLVKAAYKLLSVTLDDEFDVTDRFLKRLPDSARIIILCTDPEVVRDIMLEAHKLNMVNGDYAFFNMDLLSSQTKLKRPWYRETSSPEENERARQAYRALMTVTLLKPDSPEY--RTFTEEVRARALRDYDFSYRDSEVTPFIGTFHDAVKLYALALNDALAKGGTITNGTLITQEMWNRTFKGVTGVVRIDANGDRNADYSLLDMNPVTGDFEVVVNYFGNDKSLSTVLGRTIDWINTDNQPPLHTPPCGFDGSECHNSHFIHIGIVGAVVFILLMTMSLVLGIIFYRRAKFQAELRAMNWIIPWDALQVTEKHLRRY----RRESDIR---------------------------------------SPNQSSD--PLRKISSETCTAAAAN-------------------SQMFARTAFYMKSIVALKPLRRQTRMEPSKALSIEVKKVKDLNCDHICRLIGVCLEVPHQCIVYEYCPKGSLQDVLENEQIKLDWMFKFSLMQDICRGVMYLHQIFGPHGNLKSSNCLVDSRFVLKITDFGLPHIRGPPPLES-EVGSFIFHRNLLWTAPELLPDGDTTIYPRESIKGDVYSFAIVCQEIVYRKGVFYIQNFKNCEPDFIVKEVKAHRKPPFRPTLDSLEGCSEDLVQLICQAWDDDPSVRPDFQSIKLSMRKLNKAGDSNNVLDNLLSRMEQYANNLEELVEQRTAQYLEEKKKTEDLLYSMLPRSVAKQLFRNQPVTAESFEMVTIYFSDIVGFTSLSAESTPMQVVELLNRLYTLFDGIIENFDAYKVETIGDAYMVASGLPQRNGNKHAREVARMSIAFLKAIFEFQIPHRPEKRLELRIGIHSGPVCAGVVGQKMPRYCLFGDTVNTSSRMESNGLPLKIHISQQTFDVLKTFKSFIMTERGLVEMKGKGRQKTYWLHGEDCYIVDPIPPGAQIV 1128          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1I8JDN4 (Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 484/1071 (45.19%), Postives = 669/1071 (62.46%), Query Frame = 2
Query:  464 GPNSIISLGTIARMSGTR-FNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDK---------------------SYSDYFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTG--LNPRPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYA-------KNDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTG-------LIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPN--SDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKIN-TGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRT-QTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKS--SKHVPFRPSLDE----IDGCS-SDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDP 3523
            GP     L  +AR +    + + +++ G A      +DK +Y  L R+   +  + N +  + + Y WLPR  +N+ + Y+ D                      +  + F      + R+K Y        +   + +RE++       R++++C      R IM+ A E+     E+VF +IDLF+   L  RPW+ +  S+E N +   A+R+++ + L  P ++EY + S  + ++  A++ Y+F YP+EE+N    +F+++++LYALA+ND  A        N +L  IT+ M +RTF G    V I+A G+R +D+SL D+D  + NF  V  Y G+T+ Y L+ GK I+W ++ N PP D PKC FD S CKKD +          L+  C  + L  IGVI     YR+L+ ++EL AMNW I W  L+  E+   R+  ++ + S + E   +   +  +        GN+Q   E    E   L  +PN     D DP +A      +GS    S  S+ TI+GV L  I   Q+F KTA +KGN+VALK+I    ++ E   ++L++IK++KDL +D+I RFIG C++  ++ LV EYCPKGSL+D+LEN+ +NLDWMF+ SL+ DI RGMIYLH ++G HG+LKSSNC+VDSRF LK+ DFGL+ LR  ++    ++  +  Y+  LWT+PE+LR   T P  GT +GDVYSF IIAQEIIYR+GVF + + D  +P++I+E ++       PFRPSL +    +DG     L+ I++  W EDPN RP+F  +K+ + + +K  ESGNILDNLL RMEQY+NNLE LVA+RT +YLEEKK+AE+LLY MLPK VA  L+K +SV+AE ++ VTIYFSDI GFT+LS++STPM+V+ LLN LYT FD IIE +D YKVETIGDAYMVVSGLP  NG  HAREIARM L FL  IF F I H+P+ QL+LRIGVHSGPVCAGVVG KMPRYCLFGDTVNT+SRMESNGLPLKIHIS  T  +L+    F+ +ERGEVEMKGKG Q TYWLHGEND IVDP
Sbjct:   37 GPFCTFCLAAVARYNRYYLYQKPIITSGAAA---NLEDKEEYYNLIRVGPMNFDIENMLLAIFQRYNWLPRQQQNLLIIYVPDDETQLHKQRDETRVTFSRLLRTTIENRFSHQHRYILRVKPYSATNKHFQSEVFRCMREEV-------RLVVLCADPDTVREIMIKAHELGFINGEYVFFNIDLFSSERLTSRPWYRKTDSNERNAAASVAYRALMTITLRKPNSTEYRDFS--DKVKAAAKQNYSFEYPEEEVNSFVGAFHDAVLLYALAINDTLATHGLAGISNGSL--ITSRMKSRTFKGITGTVSINANGDRNADYSLLDMDKNTKNFTVVAHYYGNTKRYELVSGKVIDWFSKDNLPPPDVPKCGFDNSRCKKDLSEMAIYAVIVLLVLICVLSVL--IGVI-----YRKLRLESELHAMNWRIAWSELEPTERLAARRRSMASQSSRLRERPSDSGAQRTQTF------GNHQQEGE----EAQPLNPTPNEQQQQDEDPAIA-----PKGSDVVSSNDSVETIAGVPLSQIPVAQLFAKTAYYKGNLVALKQIYLRNKRLEVNNKILMEIKRVKDLASDNIVRFIGACLDSPNECLVTEYCPKGSLQDILENDNLNLDWMFKFSLMLDICRGMIYLHHSFGSHGNLKSSNCLVDSRFSLKIADFGLHSLRGSKELKERDDSDYSSYRNKLWTAPELLRNPSTAPAEGTREGDVYSFGIIAQEIIYRKGVFYISDYDFPEPQDIIEKIRQPVGSQPPFRPSLSQELVDLDGERVQALLGIVRSCWHEDPNARPNFNAVKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVARRTDQYLEEKKKAENLLYCMLPKQVATTLMKGESVTAEWFDSVTIYFSDICGFTALSSESTPMEVVNLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPGRNGNLHAREIARMSLSFLRNIFSFKIRHKPDAQLKLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSLTYAILEEIGGFVTTERGEVEMKGKGLQKTYWLHGENDNIVDP 1071          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1I8HCY1 (Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 884.404 bits (2284), Expect = 0.000e+0
Identity = 480/1083 (44.32%), Postives = 673/1083 (62.14%), Query Frame = 2
Query:  431 FILDEPVHAFIGPNSIISLGTIARMSGT-RFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSD---------------------YFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTG--LNPRPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAK-------NDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDP---MVAIRNGKHRGSASNE-SYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKIN-TGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLD----EIDGCSSD-LIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPESAKIIQ 3550
             +L + +   +GP    +L  +AR +    + R +++ G  G     +DK +Y  L R+  + + +   +  + + + W PR  + I    + D+   +                     +F   K ++ RL+ Y+    +  +   + +R+++       R++++C      R IM+ A E+     E+VF +IDLF+   L  +PW  +  + E NE    A+R+++ + L  P + EY N S    ++ IA+ KYNF+YP+EE+N    +F+++++LYALA+ND   +       N +L  IT  M NRTF G    V I+A G+R +D+SL D+D  + NF  V  Y G+ + Y L+ GK I+W NE N PP D PKC FD S+CK+D +            L  +  +     YR+L+ ++EL AMNW IPW  L+ +E+         R+ S   + L   D++ ++    +      Q  +++ +    L  NS N  S           +N +H G+A+ E S +S+ TI+GV L  I  TQ+F KTA +KG +VALK ++   ++ E T ++L+++K++KDL +D++ RFIG C++  ++ LV EYCPKGSL+D+LEN+ +NLDWMF+ SL+ DI RGMIYLH N+G HG+LKSSNC+VDSRF LK+ DFGL  LR  +     E+  +  Y+  LWT+PE+LR  T P  GT +GDVYSFAII QEIIYRRGVF + + D  +P+EIVE VK   +  +RP+LD    + D   S+ LI  ++  W EDP  RP F  IK+ + + +K  ESGNILDNLL RMEQY+NNLE LVA+RT  YLEEKK+AE+LLY MLPKSVA  L++ +SV+AE ++ VTIYFSDI GFT+LS++STP++V+ LLN LYT FD IIE +D YKVETIGDAYMVVSGLP  NG  HAREI+RM L FL  I+ F I H+P+ QL+LRIG+HSGPVCAGVVG KMPRYCLFGDTVNT+SRMESNGLPLKIHIS  T E+L+    F+ + RGEVEMKGKGKQLTYWLHGE D IVDPV  +  + Q
Sbjct:   48 LLLQQKIDLMLGPYCSFALAAVARYNRMPHYRRPILTTG--GVASALRDKAEYFNLIRVGPSFDGVEKMLYLVFQRFNWKPRDVQTILFIELPDEDVKEKRTRDEIGVTQSRILCHGIEKHFVQEKYIVRRLQ-YEMHNAQFKSEIFRVMRDEI-------RLVVLCADPDTVREIMIKAQELGFINGEYVFFNIDLFSSEKLTLQPWRRENDTHERNEKAARAYRALMTITLRKPSSPEYRNFS--QQVKSIAKSKYNFTYPEEEVNSFVGAFHDAVILYALAINDTVYEHGFEGIANGSL--ITEKMKNRTFEGITGTVSINANGDRDADYSLLDMDKNTRNFVVVAHYYGNRQKYELVPGKEIDWYNEDNLPPRDIPKCGFDYSMCKQDLSKVATYAVVVLLVLICVLSVVIAVIYRKLRLESELHAMNWRIPWSELEPMER-----IAAGRRTSESGKDLQQQDEEPEQSQPHRHHQHRGQSHQKRTDSVRILFGNSHNEGSTSKKNRDEKKHQNDQHSGAAAEEMSLVSVDTIAGVPLSQIPVTQLFTKTAYYKGALVALKPLSLRNKRIEVTNKLLMEVKRVKDLTSDNVIRFIGACLDAPNECLVSEYCPKGSLQDVLENDNLNLDWMFKFSLMLDICRGMIYLHHNFGSHGNLKSSNCLVDSRFSLKIADFGLQSLRGTKDYKDKEDAEYSSYRNKLWTAPELLRNPTPPPEGTKEGDVYSFAIICQEIIYRRGVFFISDYDFPEPQEIVEKVKEISNQMYRPTLDAETNDPDQERSEALINTVRNCWQEDPAARPSFNSIKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVAKRTDLYLEEKKKAENLLYCMLPKSVATTLLRGESVTAEWFDSVTIYFSDICGFTALSSESTPLEVVTLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPMRNGILHAREISRMALSFLQNIYSFKIRHKPDVQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSFTHEILEEIGGFVTTARGEVEMKGKGKQLTYWLHGEGDSIVDPVVSNGSLNQ 1111          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1I8GAT2 (Guanylate cyclase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 877.47 bits (2266), Expect = 0.000e+0
Identity = 492/1150 (42.78%), Postives = 698/1150 (60.70%), Query Frame = 2
Query:  230 LEKNNGNNMIVENSKKLGPITDLALARIEKLKKKGELQGFANYSLKLFFSESSTVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTR-FNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEM---------MERLKNYKTEGYKADASSLKEIREKL-----KLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTG--LNPRPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLY-------AKNDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR-------KDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMET------TLLLNSPNSDSDIDPMVAIRNGKHRG--SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKIN-TGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKE-NSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSL-DEIDGCSSD----LIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPES 3535
            + ++N ++M +E   ++ P+ D+A+A  + +         +N +++L  ++S       +I       +L E V   +GP     LG +AR +    + R +++ G  G      +KV+Y  L R+  +HE +   + K+ K Y W PRP + + V    D+  S    S   +         +E++       Y A   + K  R  L     K+L  + R++++C      R IM+ A E+     E+VF +IDLF+   L  RPW     + E N     A+RS++ + L  P + EY N S    ++++A  KYNF+YP+EE+N    +F+++++LYALA+ND          +N +L  +T  M +R+F G    V I+  G+R +D+SL D+D  +G F  V  YNG+ + Y L++ + I+W NE+N PP D P C FD SLCKKD T   L        L     I  F  YR+L+ ++EL  MNW I WE L+  E+   R+  +++       K +T  +     ++K  ++ Q      N+ G+K     +       TL L      ++      I  G  +      + S  S+ TI+GV L  I   Q+F KTA +KG +VALK++N   ++ E T  +L+++K++KDL +D++ RFIG C++P ++ LV EYCPKGSL+D+LEN+ +NLDWMF+LSL+ DI RGMIYLH ++G HG+LKSSNC+VDSRF LK+ DFGL  LR  + E    E+  +  Y+  LWT+PE+LR    PF GT +GDVYSFAII QE+IYR+GVF + + D  +P++IVE V++ ++ PFRP+L +E+     D    L  +++  W EDP  RP F   K+ + + +K  ESGNILDNLL RMEQY+NNLE LVA+RT +Y  EKK+AEDLLY MLPK+VA  L++ ++V+AE ++ V+IYFSDI GFT+LS++STP+QV+ LLN LYT FD IIE +  YKVETIGDAYMVVSGLP  NG  HA EI+RM L FL+ I+ F I H P  QL+LRIG+HSGPVCAGVVG KMPRYCLFGDTVNT+SRMESNGLPLKIHIS +T E+L     F+ + RGEVEMKGKGKQLTYWLHGE D IVDP P +
Sbjct:    1 MSRHNISHMSLE---RVLPVVDVAVASAQSVGL------LSNVTVRLLSNDSEC---DYSIAPVVGMLMLRE-VDLMLGPYCSFCLGAVARYNRYHLYQRPIITSG--GGASVLNNKVEYYNLIRVGPSHEQIEEMLLKIFKHYNWRPRPVQTVLVVGPPDEINSRQHQSESIISDALVMSVAIEKMLTQPNVSYIARRLTYKPGRPHLATQLFKVLEEV-RIVVLCADPDTVRDIMIRAEELGFINGEYVFFNIDLFSSEKLTVRPWRRVNDTAERNSKAFRAYRSLMTITLRKPNSPEYRNFS--RQVKELAYHKYNFTYPEEEVNSFVGAFHDAVLLYALAINDTLREHGSEGIRNGSL--VTEKMKSRSFEGITGTVSINKNGDRNADYSLLDMDKDTGEFAVVAHYNGNKKVYELVKDRQIDWNNEENLPPKDIPTCGFDYSLCKKDLTQMALYAVVVLLVLICFLTILIFVIYRKLRLESELHGMNWRIAWEELEPTERVAARRRSLAQPQPPPPQKQTTNKKKRARLNQKKQQQQQPHWFFANHHGTKRSNRGDPDEAAAETLPLRPSGGGANDSGGGDIGAGDSQSVVQMDSASMESVETIAGVPLSQIPTAQLFAKTAYYKGTLVALKQLNLRNKRIEVTNRLLMEVKRVKDLASDNVVRFIGACLDPPNECLVTEYCPKGSLQDILENDNLNLDWMFKLSLMADICRGMIYLHHSFGSHGNLKSSNCMVDSRFSLKIADFGLQSLRSNKLEYRDKEDGDYSTYRNKLWTAPELLRLPNPPFEGTKEGDVYSFAIICQEVIYRKGVFFLSDSDFIEPQDIVERVRTPQNPPFRPALVEEMSDLEPDRTAALTAMVELCWHEDPGARPTFNAAKSRISRFNKTAESGNILDNLLKRMEQYSNNLESLVAKRTDQYQVEKKKAEDLLYCMLPKAVATTLMRGEAVTAEWFDSVSIYFSDICGFTALSSESTPLQVVTLLNDLYTLFDRIIEQYSCYKVETIGDAYMVVSGLPERNGNRHAGEISRMALSFLNNIYSFEIRHMPGVQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISATTHELLTDIGNFVTTVRGEVEMKGKGKQLTYWLHGEGDKIVDPPPAA 1130          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A267FJR9 (Guanylate cyclase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025214g3 PE=3 SV=1)

HSP 1 Score: 872.848 bits (2254), Expect = 0.000e+0
Identity = 464/946 (49.05%), Postives = 626/946 (66.17%), Query Frame = 2
Query:  776 EGYKADASSLKEIREKL-KLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTG--LNPRPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYA-------KNDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTG-------LIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPN--SDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKIN-TGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRT-QTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKS--SKHVPFRPSLDE----IDGCS-SDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDP 3523
            EG + D+S+    R  L + +S+   V+++C      R IM+ A E+     E+VF +IDLF+   L  RPW+ +  S+E N +   A+R+++ + L  P ++EY + S  + ++  A++ Y+F YP+EE+N    +F+++++LYALA+ND  A        N +L  IT+ M +RTF G    V I+A G+R +D+SL D+D  + NF  V  Y G+T+ Y L+ GK I+W ++ N PP D PKC FD S CKKD +          L+  C  + L  IGVI     YR+L+ ++EL AMNW I W  L+  E+   R+  ++ + S + E   +   +  +        GN+Q   E    E   L  +PN     D DP +A      +GS    S  S+ TI+GV L  I   Q+F KTA +KGN+VALK+I    ++ E   ++L++IK++KDL +D+I RFIG C++  ++ LV EYCPKGSL+D+LEN+ +NLDWMF+ SL+ DI RGMIYLH ++G HG+LKSSNC+VDSRF LK+ DFGL+ LR  ++    ++  +  Y+  LWT+PE+LR   T P  GT +GDVYSF IIAQEIIYR+GVF + + D  +P++I+E ++       PFRPSL +    +DG     L+ I++  W EDPN RP+F  +K+ + + +K  ESGNILDNLL RMEQY+NNLE LVA+RT +YLEEKK+AE+LLY MLPK VA  L+K +SV+AE ++ VTIYFSDI GFT+LS++STPM+V+ LLN LYT FD IIE +D YKVETIGDAYMVVSGLP  NG  HAREIARM L FL  IF F I H+P+ QL+LRIGVHSGPVCAGVVG KMPRYCLFGDTVNT+SRMESNGLPLKIHIS  T  +L+    F+ +ERGEVEMKGKG Q TYWLHGEND IVDP
Sbjct:  244 EGRQNDSSTSSLYRRILHERVSTKFSVVVLCADPDTVREIMIKAHELGFINGEYVFFNIDLFSSERLTSRPWYRKTDSNERNAAASVAYRALMTITLRKPNSTEYRDFS--DKVKAAAKQNYSFEYPEEEVNSFVGAFHDAVLLYALAINDTLATHGLAGISNGSL--ITSRMKSRTFKGITGTVSINANGDRNADYSLLDMDKNTKNFTVVAHYYGNTKRYELVSGKVIDWFSKDNLPPPDVPKCGFDNSRCKKDLSEMAIYAVIVLLVLICVLSVL--IGVI-----YRKLRLESELHAMNWRIAWSELEPTERLAARRRSMASQSSRLRERPSDSGAQRTQTF------GNHQQEGE----EAQPLNPTPNEQQQQDEDPAIA-----PKGSDVVSSNDSVETIAGVPLSQIPVAQLFAKTAYYKGNLVALKQIYLRNKRLEVNNKILMEIKRVKDLASDNIVRFIGACLDSPNECLVTEYCPKGSLQDILENDNLNLDWMFKFSLMLDICRGMIYLHHSFGSHGNLKSSNCLVDSRFSLKIADFGLHSLRGSKELKERDDSDYSSYRNKLWTAPELLRNPSTAPAEGTREGDVYSFGIIAQEIIYRKGVFYISDYDFPEPQDIIEKIRQPVGSQPPFRPSLSQELVDLDGERVQALLGIVRSCWHEDPNARPNFNAVKSRISRFNKDAESGNILDNLLKRMEQYSNNLESLVARRTDQYLEEKKKAENLLYCMLPKQVATTLMKGESVTAEWFDSVTIYFSDICGFTALSSESTPMEVVNLLNDLYTLFDRIIEQYDCYKVETIGDAYMVVSGLPGRNGNLHAREIARMSLSFLRNIFSFKIRHKPDAQLKLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHISSLTYAILEEIGGFVTTERGEVEMKGKGLQKTYWLHGENDNIVDP 1163          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 317/540 (58.70%), Postives = 403/540 (74.63%), Query Frame = 2
Query: 1889 RGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            RGS    +Y SL+T  G       N QVF KTA FKGNIVA+K +N  ++ E T+++L ++K ++D+ NDH+ RFIG C++P +  +V EYCP+GSL+D+LENE I LDWMF+ SLI DIV+GM +LH S    HG+LKSSNCVVD+RFVLK+TD+GL+  R      S+ E +H YY + LW +P++LR    P  GT KGD+YSF II QE+  RRGVF ++  DS  PKEIV+ V   +    RP+++     S +L +++++ W E+P  RP+F  IK  +RK ++ + S +ILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTSLSA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HAREIARM L  L A+  F I HRP+ QL+LRIG+HSGPVCAGVVG KMPRYCLFGDTVNTSSRMESNG PLKIH+S ++ ++L+ F  F +  RG+VEMKGKGK  TYWL GE+
Sbjct:  548 RGS----NYGSLLTADG-------NFQVFAKTAYFKGNIVAIKYVNR-KRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRT----ESDPEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEG-DSLSPKEIVDRVALGEWPYLRPTVN-TQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNR-EVSRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGES 1068          

HSP 2 Score: 142.51 bits (358), Expect = 6.725e-34
Identity = 108/414 (26.09%), Postives = 186/414 (44.93%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDK-SYSDYFYSAKEMMERLKNYKTEG----YKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF----TGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKND---TLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESL 1651
            AFIGP    +   +   + T +   +++ G     F  +    Y  +T     H+ L  F   + + + W     ++  + + D K    + +++ + +   LK          ++ D+  +    E L+ +    RV+ +C +    R +M+   +  L   EFVFI+ID+F    T    +PW    + DE+ +    + + +L  + P N EY +  +  DL+  A++ +NF+     +N ++  FY+ +MLY  ALN+  A++    +   IT  MWNRT+ G    V+ID  G+R +DF+L+D+ D  S  FQ V  YNG+ +    + G +  W       P D P C F  D   C     +   +       + VI      F YR+LK + EL A  W I WE +
Sbjct:  126 AFIGPGCDYTSSPVGLFT-THWGLPMITAGAPAVGFSDRSDA-YTSITNTGPTHKKLGEFALHICRHFGW----SQHALLMFGDSKMGERECYFAVEGLYTELKEVNITTVDLVFEEDSRPVN-YSEHLQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPWARGDADDELAKKAYQSVK-ILTYREPQNPEYKDFVM--DLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWPG--GFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDM 527          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 317/540 (58.70%), Postives = 403/540 (74.63%), Query Frame = 2
Query: 1889 RGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            RGS    +Y SL+T  G       N QVF KTA FKGNIVA+K +N  ++ E T+++L ++K ++D+ NDH+ RFIG C++P +  +V EYCP+GSL+D+LENE I LDWMF+ SLI DIV+GM +LH S    HG+LKSSNCVVD+RFVLK+TD+GL+  R      S+ E +H YY + LW +P++LR    P  GT KGD+YSF II QE+  RRGVF ++  DS  PKEIV+ V   +    RP+++     S +L +++++ W E+P  RP+F  IK  +RK ++ + S +ILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTSLSA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HAREIARM L  L A+  F I HRP+ QL+LRIG+HSGPVCAGVVG KMPRYCLFGDTVNTSSRMESNG PLKIH+S ++ ++L+ F  F +  RG+VEMKGKGK  TYWL GE+
Sbjct:  548 RGS----NYGSLLTADG-------NFQVFAKTAYFKGNIVAIKYVNR-KRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRT----ESDPEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEG-DSLSPKEIVDRVALGEWPYLRPTVN-TQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNR-EVSRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGES 1068          

HSP 2 Score: 142.51 bits (358), Expect = 6.725e-34
Identity = 108/414 (26.09%), Postives = 186/414 (44.93%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDK-SYSDYFYSAKEMMERLKNYKTEG----YKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF----TGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKND---TLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESL 1651
            AFIGP    +   +   + T +   +++ G     F  +    Y  +T     H+ L  F   + + + W     ++  + + D K    + +++ + +   LK          ++ D+  +    E L+ +    RV+ +C +    R +M+   +  L   EFVFI+ID+F    T    +PW    + DE+ +    + + +L  + P N EY +  +  DL+  A++ +NF+     +N ++  FY+ +MLY  ALN+  A++    +   IT  MWNRT+ G    V+ID  G+R +DF+L+D+ D  S  FQ V  YNG+ +    + G +  W       P D P C F  D   C     +   +       + VI      F YR+LK + EL A  W I WE +
Sbjct:  126 AFIGPGCDYTSSPVGLFT-THWGLPMITAGAPAVGFSDRSDA-YTSITNTGPTHKKLGEFALHICRHFGW----SQHALLMFGDSKMGERECYFAVEGLYTELKEVNITTVDLVFEEDSRPVN-YSEHLQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPWARGDADDELAKKAYQSVK-ILTYREPQNPEYKDFVM--DLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWPG--GFIPPDMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDM 527          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 305/549 (55.56%), Postives = 393/549 (71.58%), Query Frame = 2
Query: 1868 AIRNGKHRGSAS--NESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            A+R    R + S    +Y SL+T+ G       N Q++ KT  +KGNI A+K +N  ++ E T+++L ++K ++D+ N+H+ RFIG C++  +  ++ EYCP+GSL+DL+E E I LDWMFR SLI DIV+GM +LH S    HG+LKSSNC+VDSRFVLK+TD+GL   R+     S  E +H YY + LWT+PE++R +     GT KGDVYSF II QE+   +GVF +D+     PKEIVE V   +    RP L      S +L +++++ W ED N RPDF  IK  + K ++G  S NILDNLLSRMEQYANNLE LV +RTQ Y EEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT++SA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ H  EIARM L  L A++ F I HRP+ QL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S +T  VL+ F  F +  RG++EMKGKG+  TYWL GE+
Sbjct:  515 ALRRACSRLTLSLRGSNYGSLLTLEG-------NVQIYAKTCYYKGNITAIKYVNK-KRIELTRKVLFELKHMRDVQNEHLNRFIGACIDAPNICILTEYCPRGSLQDLMEIESITLDWMFRYSLINDIVKGMAFLHNSVIVSHGNLKSSNCLVDSRFVLKITDYGLASFRK----ESYLEDTHAYYARKLWTAPELMRDENRQPCGTQKGDVYSFGIILQELALLKGVFYLDS-PPFSPKEIVEHVAEGRWPYLRPLLC-TQSHSEELGQLMQRCWSEDVNERPDFNQIKVMLHKNNRGYGS-NILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAMSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHTGEIARMSLALLEAVYSFRIRHRPDLQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDIEMKGKGRMRTYWLLGES 1048          

HSP 2 Score: 103.219 bits (256), Expect = 9.116e-22
Identity = 107/419 (25.54%), Postives = 182/419 (43.44%), Query Frame = 2
Query:  173 GKKLSPREFRIAVLMTNSNLEKNNGNNMIVENSKKLGPITDLALARIEKLKKKGELQGFANYSLKLFFSES--------STVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSA-----KEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF-TGLNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALN---DLYAKNDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQ 1369
            G+   P    +A+++   N E             ++GP  + AL   EK+     L     Y ++L FS S         +V+    +  +F +    +P  AFIGP    +   +AR + T +   +V+ G     F       Y  +T     H+ L  F+ ++   + W    HK   V + D K+     Y A      EM       K   +  D   L    + +  +S   RV+ +C      R +M+   + +L   E+VF  IDLF   L  RP       D  +E+ + AF+S+ I+  + P N EY      + +++ A++++NFS     +N +   F++ ++LY+ ALN   D          +T  MWNRTF+G    V++D  G+R  DF+L+D+ D +SG ++
Sbjct:   17 GRTSVPPNITLAIILPKQNTEYPWA-------WPRVGPALNWAL---EKVNSDPTL--LPGYHMQLVFSSSENKEGLCSDSVAPLVAVDLKFAH----DP-WAFIGPGCDYASSPVARFT-THWEVPMVTAGAPALGFNM-----YSSITNTGPTHKKLGEFVVRMHHNFGW----HKYAMVMFHDKKNDDRPCYFAVEGPYTEMTADNITAKDMVFNEDDEPLS-YADLINGISQRGRVVYVCCKWDTFRKLMVQFYKQRLPQEEYVFFFIDLFGESLRSRPAKPWARGDADDEAAKQAFKSVKIMTYREPQNPEY--KHFVSKMKRDAKKEFNFSIEDSLMNLIAGGFHDGVLLYSHALNESMDQSGLRPPGHVVTKKMWNRTFHGVTGLVQMDENGDREIDFALWDMTDTESGVYE 405          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 300/540 (55.56%), Postives = 384/540 (71.11%), Query Frame = 2
Query: 1889 RGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            RGS    +Y SL+T  G       N QVF KTA FKGNIVA+K +N  ++ E T+++L ++K ++D+ NDH+ RFIG C++P +  +V EYCP+GSL                      ++ GM +LH S    HG+LKSSNCVVD+RFVLK+TD+GL+  R      S+ E +H YY + LW +P++LR    P  GT KGD+YSF II QE+  RRGVF ++  DS  PKEIV+ V   +    RP+++     S +L +++++ W E+P  RP+F  IK  +RK ++ + S +ILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTSLSA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HAREIARM L  L A+  F I HRP+ QL+LRIG+HSGPVCAGVVG KMPRYCLFGDTVNTSSRMESNG PLKIH+S ++ ++L+ F  F +  RG+VEMKGKGK  TYWL GE+
Sbjct:  528 RGS----NYGSLLTADG-------NFQVFAKTAYFKGNIVAIKYVNR-KRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSL----------------------VLSGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRT----ESDPEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEG-DSLSPKEIVDRVALGEWPYLRPTVN-TQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNR-EVSRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGES 1026          

HSP 2 Score: 142.124 bits (357), Expect = 8.557e-34
Identity = 108/414 (26.09%), Postives = 186/414 (44.93%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDK-SYSDYFYSAKEMMERLKNYKTEG----YKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF----TGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKND---TLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESL 1651
            AFIGP    +   +   + T +   +++ G     F  +    Y  +T     H+ L  F   + + + W     ++  + + D K    + +++ + +   LK          ++ D+  +    E L+ +    RV+ +C +    R +M+   +  L   EFVFI+ID+F    T    +PW    + DE+ +    + + +L  + P N EY +  +  DL+  A++ +NF+     +N ++  FY+ +MLY  ALN+  A++    +   IT  MWNRT+ G    V+ID  G+R +DF+L+D+ D  S  FQ V  YNG+ +    + G +  W      P  D P C F  D   C     +   +       + VI      F YR+LK + EL A  W I WE +
Sbjct:  106 AFIGPGCDYTSSPVGLFT-THWGLPMITAGAPAVGFSDRSDA-YTSITNTGPTHKKLGEFALHICRHFGW----SQHALLMFGDSKMGERECYFAVEGLYTELKEVNITTVDLVFEEDSRPVN-YSEHLQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPWARGDADDELAKKAYQSVK-ILTYREPQNPEYKDFVM--DLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWPGGFIPP--DMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDM 507          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 300/540 (55.56%), Postives = 383/540 (70.93%), Query Frame = 2
Query: 1889 RGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            RGS    +Y SL+T  G       N QVF KTA FKGNIVA+K +N  ++ E T+++L ++K ++D+ NDH+ RFIG C++P +  +V EYCP+GSL+D+LENE I LDWMF+ SLI DIV+GM +LH S    HG+LKSSNCVVD+RFVLK+TD+GL+  R      S+ E +H YY + LW +P++LR    P  GT KGD+YSF II QE+  RRGVF ++  DS  PKEIV+ V   +    RP+++     S +L +++++ W E+P  RP+F  IK  +RK ++ + S +ILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTSLSA+STPMQV                       ETIGDAYMVVSGLP  NG+ HAREIARM L  L A+  F I HRP+ QL+LRIG+HSGPVCAGVVG KMPRYCLFGDTVNTSSRMESNG PLKIH+S ++ ++L+ F  F +  RG+VEMKGKGK  TYWL GE+
Sbjct:  567 RGS----NYGSLLTADG-------NFQVFAKTAYFKGNIVAIKYVNR-KRIELTRKVLFELKHMRDVQNDHLTRFIGACIDPPNVSIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAFLHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRT----ESDPEDAHSYYARKLWMAPDLLRMSNPPACGTQKGDIYSFGIILQEVALRRGVFYIEG-DSLSPKEIVDRVALGEWPYLRPTVN-TQAHSEELGQLMQRCWAEEPAERPEFSHIKVLLRKQNR-EVSRDILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQV-----------------------ETIGDAYMVVSGLPVRNGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWLLGES 1064          

HSP 2 Score: 142.51 bits (358), Expect = 7.103e-34
Identity = 108/414 (26.09%), Postives = 186/414 (44.93%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDK-SYSDYFYSAKEMMERLKNYKTEG----YKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF----TGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKND---TLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESL 1651
            AFIGP    +   +   + T +   +++ G     F  +    Y  +T     H+ L  F   + + + W     ++  + + D K    + +++ + +   LK          ++ D+  +    E L+ +    RV+ +C +    R +M+   +  L   EFVFI+ID+F    T    +PW    + DE+ +    + + +L  + P N EY +  +  DL+  A++ +NF+     +N ++  FY+ +MLY  ALN+  A++    +   IT  MWNRT+ G    V+ID  G+R +DF+L+D+ D  S  FQ V  YNG+ +    + G +  W      P  D P C F  D   C     +   +       + VI      F YR+LK + EL A  W I WE +
Sbjct:  145 AFIGPGCDYTSSPVGLFT-THWGLPMITAGAPAVGFSDRSDA-YTSITNTGPTHKKLGEFALHICRHFGW----SQHALLMFGDSKMGERECYFAVEGLYTELKEVNITTVDLVFEEDSRPVN-YSEHLQKIKEEGRVVFVCCSPDIFRQLMVHFRKANLPQEEFVFIYIDVFGRTLTSQPVQPWARGDADDELAKKAYQSVK-ILTYREPQNPEYKDFVM--DLKAGAKKMFNFTVDDSLMNIISGGFYDGLMLYVQALNESLAESHGRPSSKSITERMWNRTYYGVTGLVQIDKHGDRETDFALWDMTDTNSSVFQIVAVYNGTQKQMRTLPGMAFHWPGGFIPP--DMPFCGFKNDNPACIARTITMHQMVSIVVFFILVIIFTITVFIYRKLKLEKELAAQLWRISWEDM 546          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 318/544 (58.46%), Postives = 394/544 (72.43%), Query Frame = 2
Query: 1883 KHRGSASNESYMSLVTISGVQLENIQN-TQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLE-DLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCS-SDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            K R SA ++  +S+   S   L   Q   Q+F KT  ++GN+VA+K IN  +K E T+E+L ++K ++D+ N+H+ RF+G C++P +  +V EYCP+GSL+ D+LENE I LDW+FR SLI DIV+GM++LH S  G HG LKSSNCVVDSRFVLK+TD+GL   R      S  E  H  Y K LWT+PE+LR +  P  GT KGDVYS  II QEI  R G F V+  D   PKEIV+ VK+ +   FRPS DE   C   +L  ++++ W EDP  RPDF  IK  + K +K + S NILDNLLSRMEQYANNLE LV +RTQ YLEEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTSLSA+STPMQV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ +A+EIARM L  L A+  F I HR   +L+LRIG+H+GPVCAGVVG KMPR+CLFGDTVNT+SRMESNG  LKIH+S +T EVL  F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:  286 KARRSAGSKLTLSMRGSSCGSLLTTQGRNQMFAKTGYYRGNLVAIKPINK-KKIELTREVLFELKHMRDVLNEHLTRFVGACIDPPNICIVTEYCPRGSLQQDILENESITLDWVFRYSLINDIVKGMLFLHNSVIGSHGSLKSSNCVVDSRFVLKITDYGLASFRSC----SECEDMHSLYAKKLWTAPELLRLEHPPPQGTQKGDVYSLGIILQEIALRNGTFYVEGMD-LSPKEIVQKVKNGQRPYFRPSTDE--SCHIEELGLLMQRCWAEDPAERPDFSQIKMLIHKFNK-ENSTNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLDAVKTFKIRHRQEDKLKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWLLGE 820          

HSP 2 Score: 148.673 bits (374), Expect = 1.106e-36
Identity = 99/348 (28.45%), Postives = 170/348 (48.85%), Query Frame = 2
Query:  851 VIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFT--------GLNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLD---RITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQG--------SKEKIEMETTLLL 1828
            V+  C ++   R  M+ A    +   ++VF ++D F+          + +PW   K  DE +E  + A+++++I+  + P N EY +  +   L+K A+E++NF+     +N +  SFY++IM+Y  ALN   +    +     IT +MWNRT+ G      ID  G+R +DFSL+DL D  +G F  V  Y+G++     + G  I+W       P D P C F+   C   G ST  +     + + +I  +  F  YR+LK + EL +M W + WE++      K R+S  S+   ++  +          ++Q   K+G Y+G        +K+KIE+   +L 
Sbjct:    6 VVYFCCSAAVFRQTMVQAHAEGMTAGDYVFFYVDPFSESLSESNVSESRKPW---KRGDEFDEQAKEAYKAVMIISYREPQNIEYKDFVV--KLKKRAKEQFNFTIEDTLMNLIAGSFYDAIMMYTAALNKTLSSGGGVHDGHAITKHMWNRTYRGVTGEFTIDRNGDRETDFSLWDLTDMNTGEFNVVLSYDGASSKLIEVPGLEIQWPG--GSIPKDVPLCGFENEACISGGFSTMEVLMIVFSLILLIVAVSSFLIYRKLKLEKELASMLWRLRWENIQVSSLEKARRSAGSKLTLSMRGSSCGSLLTTQGRNQMFAKTGYYRGNLVAIKPINKKKIELTREVLF 346          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 287/511 (56.16%), Postives = 372/511 (72.80%), Query Frame = 2
Query: 1994 KGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNY-GCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKI---DKGKESG---NILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            +GN+V +  IN  +K E T++ML ++K ++D+ N+H+ RF+G C++  +  ++ EYCP+GSL+D+LENE I+LDWMFR SL+ DIV+GM+YLHS+  G HG+LKSSNCVVDSRFVLK+TD+GL+ +R   K +S    S  Y++K LWT+PE+LR + +   GT KGDVYSFAII QEI  R G F ++  +    KEIV+ VK  +    RP++D   G S +L  ++++ W E+   RPDF  IK  ++K    D G ES     ILDNLLSRMEQYANNLE LV +RTQ YLEEK +AE LLY +LP SVA QL + ++V AE+++ VTIY SDIVGFT++SA STPMQV+  LN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG  HA E+ARM L  LSA+  F I HRP  +L LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRME+ G   +IH+S +T  +L  +  F++   G+V++KGKG   TYWL GEN
Sbjct:    1 QGNLVEIPFINR-KKIELTRQMLFELKHMRDVQNEHLTRFVGACIDVPNICIITEYCPRGSLQDILENESISLDWMFRYSLMHDIVKGMLYLHSSVIGSHGNLKSSNCVVDSRFVLKITDYGLSSVRAHSKADS----SANYFEKRLWTAPELLRLEEVAPRGTQKGDVYSFAIILQEIALRSGPFYLE-ANHLTAKEIVQRVKLGEWPYLRPTVDP-GGHSEELGHLMQRCWAEESTERPDFHQIKILLQKFSSQDDGPESPPAFTILDNLLSRMEQYANNLEELVEERTQAYLEEKGKAEALLYQILPHSVAEQLKRGETVPAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVHNGTRHAIEVARMALALLSAVRCFHIRHRPAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWLLGEN 504          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008976.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 453.366 bits (1165), Expect = 1.161e-144
Identity = 297/798 (37.22%), Postives = 430/798 (53.88%), Query Frame = 2
Query: 1172 FYESIMLYALALNDLYAKND------TLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLI----EGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTS---TGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMN---WIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPS-HEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYR--RGVFAVDNCDSKDPKEIVESVKSSKHV-PFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
             +++ +LYA+A+ +L  +         + R         F G    V ID  G R  D+++FDL  K     ++   +    T+  I    E + + W + +  PP D P+C F G LC++   S     L+   +  +L VIG +  F  Y  ++ ++  ++M+   W I +E +  V                    L+N               G+Y+ S +++        N  N   D+            G+   E  + +   + V L+ ++ T         K N  ALK           +EML          ++++  F G+CVE  +  +V +YC KGSL+D+L+     LDWMF+ S   DIV GMI+LH S    HG+LK S C++DSR  +KLT FG+   R  +K  + +  +   ++ ++ WT+PE+LR + LP  GT KGDV+SFAI+ +E+IY    G +   +    +PK+I++ V+    V P RP L E   C   +  +I+Q WDE  + RPDF  +   +R +   +   NILDN++S++E+YAN+LE +V  RT +   EKK+ + LL S+LP  V  QL   ++V  E YE VTI+F DIVGFT++SA STP++VI LLN LY   D II+ +DVYKVETIGDAYMV SGLP  NG  H  EIA M L FLS+I  F I H P  QL+LRIG++SGPV AGVVG+ MPRYCLFGDTVN +SRMES G PL IH+S +T  +LK    + + ERG + +KGKG QLTYWL G+
Sbjct:    4 LHDAGILYAMAVRELLRQGGNPRDGRAVIRTIRGSNKIKFYGASGQVSIDVNGERFLDYAVFDLQKKQTATGEMRIASKRYFTFQTINFTPEYQKMGWPDGR--PPSDMPECGFTGELCQEAPISEPDLALVLVGSILSLIVIGTV-AFLTYLVVQSRSLQESMDTTWWKINFEDITLV-------------------PLVN---------------GSYRSSSKQVSG------NQSNVHHDV-----------HGTDRVEIPIGIYQGNQVALKFLERTH----PPDLKSNRFALK----------MREML----------HENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINNLGSFFIELYWTAPELLRMEDLPVNGTPKGDVFSFAILMREVIYHEDEGPYVGIHL---EPKDIIDQVRDGIAVPPLRPLLTE--RCEPRIQALIRQCWDESADRRPDFSSVSRMLR-LASPEGDMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 717          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008942.1 (pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 gene:ENSPMAG00000008084.1 transcript:ENSPMAT00000008942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 446.432 bits (1147), Expect = 4.558e-138
Identity = 245/526 (46.58%), Postives = 345/526 (65.59%), Query Frame = 2
Query: 1967 QVFIKTALFKGNIVALKKINTGRKFE-TTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSK-HVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKID-KGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPE 3532
            ++F    +++GN VALK +   R  +  +K +L +++ +++L ++++  F G+CVE  +  +V +YC KGSL+D+L+     LD MF+ S   DIV GMI+LH S    HG+LK S C++DSR  +KLT FG+   R   K+    + +++   ++ WTSPE+LR +  P  GT KGDV+SF ++ +E+IY          D  +PKEI++ V+  K   P RP L E   C   +  +I++ WDE P+ RPDF  I   +R    +G  S  ILDN++S++E+YAN+LE +V  RT +   EKK+ + LL S+LP  V  QL   ++V  E +EQVTI+F DIVGFT++SA S+P++VI LLN LY   D II+ +DVYKVETIGDAYMV SGLP  NG  H  EI+ M L FLS+I  F I H P  QL++RIGV+SG V AGVVG+ MPRYCLFGDTVN +SRMES G PL+IH+S ST  +LKS   + + ERG +++KGKG QLTYWL+G+  F + P+P+
Sbjct:  543 KMFTPLGIYQGNQVALKFLQRTRPPDLKSKTLLKELQMLRELRHENLVVFFGVCVEMPNICIVTQYCRKGSLKDVLKTSDFELDLMFKTSFAYDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRH-GKKGKIMDVNNQDIAELFWTSPELLRMEIFPVNGTPKGDVFSFGVLMREMIYHEDEGPYVGVD-MEPKEIIDQVREGKCSPPLRPLLTE--RCEPRIQALIQRCWDESPDRRPDFHSIARMLRSASPEGHRS--ILDNMVSKLEKYANHLEEVVEDRTAQLESEKKKTDRLLSSLLPSVVVEQLKAGKTVQPEHFEQVTIFFCDIVGFTAMSAISSPLEVITLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEISIMSLHFLSSIINFRIRHLPKEQLKIRIGVNSGSVVAGVVGNTMPRYCLFGDTVNVASRMESTGYPLRIHVSESTASLLKSIGGYELVERGAIQLKGKGSQLTYWLNGKFGFHM-PLPD 1061          

HSP 2 Score: 55.0694 bits (131), Expect = 1.142e-7
Identity = 59/259 (22.78%), Postives = 109/259 (42.08%), Query Frame = 2
Query:  773 TEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKY------NFSYPKEELNYVTTSFYESIMLYALALNDLYAKND------TLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPK--SGNFQQVGFYNGSTETYSLI-EGKSIEWGNEKNEPPLDTPKCAFDGSLCKK 1504
            T   K D S     R+ L  +S+ +R++I+   S+  R ++L A  + L   +F+F+ +  F       ++   +++ ++     A   +++  +     Y +S     L+++ R         N S  KE   Y     +++ +LYA+A+ +L            + R         F G    V ID  G R  D+++F+L  K  S  F  V  ++    + S   E + + W   +  PP D P C F G LC++
Sbjct:  190 TARIKYDTSDKVLHRQNLLDISTKARIVILICGSEEAREVLLEAQSLGLATGKFIFLVVQQFED----SFWKSVAAERLDTQTLQALEPVMLFTI---KAYGSSDYELFLQEVRRRLLGPPFYSNLSSDKEVSPY-AAYLHDAAILYAMAVRELLRHGGNPRDGRAIVRTIKGSTKVKFYGVSGQVNIDVNGERFLDYAVFNLQKKGNSSQFLPVMVFDTFQGSISFTPEYQKMVW--PEGGPPNDMPICGFLGELCQE 438          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008986.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 430.639 bits (1106), Expect = 2.496e-137
Identity = 235/490 (47.96%), Postives = 314/490 (64.08%), Query Frame = 2
Query: 2054 EMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKE-----NSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVP-FRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            E+ + I +++++ ++++  F G+CVE  +  +V +YC KGSL+D+L+     LDWMF+ S   DIV GMI+LH S    HG+LK S C++DSR  +KLT FG+   R  +K      N  E+      K++ WT+PE+LR + LP  GT KGDV+SFAI+ +E   R    A        P +I++ V+    VP  RP L E   C   +  +I+Q WDE  + RPDF  +   +R         NILDN++S++E+YAN+LE +V  RT +   EKK+ + LL S+LP  V  QL   ++V  E YE VTI+F DIVGFT++SA STP++VI LLN LY   D II+ +DVYKVETIGDAYMV SGLP  NG  H  EIA M L FLS+I  F I H P  QL+LRIG++SGPV AGVVG+ MPRYCLFGDTVN +SRMES G PL IH+S +T  +LK    + + ERG + +KGKG QLTYWL G+
Sbjct:  142 EIPIGIYQMREMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLDINKQEDAWALSSKELYWTAPELLRMEDLPVNGTPKGDVFSFAILMRESTPREWPTATRANRVPFP-DIIDQVRDGIAVPPLRPLLTE--RCEPRIQALIRQCWDESADRRPDFSSVSRMLRLASPEGLHMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 628          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: KIN2 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN2 has a paralog, KIN1, that arose from the whole genome duplication [Source:SGD;Acc:S000004086])

HSP 1 Score: 68.9366 bits (167), Expect = 3.806e-12
Identity = 46/167 (27.54%), Postives = 82/167 (49.10%), Query Frame = 2
Query: 2033 RKFETTKEMLLDIKKIKD------LNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAII 2515
            R+    KE+  D + +++      L + HICR   MC    H Y+++EY   G L D +  +  +L         + I   + YLH+N   H  LK  N ++ S   +K+ DFGL+ + + +K+       H +   + + +PE+L+ Q  P+ G  + D++SF I+
Sbjct:  156 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII-QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDYRKQ------LHTFCGSLYFAAPELLKAQ--PYTGP-EVDIWSFGIV 312          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 67.0106 bits (162), Expect = 1.392e-11
Identity = 46/168 (27.38%), Postives = 85/168 (50.60%), Query Frame = 2
Query: 2033 RKFETTKEMLLDIKKIKD------LNNDHICRFIGMCVEPLHQYLVYEYCPKGSLED-LLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAII 2515
            R+ +  KE+  D + I++      L + HICR   MC    H Y+++EY   G L D ++++  I      + +  + I   +IYLH+N   H  LK  N ++     +K+ DFGL+ + + +K+       H +   + + +PE+L+    P+ G  + DV+SF ++
Sbjct:  177 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYIIQHGSIREHQARKFA--RGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDSRKQ------LHTFCGSLYFAAPELLKAN--PYTGP-EVDVWSFGVV 333          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 63.5438 bits (153), Expect = 1.107e-10
Identity = 45/178 (25.28%), Postives = 89/178 (50.00%), Query Frame = 2
Query: 2003 IVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLS-LIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLN-ILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEII 2530
            IVA+K +N     E  + +  +I  + +L +  I  +I   +E +  ++V EYC  GS  DLL+   +N     ++S +I ++  G+ YLH     H  +K++N +++   ++KL DFG++  +R   K ++       +     W +PE++  +   +    K D++S  I   E++
Sbjct:   43 IVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLKRDT-------FVGTPYWMAPEVVCCEVDGY--NEKADIWSLGITTYELL 211          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 61.6178 bits (148), Expect = 5.521e-10
Identity = 41/161 (25.47%), Postives = 76/161 (47.20%), Query Frame = 2
Query: 2078 IKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVR----GMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVF 2548
            +K+L++++I  + G   E  +  +  EY P GS+  +L N        F  SLI +  R    G+ YLH     H  +K +N ++D +  +K+TDFG++  +++   N  +         + W SPE+++        T K D++S   +  E+   +  F
Sbjct:  508 LKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNY-----GPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGIS--KKLSPLNKKQNKRASLQGSVFWMSPEVVKQTAT----TAKADIWSTGCVVIEMFTGKHPF 657          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 58.151 bits (139), Expect = 7.129e-9
Identity = 39/124 (31.45%), Postives = 64/124 (51.61%), Query Frame = 2
Query: 1988 LFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGL 2359
            +F    VA   I + +   T K++L +I+  K +++ +I +FI    +  + Y++ E CP GSL +LL+  ++  +   R    Q I   + Y+HS    H  LK  N   DS + LK+ DFGL
Sbjct:  106 IFAAKTVAKASIKSEK---TRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQ-ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGL 225          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 532.717 bits (1371), Expect = 1.442e-177
Identity = 272/522 (52.11%), Postives = 369/522 (70.69%), Query Frame = 2
Query: 1952 NIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSN-YGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEI--DGCS-SDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEN 3505
            NI   Q+F    ++K N+VA+K+IN  R+ E T+E+  ++K ++ + ++++  F G CVEP +  ++ +YCPKGSL+D+LENE I LD MF  SL+ DIV+GM YLHS     HG LKS NCVVD R+VLK+TD+GLN  +  Q + S EE  +  Y + LWT+PE+LR       GT KGDVYSF II QE++ R G F +    + +P +I+E V   +  PFRP L  I  +G + + ++ + K  W+E+P++RPDF  I+ ++RK+  GK+S NI+DN+++ +E+YANNLE LV +RT +  +EK++ E+LL  MLP SVA  L+  + V+AE++++V+I+FSDIVGFTSLS++STP+QV++LLN LYT FD II N+DVYKVETIGDAYMVVSGLP  NG  HA EIA M L  L  I  F I HRPN +L+LRIG+HSG   AGVVG KMPRYCLFGDTVNT+SRMESNG  LKIHIS ST  +L     + + +RG+V +KGKG  +TYWL G +
Sbjct:    1 NINQRQIFTTVGIYKSNMVAIKRINK-RQIELTREIKYEMKLMRTVRHENLVTFTGACVEPPNICILLQYCPKGSLQDILENEDIKLDSMFVNSLLTDIVKGMAYLHSTEIRSHGRLKSPNCVVDGRWVLKITDYGLNKFKSNQ-DISEEEGEYAMYYRKLWTAPELLRAADPRPRGTQKGDVYSFGIIVQELLTRSGPFDLSYY-TNEPSDIIEKVTRVESPPFRPKLSTIVLEGPTVAGIVDLAKWCWEENPDHRPDFEEIRKTVRKLPMGKQS-NIMDNMVNLLEKYANNLESLVEERTSQLADEKRKTENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQVVDLLNDLYTLFDEIINNYDVYKVETIGDAYMVVSGLPIRNGHQHAGEIATMALHMLREIDSFKIRHRPNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPSTKRILDELGGYHIQKRGKVFLKGKGTWITYWLVGSD 518          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO30985 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SZ80])

HSP 1 Score: 522.316 bits (1344), Expect = 5.129e-173
Identity = 260/500 (52.00%), Postives = 360/500 (72.00%), Query Frame = 2
Query: 2003 IVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKI-DKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAI-FRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWL 3493
            + AL K    R  + ++++LL++K+++D+ +D++ +FIG CV P +  +V +YC +GSL+D+LEN+ + LD +F  SL+ DIV+GM YLH S+   HG+LKSSNC+VDSR+VLK+TD+GL +LR   K+++ E      ++ +LW +PEILR  + P  GT KGDVYSF+II QE   R G ++    +  +PK I+E V+ S+  P+RP +  +   + +L  ++KQ W EDP+ RPDF  IK ++R+I DK     NI DN+++ ME YA+NLE LVAQRT + ++EK++ + LL S+LP+ VA QL K ++V AES+ +VTIYFSDIVGFTSLSA+STPMQV+  LN LYT FD II+ +DVYKVETIGDAYMV SGLP  NGR HA EIA+M L  + A+   F++ H+P  +L+LR+G H+GPV AGVVG+ M RYCLFGDTVNT+SRMESNG PL+IHIS  T +VL    TF++  RG+V +KGKG   T+WL
Sbjct:    5 VAALPK----RTIDISRQLLLEMKQMRDIRHDNLNQFIGACVGPPNVCIVMQYCSRGSLQDILENDDVKLDLVFIASLLSDIVKGMEYLHNSDIRSHGNLKSSNCLVDSRWVLKITDYGLPLLRSRSKKSTIET----NWRDLLWVAPEILRIPSRPPKGTHKGDVYSFSIILQEFHTRDGPYS---ANYMEPKAIIEKVRKSEFPPYRPIVANLIDGAEELRDLMKQCWAEDPDLRPDFTEIKKTVRRIVDKSGMKKNIFDNMVNMMEIYADNLENLVAQRTDQLVDEKRKTDALLESILPRPVAEQLKKGKAVEAESFNEVTIYFSDIVGFTSLSAESTPMQVVTFLNDLYTIFDDIIQEYDVYKVETIGDAYMVASGLPIRNGRRHAGEIAKMALHLVDAVSHNFIVRHKPEYKLQLRVGCHTGPVVAGVVGNTMARYCLFGDTVNTASRMESNGEPLRIHISQQTKDVLDELGTFVVKSRGKVHLKGKGTVETFWL 493          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36203 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA1])

HSP 1 Score: 416.001 bits (1068), Expect = 5.753e-133
Identity = 217/470 (46.17%), Postives = 306/470 (65.11%), Query Frame = 2
Query: 1973 FIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQ--TLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLD-EIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGL 3370
            F + +  K  +VALK +        T++ML+++K+++D+ + ++  +IG+C  P +  +V +YC +GSL+++L N++I+LDW FR S   DI  GM  +H S+   HG L+SS C++DSR+V K+ DFGLN+L+  Q+ +  E   H  Y ++ W +PE+L+ +  T   + T  GDVYSF II  E++ R   +A        P E++E ++   + PFRP    EI   S  + K++ Q W++DP  RP F  IK  +R +  GK S  I+DN+L  ME Y   LE +V +RT++  +EK + ++LLY MLP+ +A  L + + V AESY  VTI+FSDIVGFT L+A STP+QV++LLN LYT FD+II+  DVYKVETIGDAYMVVSGLP  NG  HA EIA M L  LS++  F   H PN  + LRIG+H+G   AGVVG KMPRYCLFGDTVN +SRMES G+
Sbjct:   59 FCEHSFIKSYLVALKMLRKD-SLTLTRDMLIEMKQVRDVQHTNLLHYIGVCTTPPNICIVSQYCHRGSLQEILANDEISLDWFFRESFANDIAMGMHVIHTSSIHVHGDLRSSKCLIDSRWVCKVADFGLNLLKANQRPDP-EIGVHAQYSRLFWRAPELLQNEKSTNKPVPTQMGDVYSFGIILNELLTREEPYATTEFA---PIEVIERIRCHLNPPFRPETPFEIRNRS--VTKLMTQCWNDDPQARPTFSDIKRQLRLLKGGKSS--IVDNMLRLMENYTEQLETIVDERTRQLADEKAKTDELLYKMLPRYIAESLKRGEPVIAESYSSVTIFFSDIVGFTELAAASTPLQVVDLLNDLYTCFDTIIDKHDVYKVETIGDAYMVVSGLPVRNGHRHAGEIATMALNLLSSMGNFRARHLPNRPIHLRIGIHTGSCVAGVVGLKMPRYCLFGDTVNYASRMESTGV 519          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36182 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA4])

HSP 1 Score: 409.453 bits (1051), Expect = 6.447e-131
Identity = 225/501 (44.91%), Postives = 312/501 (62.28%), Query Frame = 2
Query: 2069 IKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVK--------GDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEI--DGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRK--IDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPE 3532
            +K ++DL++ ++ R++G+CVE  +  +V  +C +G+L+DLL N+ I LDWMFR S   DI  GM  +H S    HG+LKSSNC++DSR+  K+TD+GL++LR  Q      E     YK + WT+PE+L     P     K        GDVYS+ I+  EII R   ++  N D+   K+++E V+  +   FRP   +   +     ++++ +  WD D   RP F  IK  ++   +  GK SG     + SR   Y NN   LV  R    +  K+    LL  +L + +A +L K  SVSAES++ VTI+FSDIVGFTS++A STP+QV++LLN+LYT FD +++  DVYKVETIGDAYMVVSGLP  NG  HA E+A M L  LS +  F IPH P+ +++LRIG+HSG   AGVVG KMPRYCLFGDTVN +SRMES+GL L+IH+S    EVL     + + ERG V MKGKG  +TY+L G++ F   P+P+
Sbjct:    1 MKMVRDLHHANLNRYLGVCVESPNICMVSRFCNRGTLQDLLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLLRANQTPKDIGE--FAVYKNLFWTAPELL-----PLADGFKDRKNKTQAGDVYSYGIVLYEIITRDEPYST-NTDTLSSKDVIELVRKRQEPAFRPQFSKFMEEKSGHKMVQVTQDCWDNDAQKRPTFSAIKKKLKANGMGNGKISG-----MFSR---YYNNFSKLVISRMGVCMALKR----LL--VLSRPIADELKKGNSVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMKGKGTIVTYFLTGKDGFD-KPLPD 478          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36204 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA3])

HSP 1 Score: 409.068 bits (1050), Expect = 8.543e-131
Identity = 227/490 (46.33%), Postives = 305/490 (62.24%), Query Frame = 2
Query: 2078 IKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLE-----------LRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDF 3511
            +  L++ +I  +IG+C+   +  +V E C +GSL D+L N+ I LDW F++S   DI  GM  LH S    HG+L SSNC+VD  +V K+ D+GL   R  +     EE       K LW +PE +R  +    G+  GDVYSF +I  EI+ R   F      +     I+  + S++  P RP+L+  D C   + K IKQ W E+P+ RP F  IK SMRKI+ G+ S  ++D++L +M+ Y+NNLE LV +RT++   EK + + LLY MLP+ VA QL   +SV AE ++QVT++FSDIVGFT LS+ STP+QV+  LN LYT FD+II N+DVYKVETIGDAYMVVSGLP  N   HA EIA M L  L  I  F I H P+T+L            L   + SGP  AGVVG K PRY +FGDTVN +SRMESNG+P +IHIS    + L +   + M  RGE+E+KGKGK +TY+L+G++ F
Sbjct:    2 VHKLSHVNINPYIGVCITAPNICIVSEACGRGSLADVLINDDIKLDWTFKMSFATDIAAGMEALHASEVSFHGNLTSSNCLVDRMWVCKIADYGLQ--RFSKHTYEPEEQLTGQTGKSLWMAPEHMRNAS--STGSQPGDVYSFGVILSEIVTRCEPFETLRATT----SILRRIMSTEFPPLRPTLNA-DDCDPTITKFIKQCWSEEPSARPTFRDIKKSMRKINGGR-SLRLVDSMLGKMDIYSNNLEVLVEERTRQLEAEKAKTDQLLYEMLPRPVADQLKSGKSVEAELFDQVTVFFSDIVGFTKLSSSSTPIQVVTFLNDLYTYFDNIIPNYDVYKVETIGDAYMVVSGLPEKNRDRHAGEIATMALHLLCDIRTFKIRHVPDTRLVSSYSLLLIITCLFYLIFSGPAVAGVVGIKKPRYDVFGDTVNVASRMESNGVPNRIHISAECRKALLNLGGYHMERRGEIELKGKGKVITYFLNGKDGF 481          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 316/537 (58.85%), Postives = 394/537 (73.37%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNY-GCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            S    SY SL+T  G         Q+F KT  FKGN+VA+K +N  ++ E T+++L+++K ++D+  +H+ RFIG C++P +  +V EYCP+GSL+D+LENE INLDWMFR SLI DIV+GM +LH++Y GCHG+LKSSNCVVDSRFVLK+TD+GL   R     +   + SH  Y K LWT+PE+L     P  GT KGDVYSF II QEI  R G F V++ D   PKEIV+ V++ +   FRP+ D     S +L  +++  W EDP  RPDF  IK  M K++K + S +IL+NLLSRMEQYANNLE LV +RTQ YLEEK++AE+LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTS+SA+STP+QV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HAREIA M L  L  +  F I HRPN QL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S +T EVL  F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:  475 SQRGSSYGSLITAQG-------KYQLFAKTGYFKGNLVAIKHVNK-KRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLASFRS----SCENDDSHALYAKKLWTAPELLIYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVESMD-LSPKEIVQKVRNGQRPYFRPTTDS-RFHSEELTILMEGCWAEDPAERPDFGHIKIYMAKLNK-EGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGE 996          

HSP 2 Score: 97.8265 bits (242), Expect = 3.770e-20
Identity = 77/277 (27.80%), Postives = 128/277 (46.21%), Query Frame = 2
Query:  923 LSEFVFIHI--DLFTGLNPRPWFDQKSSDE----VNESVRNAFR-----SMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDR---ITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
            LSE +F+++  ++   ++ RP+ +++   E    + E+ R+ F      S+ ++    P N EY        L   A+  +  +     ++Y+  SFY+  +LYA+AL++  A+    +    IT    NR+F G    V ID    R  D  L+ + + ++G +  V +YNGST+     + + I W      PPLD P C F  D   C       G++   +  AL + G I  F  YR+LK + EL  M W + WE L      K+ +   SR
Sbjct:  200 LSEGIFMNLKDEMNMTVSARPYTNEQDYKELVSFIKENGRSKFTHQYDTSVFVITYHPPDNPEY--KDFQRKLHARAQRDFGVNLEPSLMDYIAGSFYDGFVLYAMALDETLAEGGAQNNGINITRRTQNRSFWGVTGLVSIDKRNARNIDVDLWAMTNQETGEYGVVSYYNGSTKEIVWSQTEKIHW--PSCGPPLDNPPCVFSTDDPSCNDGLPVLGIVAVGSGLALIIFG-ISSFLIYRKLKLEKELAGMLWRVQWEDLQFESPNKYHKRAGSR 471          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 316/537 (58.85%), Postives = 394/537 (73.37%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNY-GCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGE 3502
            S    SY SL+T  G         Q+F KT  FKGN+VA+K +N  ++ E T+++L+++K ++D+  +H+ RFIG C++P +  +V EYCP+GSL+D+LENE INLDWMFR SLI DIV+GM +LH++Y GCHG+LKSSNCVVDSRFVLK+TD+GL   R     +   + SH  Y K LWT+PE+L     P  GT KGDVYSF II QEI  R G F V++ D   PKEIV+ V++ +   FRP+ D     S +L  +++  W EDP  RPDF  IK  M K++K + S +IL+NLLSRMEQYANNLE LV +RTQ YLEEK++AE+LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFTS+SA+STP+QV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ HAREIA M L  L  +  F I HRPN QL LRIG+H+GPVCAGVVG KMPRYCLFGDTVNT+SRMESNG  LKIH+S +T EVL  F  F +  RG+VEMKGKGK  TYWL GE
Sbjct:  527 SQRGSSYGSLITAQG-------KYQLFAKTGYFKGNLVAIKHVNK-KRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLASFRS----SCENDDSHALYAKKLWTAPELLIYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVESMD-LSPKEIVQKVRNGQRPYFRPTTDS-RFHSEELTILMEGCWAEDPAERPDFGHIKIYMAKLNK-EGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGE 1048          

HSP 2 Score: 128.642 bits (322), Expect = 1.224e-29
Identity = 109/426 (25.59%), Postives = 188/426 (44.13%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTEGYKADA-SSLKEIREKLKLLSSMSRVIIICGA-SKYTRLIMLAAVEIKLDLSEFVFIHIDLFTG--LNPRPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDR---ITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR 1696
             F GP  +  L ++ R   + +   L++ G   Y FE  D  +Y+ + RI  +   L  F+  L   + W  R    + +FY   +    +++ ++ +   LK+       A   ++ ++ +E +  +    R+I ICG    +  ++ L   EI+ D   +   ++D+F     + +PW + K  D  N      F+S+ ++    P N EY        L   A+  +  +     ++Y+  SFY+  +LYA+AL++  A+    +    IT    NR+F G    V ID    R  D  L+ + + ++G +  V +YNGST+     + + I W      PPLD P C F  D   C       G++   +  AL + G I  F  YR+LK + EL  M W + WE L      K+ +   SR
Sbjct:  113 VFFGPGCVYPLASVGRFV-SHWKLPLITAGGPAYGFEKLD--EYKTIVRIGPSTTKLGAFVNVLHTQFNWTSRA---VVIFYDLKQDDRPHYFLSEGIFMNLKDEMNMTVSARPYTNEQDYKELVSFIKENGRIIYICGPLETFLSIMKLFQSEIQ-DPESYAIFYLDVFAESLTHRKPWQNAKF-DWTNPI--QVFKSVFVITYHPPDNPEY--KDFQRKLHARAQRDFGVNLEPSLMDYIAGSFYDGFVLYAMALDETLAEGGAQNNGINITRRTQNRSFWGVTGLVSIDKRNARNIDVDLWAMTNQETGEYGVVSYYNGSTKEIVWSQTEKIHW--PSCGPPLDNPPCVFSTDDPSCNDGLPVLGIVAVGSGLALIIFG-ISSFLIYRKLKLEKELAGMLWRVQWEDLQFESPNKYHKRAGSR 523          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 309/539 (57.33%), Postives = 394/539 (73.10%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEND 3508
            S    +Y SL+T+ G       N Q++ KT  +KGN+VA+K IN  ++ E T+ +L ++K ++D++N+H+ RFIG CV+P +  ++ EYCP+GSL+DL+E+E + LDWMFR SLI DIV+GM +LH S    HG+LKSSNCVVDSRFVLK+TD+GL  LR     +S  + +H YY + LWT+PE+LRT+  P  GT KGDVYSF II QE+   +GVF +D   +  PKEI++ V        RPSL      S +L  ++++ W E+P  RPDF  IK  +RK  +G  S NILDNLLSRMEQYANNLE LV +RTQ Y EEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STP+QV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ H RE+ARM L  L A+  F I HRP+ QL LRIGVHSGPVCAGVVG KMPRYCLFGDTVNT+SRMES G  LKIH+S +T +VL+ F TF +  RGE+E+KGKG   TYWL GE++
Sbjct:  529 SMKGSNYGSLMTMEG-------NLQIYTKTGYYKGNLVAIKYINK-KRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDYGLQSLRT----SSCPDDTHAYYARKLWTAPELLRTEDPPLCGTQKGDVYSFGIILQELALLKGVFYIDT-HTLIPKEIIQGVIRGGVPLLRPSLC-FHSHSEELGVLMQRCWCEEPGERPDFNTIKILLRKQHRGYGS-NILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQGEDN 1052          

HSP 2 Score: 154.451 bits (389), Expect = 1.469e-37
Identity = 125/444 (28.15%), Postives = 205/444 (46.17%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSD---YFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFT----GLNP-RPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTL---------DRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPW-----ESLDTVEKRKHRQSQISRKDS 1705
            AFIGP    S   +AR + T ++  +V+ G     F      ++  +T     H+ L  F  K+ + + W    H +  + + D+K  +D    +++ + +   +  +    +     S    +E ++++    RV+ +C +    R +M+   +  +DL  +VF  IDLF     G  P  PWF     D+ + + R AFRS+ ++    P N+EY        L+K A + +NF+      N +   FY+ +MLY+ ALN+  +K             D +T  MWNRTF G M  V++D  G+R  DF+L+D+ D  SG F+ V  YN S +   L +G + +W      PPL+ P+C F  D   C     +   +       +FVI +    F YR+LK + EL A  W + W      +LD V +R   +  IS K S
Sbjct:  107 AFIGPGCDYSSSPVARFT-THWDVPMVTAGARADGFS-----KFAAVTNTGPTHKKLGEFSLKIQETFGW----HHHTMLIFSDNKDDNDERTCYFAIEGLYSLMGKHNITVFDYFVESNINHKELVQIIQKNGRVVYLCCSWDNMRSLMVQFWKEGVDLENYVFFFIDLFAEGLGGEKPGMPWF---RGDQDDHAARLAFRSVKVLTYMEPQNAEY--HQFVETLKKDAEKMFNFTIKDSLYNLIAGGFYDGVMLYSRALNETLSKRKPGLRPVQRPKGDMVTQRMWNRTFQGVMGTVEMDKFGDREIDFALWDMTDINSGKFEVVCVYNSSIKELVLQKGLNFQWPG--GSPPLEVPECGFKNDNPACLTSTVTMHQMVAMVICFVFVIIITITIFIYRKLKLENELAAQLWRVSWVDIQMSNLDKVLRRACSRLTISMKGS 533          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 309/539 (57.33%), Postives = 394/539 (73.10%), Query Frame = 2
Query: 1895 SASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEND 3508
            S    +Y SL+T+ G       N Q++ KT  +KGN+VA+K IN  ++ E T+ +L ++K ++D++N+H+ RFIG CV+P +  ++ EYCP+GSL+DL+E+E + LDWMFR SLI DIV+GM +LH S    HG+LKSSNCVVDSRFVLK+TD+GL  LR     +S  + +H YY + LWT+PE+LRT+  P  GT KGDVYSF II QE+   +GVF +D   +  PKEI++ V        RPSL      S +L  ++++ W E+P  RPDF  IK  +RK  +G  S NILDNLLSRMEQYANNLE LV +RTQ Y EEK++AE LLY +LP SVA QL + ++V AE+++ VTIYFSDIVGFT+LSA+STP+QV+ LLN LYT FD+II+NFDVYKVETIGDAYMVVSGLP  NG+ H RE+ARM L  L A+  F I HRP+ QL LRIGVHSGPVCAGVVG KMPRYCLFGDTVNT+SRMES G  LKIH+S +T +VL+ F TF +  RGE+E+KGKG   TYWL GE++
Sbjct:  470 SMKGSNYGSLMTMEG-------NLQIYTKTGYYKGNLVAIKYINK-KRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDYGLQSLRT----SSCPDDTHAYYARKLWTAPELLRTEDPPLCGTQKGDVYSFGIILQELALLKGVFYIDT-HTLIPKEIIQGVIRGGVPLLRPSLC-FHSHSEELGVLMQRCWCEEPGERPDFNTIKILLRKQHRGYGS-NILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQGEDN 993          

HSP 2 Score: 87.4261 bits (215), Expect = 6.329e-17
Identity = 107/433 (24.71%), Postives = 175/433 (40.42%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSD---YFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFT----GLNP-RPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPW-----ESLDTVEKRKHRQSQISRKDS 1705
            AFIGP    S   +AR + T ++  +V+ G     F      ++  +T     H+ L  F  K+ + + W    H +  + + D+K  +D    +++ + +   +  +    +     S    +E ++++    RV+ +C +    R +M+   +  +DL  +VF  IDLF     G  P  PWF     D+ + + R AFR    V+ P        SI N         YN S         TT   +S M               +   +  +W     G M  V++D  G+R  DF+L+D+ D  SG F          E   L +G + +W      PPL+ P+C F  D   C     +   +       +FVI +    F YR+LK + EL A  W + W      +LD V +R   +  IS K S
Sbjct:  107 AFIGPGCDYSSSPVARFT-THWDVPMVTAGARADGFS-----KFAAVTNTGPTHKKLGEFSLKIQETFGW----HHHTMLIFSDNKDDNDERTCYFAIEGLYSLMGKHNITVFDYFVESNINHKELVQIIQKNGRVVYLCCSWDNMRSLMVQFWKEGVDLENYVFFFIDLFAEGLGGEKPGMPWF---RGDQDDHAARLAFR----VRHP--------SIFNSF-----SVYNLS---------TTITPQSFM--------------QIKMCSEPVWCVVSAGVMGTVEMDKFGDREIDFALWDMTDINSGKF----------EVKHLPKGLNFQWPG--GSPPLEVPECGFKNDNPACLTSTVTMHQMVAMVICFVFVIIITITIFIYRKLKLENELAAQLWRVSWVDIQMSNLDKVLRRACSRLTISMKGS 474          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc2 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125799])

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 306/541 (56.56%), Postives = 395/541 (73.01%), Query Frame = 2
Query: 1889 RGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLH-SNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGEND 3508
            RGS    +Y SL+T +G       N QVF KT  +KGNIVA+K  N  ++ E  +++L ++K ++D+ N+H+ RFIG CV+P +  ++ EYCP+GSL+D+LEN+ I L+WMF+ SLI DIV+GM++LH S    HG LKSSNCVVD+RFVLK+TD+GL+  R+     S+   SH YY + LW +PE+LR +  P  GT KGDVYSF+II QE+  RRG F +D  D   PKEIV+ V        RPS+D     S +L +++++ W E+P  RPDF  I+  +RK +K   + NILDNLLSRMEQYANNLE LV +RTQ Y EEK++AE LLY +LP SVA QL + ++V AE+++ V+IYFSDIVGFT+LSA+STPM+V+ LLN LYT FD++I+NFDVYKVETIGDAYMVVSGLP  NG+ H REIARM L  L  +  F I HRP  QL+LRIG+HSGPVCAGVVG KMPRYCLFGDTVNTSSRMES+G  LKIH+S +T +VL  F +F +  RG++++KGKGK  TYWL GE+D
Sbjct:  539 RGS----NYGSLMTANG-------NLQVFAKTGYYKGNIVAIKYTNK-KRIELNRKVLFELKHMRDVQNEHLTRFIGACVDPPNICIITEYCPRGSLQDILENDSITLEWMFKFSLINDIVKGMVFLHNSVIFSHGKLKSSNCVVDNRFVLKITDYGLSTFRQESDVGSD---SHSYYAQKLWMAPELLRMENPPPQGTQKGDVYSFSIILQEVALRRGAFYLDG-DPLSPKEIVDRVILGDWPCLRPSIDP-QSHSPELGQLMQRCWAEEPTERPDFNHIRLLLRKHNKESRT-NILDNLLSRMEQYANNLEELVEERTQAYHEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVSIYFSDIVGFTALSAESTPMEVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREIARMALALLDTVRTFRIRHRPEQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESSGEALKIHVSAATRDVLIEFNSFQLELRGDIDIKGKGKMTTYWLLGESD 1061          

HSP 2 Score: 145.591 bits (366), Expect = 8.649e-35
Identity = 113/414 (27.29%), Postives = 191/414 (46.14%), Query Frame = 2
Query:  455 AFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKE-MMERLKNYKTEGYKADASSLKE---IREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLF--TGLNPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALND---LYAKNDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDL-DPKSGNFQQVGFYNGSTETYSLIEGKSIEW-GNEKNEPPLDTPKCAF--DGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESL 1651
            AFIGP    +   +   + T ++  L++ G       F D + Y  +T     H+ L  F  ++ + + W     + + + + D+K      Y A E + E LK+       +     K      + L  + ++ RV+ +C +    R +M+   +  L   ++VF++IDLF  +  N +PW      D +    ++AF+S+ I+  + P N EY       DL+  A+  +N+S     +N +   FY+ +MLYA ALN+   +         I+  MWNRTF+G    + +D  G+R +DF+L+DL D  S +FQ V  YN   E  + + G S+ W G  +   PLD PKC F  D   C     +   +   T   +F + +    F  R++K + EL A  W I W+ +
Sbjct:  122 AFIGPGCSYTASPVGLFT-THWDVPLITAGAPA--IAFLDGI-YPTITNTGPTHKKLGRFALRICEHFGW----REYVTLMFSDNKEDDRPCYFAMEGLYEELKSINISLQDSVFEENKPPINYSQILADIQNIGRVMFVCCSPDVFRRLMIEFWKADLPHEQYVFLYIDLFAVSLSNKQPWARGDQDDTI---AKDAFQSVKILSYREPQNQEY--QQFVRDLKADAKTSFNYSVQDSLMNIIAGGFYDGLMLYAHALNETALVPGARPPGKLISGKMWNRTFHGVTGLLHLDVSGDRETDFALWDLVDTNSSSFQIVVVYNSFEEQVTPVPGTSVRWLGGAR---PLDVPKCGFKNDNPACLTKTITIHQMVSITLFFIFTMTLTIAIFICRKMKLEKELVAQLWRISWDDI 519          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000019264.1 (SMESG000019264.1)

HSP 1 Score: 2360.1 bits (6115), Expect = 0.000e+0
Identity = 1167/1170 (99.74%), Postives = 1168/1170 (99.83%), Query Frame = 2
Query:   47 MCTRNHFGGWLIFILLIXXXXXXXXXXXXXITLLAGMGSYKCGKKLSPREFRIAVLMTNSNLEKNNGNNMIVENSKKLGPITDLALARIEKLKKKGELQGFANYSLKLFFSESSTVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPESAKIIQCE 3556
            MCTRNHFGGWLIFILLISESNSSDNNDGNGITLLAGMGSYKCGKKLSPREFRIAVLMTNSNLEKNNGNNMIVENSKKLGPITDLALARIE +KKKGELQGFANYSLKLFFSESSTVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNPRPWFD KSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGDKKLDKKDQKKKKSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPESAKIIQCE
Sbjct:    1 MCTRNHFGGWLIFILLISESNSSDNNDGNGITLLAGMGSYKCGKKLSPREFRIAVLMTNSNLEKNNGNNMIVENSKKLGPITDLALARIENMKKKGELQGFANYSLKLFFSESSTVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTEGYKADASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNPRPWFDPKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDRITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGDKKLDKKDQKKKKSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPESAKIIQCE 1170          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000056411.1 (SMESG000056411.1)

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 529/1094 (48.35%), Postives = 710/1094 (64.90%), Query Frame = 2
Query:  311 IEKLKKKGELQGFANYSLKLFFSESSTVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNH-ESLTNFM-GKLLKFYKWLPRPHKNIGVFYID--DKSYSDY-----FYSAKEMMERLKNYK----TEGYKADASSLKEIREKL-KLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLN--PRPWFDQKSSDEVNESVRNAFRSMLIVKL--PLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDR---ITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVP 3529
            +EK++K   +         L+  +S  +  H+ + +    F+ + P   F GP     +  IAR+    +NR +++ G   Y F      ++  LTR+   H +  T ++  +L   YKW    +K   +F+ D  + +   Y      Y  K   + +KN+     TE +  D  +   I   L + + + + + I+C      R IML A  +     E++F++ID+F+  +   RPW+ +   +E NE  + AFR+++ + L  P   +Y       ++++ A+ +YNF+   E +N   +SF+++++LYAL LND  +K   ++    +   MWNR+F    T V I  +G+R +DFSL DL+ ++G F+ V  Y G    Y  +  K I+WG   N+ PLDTP C +D S C K G + G I      A   I +IGG F +RR KFQAEL AMNWIIPW+ L+T EKR+ + S          +   N       + +    + + +   E IE    +     +           R   ++   SN S  SL TI G+ L+++   Q+F KTALFKGN+VALK IN   K E T E+L++IKKIKD++NDHICRFIG+C++  H Y+VYEYCPKGSLED+L  EQI LDWMF+ SL+QDI RGMIYLH+N+G HG+LKSSNC+VDSRFVLK+TDFGL  L+  +    +EEP+  YYK  LWT+PE+L     P  GT+KGDVYSFA+I QEI+YR GVF++    +   KEI E V++    PFRP+L   DGC+ D++K+I+QAWDEDP +RPDF  IK  MRK++KG ++GNILDNLLSRMEQYANNLEGLVA+RT++YLEEK++AEDLLYSMLPK VAHQLIKNQ+V AESY+ VTI+FSDIVGFT+LSA+STPMQ+IELLNRLYTTFDSIIEN+DVYKVETIGDAYMV SGLP +NG  H+REIARM + FL AI  F+IPHRP+ +LELRIG+HSGPVC+GVVG KMPRYCLFGDTVNTSSRMESNGLPLKIHIS ST E+L +F TFI+SERG +++KGKG QLTYWLHGE+  IVDP+P
Sbjct:   73 LEKVRKMENINPIIKNIKILYPIDSDCLQTHKPLYESVINFVKEMPDVIF-GPICDYVIAPIARLMAF-WNRPVITTGALYYAFSSDRIAEFHTLTRVGSGHLDKYTGYLISELFSKYKW----NKGKYIFFKDAYNSTIPMYCHGLGIYLVKGARKIVKNWPIKVYTELHPNDIKNDSTIDNMLIEQIGNKNAINILCADPDIVRKIMLRAASLNFINGEYLFLNIDIFSSQDIIERPWYRKDRPNEENEIAKKAFRTLMTITLRKPEGEKY--KEFSAEVKRRAKMEYNFTDENELVNSFVSSFHDAVILYALGLNDTLSKGGKIEDGELVVKNMWNRSFESLGTTVTISPDGDRYADFSLMDLNQQTGMFEVVSNYIGRKRKYKPVNDKIIDWGTVNNKIPLDTPTCGYDLSGCPKPGYNIGAISAGVMGAFVAIAIIGGVFIHRRTKFQAELNAMNWIIPWDDLETSEKRRRKFSDGDNFHPYTKKRFSN--IMNKNEMENLSLTKDDELKHESIENYYLMTDIDTSKKKKHKLNKLRRYNSYKDDESNISNKSLDTIIGINLDSMHKVQLFAKTALFKGNLVALKPINVNGKIEITTELLIEIKKIKDMSNDHICRFIGVCLD--HPYIVYEYCPKGSLEDVLAKEQIKLDWMFKYSLMQDICRGMIYLHNNHGPHGNLKSSNCLVDSRFVLKITDFGLPSLKGNKTNMMHEEPNM-YYKSFLWTAPELLNLSNPPVNGTIKGDVYSFAVICQEIVYRNGVFSLTPDPNLTSKEIFEKVRNKDSPPFRPTLMLTDGCTDDVLKLIQQAWDEDPTSRPDFATIKLLMRKLNKGGDTGNILDNLLSRMEQYANNLEGLVAKRTEQYLEEKQKAEDLLYSMLPKFVAHQLIKNQNVIAESYDMVTIFFSDIVGFTALSAESTPMQIIELLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHSREIARMSIAFLQAISIFIIPHRPDKKLELRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPLKIHISQSTKEILDTFGTFIISERGHIDLKGKGLQLTYWLHGEDSNIVDPLP 1153          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 525/1069 (49.11%), Postives = 702/1069 (65.67%), Query Frame = 2
Query:  431 FILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLT--NFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYF---------YSAKEMMERLKNYKTEGYK--ADASSLKEIREKLKLLSSMSR---VIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNPR--PWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDR---ITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKK--DGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKH--RQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNE-----SYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHV-PFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPESA 3538
            F+   P     GP     L  IAR+    +N  ++S G   Y F  + K +++ LTRI   H  L     + K  K YKW        G++     +Y++           Y  +E    +  +    YK    A+   +   +  L+ ++     V ++C        I+L A ++  +  E+VFI+I LF+  N    PW+   S+   N   + A+RS+L V  K+P N ++ N S  + ++++A  +YN+ Y K+ +N   ++FY+ ++LYA ALN   A    +     I   MWN TF G    V ID+ G+R++DFS+ D+DPK+G F+ V  + G+  ++ ++   S++WG+  N  P   P+C +D S+C K     + G I       LF+I    G+F YR +K QAEL AMNWIIPWESL+T EK ++    + +  +   ++ + +            + +S N +G++   EME   LL+     S     ++  N K+ G+   +     S  SL TI+G+ L+ IQN Q+F KTAL+KGN+VALK I + R+ +  +++L+ +KK+KDLNNDHICRFIG C+E  +QY+VY+YCPKGSLED+L  EQI LDW+F+ SLIQDI RGM+YLH+N G  G LKSSNC+VDSRFVLK+TDFGL  LR   K+   EE S+ Y+K +LWT+PE+LR    P  GT KGDVYSFAI+ QEI+YR+GVF++D+ D    +EIVESVK+     PFRPSL  I GC+ D + +IKQ+W+EDP  RPDF  IK  MRK +K  +SGNILDNLLSRMEQYANNLE +V +RT++YLEEKK+AEDLLYSMLPKSVAHQLIKNQ V+AESY+ VTI+FSDIVGFT+LSA+STPMQ+I+LLNRLYTTFDSIIEN+DVYKVETIGDAYMV SGLP +NG  HAREIARM + FLSAIF FVIPHRP+ +L+LRIG+HSGPVC+GVVG KMPRYCLFGDTVNTSSRMESNGLP KIHIS STM++LK+F TF+M+ERG +E+KGKG   TYWLHGEN+ IVDPVP+ A
Sbjct:  101 FVTQMP-DVLFGPICGYVLAPIARLLAF-WNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKW------THGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFS--DQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRNLVNHNCVKYQSKPIHNSKVK---------VHQSRSQNVKGTRN--EMENLHLLHEVEKPSS---KISRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRG-SKQYLLEEDSNVYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPVPKDA 1144          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000010241.1 (SMESG000010241.1)

HSP 1 Score: 979.163 bits (2530), Expect = 0.000e+0
Identity = 524/1067 (49.11%), Postives = 694/1067 (65.04%), Query Frame = 2
Query:  431 FILDEPVHAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLT--NFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYF---------YSAKEMMERLKNYKTEGYK--ADASSLKEIREKLKLLSSMSR---VIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGLNPR--PWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDR---ITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKK--DGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKEKIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNE-----SYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHV-PFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPESA 3538
            F+   P     GP     L  IAR+    +N  ++S G   Y F  + K +++ LTRI   H  L     + K  K YKW        G++     +Y++           Y  +E    +  +    YK    A+   +   +  L+ ++     V ++C        I+L A ++  +  E+VFI+I LF+  N    PW+   S+   N   + A+RS+L V  K+P N ++ N S  + ++++A  +YN+ Y K+ +N   ++FY+ ++LYA ALN   A    +     I   MWN TF G    V ID+ G+R++DFS+ D+DPK+G F+ V  + G+  ++ ++   S++WG+  N  P   P+C +D S+C K     + G I       LF+I    G+F YR +K QAEL AMNWIIPWESL+T EK ++               L+N +    +             S+ +  ME   LL+     S     ++  N K+ G+   +     S  SL TI+G+ L+ IQN Q+F KTAL+KGN+VALK I + R+ +  +++L+ +KK+KDLNNDHICRFIG C+E  +QY+VY+YCPKGSLED+L  EQI LDW+F+ SLIQDI RGM+YLH+N G  G LKSSNC+VDSRFVLK+TDFGL  LR   K+   EE S+ Y+K +LWT+PE+LR    P  GT KGDVYSFAI+ QEI+YR+GVF++D+ D    +EIVESVK+     PFRPSL  I GC+ D + +IKQ+W+EDP  RPDF  IK  MRK +K  +SGNILDNLLSRMEQYANNLE +V +RT++YLEEKK+AEDLLYSMLPKSVAHQLIKNQ V+AESY+ VTI+FSDIVGFT+LSA+STPMQ+I+LLNRLYTTFDSIIEN+DVYKVETIGDAYMV SGLP +NG  HAREIARM + FLSAIF FVIPHRP+ +L+LRIG+HSGPVC+GVVG KMPRYCLFGDTVNTSSRMESNGLP KIHIS STM++LK+F TF+M+ERG +E+KGKG   TYWLHGEN+ IVDPVP+ A
Sbjct:  101 FVTQMP-DVLFGPICGYVLAPIARLLAF-WNIPILSTGAVYYGFRKERKSEFKTLTRIGSGHLDLVLGQMIQKTFKKYKW------THGIYIYHKTAYTNVIPLYCHALGGYLTQEFEITVDYWPIRQYKELTTATLTNDTALEQFLIDAIGNKYAVAVLCVDPASVHRILLKADQLNFNNGEYVFINIGLFSSGNETKYPWYLTASNQSENSRAKRAYRSLLSVTLKIPENEKFRNFS--DQVKEMASREYNYHYEKDLINTFVSNFYDGVLLYAHALNKTLADGGAISNGSLIIKNMWNTTFEGIGGTVTIDSSGDRIADFSILDMDPKTGEFKPVAHFIGTKSSFLVVPNVSVDWGSVSNVIPSTKPRCGYDNSMCPKPDKNLNIGAISAGVMGCLFLISFSAGYFVYRNIKLQAELNAMNWIIPWESLETSEKIRN---------------LVNHNCVKYQSKPIHNSKVKVHQSRSQ-NMENLHLLHEVEKPSS---KISRNNSKNFGNPIYKDLDLISCASLETIAGINLDKIQNAQLFTKTALYKGNVVALKPILSQRRIDINRQLLIQVKKVKDLNNDHICRFIGACLEIGYQYMVYDYCPKGSLEDVLAKEQITLDWVFKYSLIQDICRGMVYLHNNLGPIGTLKSSNCLVDSRFVLKITDFGLISLRG-SKQYLLEEDSNVYFKNLLWTAPELLRMSNPPLDGTFKGDVYSFAIVCQEIVYRKGVFSLDSEDDFSAQEIVESVKAENSPNPFRPSLTAIHGCTEDFVLLIKQSWNEDPVLRPDFNTIKYHMRKFNKEGDSGNILDNLLSRMEQYANNLEDIVQERTEQYLEEKKKAEDLLYSMLPKSVAHQLIKNQPVNAESYDLVTIFFSDIVGFTALSAESTPMQIIDLLNRLYTTFDSIIENYDVYKVETIGDAYMVCSGLPQLNGNLHAREIARMAIAFLSAIFCFVIPHRPDKELKLRIGIHSGPVCSGVVGLKMPRYCLFGDTVNTSSRMESNGLPHKIHISQSTMQLLKTFGTFLMTERGHIEVKGKGSTQTYWLHGENELIVDPVPKDA 1137          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 949.888 bits (2454), Expect = 0.000e+0
Identity = 513/1049 (48.90%), Postives = 697/1049 (66.44%), Query Frame = 2
Query:  452 HAFIGPNSIISLGTIARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTR----IAGNHESLTNFMGKLLKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTEGYKA----DASSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIHIDLFTGL--NPRPWFDQKSSDEVNESVRNAFRSMLIV--KLPLNSEYWNSSIGNDLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDR---ITNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGSTETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTAALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISRKDSTVNETLINGXXXXXXXXXXXXXSGNYQGSKE---KIEMETTLLLNSPNSDSDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFKGNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPEILRTQT-LPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHGENDFIVDPVPESAK 3541
            + + GP    SL  IAR+        +   G +G   + K + +Y  LTR    I  +H  L     K+ + Y W       + + Y  ++++ ++  S   + +  +NYK + +K+    +A +L EI      + S + V+++C   +  R I+L A ++     E+VFI+IDL T    N +PW+ +  +DEVN   + A+RS+L V  + P + EY N     +++    EKY      EE N     F++S++LYALALND  A N T +    IT  MWNRT  G    + ID  G+R +D+S+ D+D  +G F+ V  Y G  + Y  +EG+ I+W N+KN PP   P C ++   C       G I   T AA+ +  +I GF+ Y+R+KFQAEL AMNW+IPW++++T EKR HR +        V++TL N +            +  +Q SK    K + E+ +L+ +P+   D+     +++   R ++ N S  S  + +G+Q +N+   + FI TAL+KGN+VALK+++  +K E  + +L+++KK+K+LNN+HICRFIG+C++    +L+ EYCPKGSL+D+LENEQINLDWMF+ SL+QDI RGMIYLHSN G HG+LKSSNC+VDSRFVLK+ DFGL  LR   KE   E   + YY+ +LWT+PEILR  T +    + K DVYSF II QE++YR GVF + + +  +PK+IVE V   + +P+RP L E + CS  L +II+Q+W ED + RPDF  IK  MR ++KG +SGNILDNLLSRMEQYANNLE LV QRT++YLEEK++ EDLLYSMLPKSVA QLI+N++V+AESYE V+IYFSDIVGFT+LSA+STPMQVIELLNRLYTTFDSIIE+FDVYKVETIGDAYMV SGLP  NG  H REIARM L FLSAIF F IPH+PN ++ELRIG+HSGPVCAGVVG KMPRYCLFGDTVNT+SRMESNGLPLKIH+S  +++VL++FQ FI+S+RG+V MKGKG Q TYWLHGE+  IVDP+PES +
Sbjct:   52 YVWFGPICDYSLAPIARLLPFWDIPIITPCGASGIFRQMKHE-EYSTLTRVNSIIVTDH--LKVLFRKIFQMYNW-----SRVKLIY--EQTFLNFCRSVGTLFDS-ENYKNKTFKSVVLLNAETLLEID-----MGSENAVVVLCVEPESVRRILLKAHKLNFINGEYVFINIDLLTSKTNNQKPWYSKNDTDEVNFKAKEAYRSLLTVTAQRPESEEYQN--FIKEVKNRTNEKYG---SVEESNKFLGVFHDSLLLYALALNDTMAMNLTYENGTFITRKMWNRTIQGITGEMSIDENGDRNADYSVLDMDKDTGIFKIVANYIGKKQLYIPVEGQIIDWVNKKNLPPPSFPVCGYNRKNCPNRKIGAGTISLITMAAILLFALINGFYIYKRVKFQAELNAMNWLIPWDNVETREKR-HRLTH------KVSDTLPNSELF----------TKRFQYSKRGLAKFDEESDVLIGNPSLAGDV-----VKSRPSRVNSINISINSWESFTGLQNDNLHCIKTFITTALYKGNVVALKQLHGSKKVEINRNLLIEVKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKLRG-TKEYLLENDEYAYYRNLLWTAPEILRKTTEIHLQKSTKADVYSFGIICQEVVYRNGVFYLSDINL-EPKQIVEFVTKVQLIPYRPFLSENEICSEGLCRIIRQSWQEDFSLRPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFEFQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHGEDSVIVDPIPESCE 1055          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR13.535e-4556.19natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
NPR23.791e-3556.55natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
GUCY2F2.588e-13345.77guanylate cyclase 2F, retinal [Source:HGNC Symbol;... [more]
GUCY2D5.474e-13044.44guanylate cyclase 2D, retinal [Source:HGNC Symbol;... [more]
GUCY2C2.525e-12543.80guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-283.323e-3955.21Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-286.956e-4455.21Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-281.098e-4655.21Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-280.000e+052.88Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-211.382e-13837.82Receptor-type guanylate cyclase gcy-21 [Source:Un... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG32160.000e+036.23gene:FBgn0034568 transcript:FBtr0273396[more]
CG311832.931e-4856.59gene:FBgn0051183 transcript:FBtr0346151[more]
CG311832.931e-4856.59gene:FBgn0051183 transcript:FBtr0083187[more]
CG107384.212e-15949.25gene:FBgn0036368 transcript:FBtr0304791[more]
CG107384.243e-15949.25gene:FBgn0036368 transcript:FBtr0304792[more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1b0.000e+045.14natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
npr1b0.000e+040.08natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
si:dkey-37g12.10.000e+038.88si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
si:dkey-37g12.10.000e+038.63si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
npr24.708e-3357.54natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR20.000e+057.79natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+057.79natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+057.79natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+057.79natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
NPR20.000e+057.79natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npr13.388e-4157.36natriuretic peptide receptor 1 [Source:MGI Symbol;... [more]
Npr21.150e-3656.62natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr20.000e+056.62natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr26.183e-15754.64natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Gucy2g3.280e-13744.64guanylate cyclase 2g [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18910|ANPRA_RAT8.511e-4257.54Atrial natriuretic peptide receptor 1 OS=Rattus no... [more]
sp|P18293|ANPRA_MOUSE2.370e-4057.36Atrial natriuretic peptide receptor 1 OS=Mus muscu... [more]
sp|P16066|ANPRA_HUMAN1.698e-4456.19Atrial natriuretic peptide receptor 1 OS=Homo sapi... [more]
sp|Q6VVW5|ANPRB_MOUSE8.042e-3656.62Atrial natriuretic peptide receptor 2 OS=Mus muscu... [more]
sp|P16067|ANPRB_RAT2.018e-3556.73Atrial natriuretic peptide receptor 2 OS=Rattus no... [more]
back to top
BLAST of Guanylate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V6510.000e+048.05Guanylate cyclase OS=Schistosoma mansoni OX=6183 G... [more]
A0A1I8JDN40.000e+045.19Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
A0A1I8HCY10.000e+044.32Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
A0A1I8GAT20.000e+042.78Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
A0A267FJR90.000e+049.05Guanylate cyclase OS=Macrostomum lignano OX=282301... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr1b6.725e-3458.70atrial natriuretic peptide receptor 1-like [Source... [more]
npr1b6.725e-3458.70atrial natriuretic peptide receptor 1-like [Source... [more]
npr1a9.116e-2255.56natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1b8.557e-3455.56atrial natriuretic peptide receptor 1-like [Source... [more]
npr1b7.103e-3455.56atrial natriuretic peptide receptor 1-like [Source... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006352.11.106e-3658.46pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
NPR10.000e+056.16natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000008976.11.161e-14437.22pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-... [more]
ENSPMAT00000008942.14.558e-13846.58pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 ... [more]
ENSPMAT00000008986.12.496e-13747.96pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN23.806e-1227.54Serine/threonine protein kinase involved in regula... [more]
KIN11.392e-1127.38Serine/threonine protein kinase involved in regula... [more]
SPS11.107e-1025.28Putative protein serine/threonine kinase; localize... [more]
STE115.521e-1025.47Signal transducing MEK kinase; involved in pheromo... [more]
CDC57.129e-931.45Polo-like kinase; controls targeting and activatio... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342751.442e-17752.11Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309855.129e-17352.00Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362035.753e-13346.17Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361826.447e-13144.91Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362048.543e-13146.33Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr23.770e-2058.85natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
npr21.224e-2958.85natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
olgc71.469e-3757.33membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc76.329e-1757.33membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc28.649e-3556.56membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Guanylate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019264.10.000e+099.74SMESG000019264.1[more]
SMESG000056411.10.000e+048.35SMESG000056411.1[more]
SMESG000010241.10.000e+049.11SMESG000010241.1[more]
SMESG000010241.10.000e+049.11SMESG000010241.1[more]
SMESG000068881.10.000e+048.90SMESG000068881.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008651 ID=SMED30008651|Name=Guanylate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=3660bp
GTATTAATATGAAGTTTTAAAAAAAAACGAAGTTTCAAATCGATCAATGT
GTACAAGAAATCATTTCGGAGGCTGGTTAATTTTCATTTTATTAATTTCC
GAGTCGAATTCAAGTGACAATAATGATGGAAATGGAATAACTTTATTGGC
TGGAATGGGCAGTTATAAATGTGGGAAAAAATTGTCTCCTCGAGAATTTC
GAATTGCCGTTCTCATGACAAATTCGAATCTGGAAAAAAACAATGGAAAT
AATATGATTGTGGAAAATTCAAAAAAATTAGGACCAATAACTGATTTGGC
ATTAGCTAGAATTGAAAAATTGAAAAAGAAAGGAGAATTACAAGGTTTTG
CCAACTATTCCCTTAAATTATTCTTCAGTGAAAGCAGTACAGTGAGTGAA
CATCAAAATATAATGAAGAGATTTTTTTATTTCATTCTTGATGAACCGGT
TCATGCATTCATTGGTCCTAATAGTATTATTTCACTTGGAACTATCGCGC
GTATGTCCGGTACAAGATTCAATAGATCACTTGTAAGTCTTGGTGAAGCT
GGATATCAATTTGAGTTCAAAGATAAAGTTCAATATCAAGGACTTACAAG
AATTGCTGGGAACCATGAATCTTTGACCAATTTTATGGGTAAACTATTAA
AGTTCTATAAATGGCTACCAAGACCGCATAAAAATATTGGAGTTTTCTAC
ATAGATGATAAATCGTACAGTGATTATTTTTACTCGGCTAAAGAAATGAT
GGAAAGATTAAAAAATTATAAAACCGAAGGATATAAAGCTGATGCAAGTA
GTTTGAAAGAAATTAGAGAAAAATTAAAGTTACTATCTTCAATGTCCCGA
GTGATTATTATTTGCGGAGCAAGCAAATATACGAGATTGATAATGCTAGC
AGCGGTAGAAATCAAATTAGATTTATCAGAATTCGTTTTTATTCATATAG
ATCTGTTTACAGGACTTAATCCTCGTCCTTGGTTTGATCAGAAGAGTTCA
GATGAAGTCAACGAAAGTGTCCGTAACGCATTTAGGTCAATGCTAATTGT
CAAGCTTCCTTTAAATAGTGAATATTGGAACAGTTCAATTGGAAATGATT
TAAGAAAAATTGCTCGTGAAAAATATAATTTTTCTTATCCAAAAGAAGAG
CTGAATTACGTAACTACTTCGTTCTATGAATCCATTATGCTATATGCTCT
AGCACTAAATGATCTTTACGCCAAAAATGATACTCTGGATCGAATTACAA
ATTATATGTGGAATAGGACATTTAATGGCTTTATGACACCAGTAAAAATA
GATGCGGAAGGAAATCGAGTCTCGGATTTTTCATTATTTGACTTAGACCC
AAAATCTGGGAATTTTCAACAAGTTGGATTTTACAATGGCTCGACTGAAA
CCTACAGTCTCATTGAAGGGAAGTCCATTGAATGGGGAAACGAAAAAAAT
GAGCCCCCATTAGATACGCCAAAATGTGCATTTGATGGATCTCTTTGTAA
AAAAGATGGTACCAGTACTGGTCTTATTTTCGGATGTACGACGGCAGCCC
TGTTTGTGATCGGGGTGATCGGAGGATTTTTCGCTTACAGACGGCTGAAA
TTTCAAGCCGAACTCAAAGCCATGAACTGGATAATTCCTTGGGAATCGCT
TGATACGGTTGAAAAACGAAAGCATCGGCAATCTCAAATATCAAGGAAAG
ACTCAACTGTCAATGAAACACTAATAAATGGTGATAAGAAATTGGATAAG
AAAGATCAAAAGAAAAAGAAATCCGGAAATTATCAAGGTTCAAAAGAAAA
AATAGAGATGGAAACTACTCTATTGCTTAATTCACCGAATTCTGATTCTG
ATATTGATCCCATGGTAGCAATACGAAATGGAAAACATCGAGGAAGTGCT
TCAAATGAAAGTTATATGTCGTTGGTTACTATTTCCGGTGTTCAGTTAGA
AAACATTCAAAATACCCAAGTTTTCATCAAAACTGCATTGTTTAAAGGCA
ATATTGTGGCATTGAAAAAAATTAATACTGGTAGGAAATTTGAAACAACA
AAGGAAATGCTTTTAGATATTAAAAAGATAAAAGATTTAAACAATGATCA
TATTTGTCGGTTTATTGGAATGTGTGTTGAACCTCTTCACCAATATCTTG
TGTATGAATACTGTCCGAAAGGGAGCTTGGAAGATCTTTTAGAAAATGAA
CAGATAAATTTGGATTGGATGTTTCGTCTTTCACTGATTCAGGATATTGT
TCGGGGAATGATATATTTGCATTCAAATTATGGATGTCATGGTCACTTAA
AAAGTTCAAACTGTGTCGTTGACTCTAGATTTGTTTTAAAATTAACAGAC
TTTGGACTGAACATTTTACGAGAAATACAAAAAGAAAACTCTAACGAAGA
ACCTTCTCATGAATATTATAAAAAAATGTTATGGACAAGTCCAGAAATTT
TACGAACTCAAACTCTTCCTTTCATTGGCACTGTCAAAGGTGATGTTTAT
AGTTTTGCAATAATAGCTCAAGAAATAATTTATCGGCGCGGAGTATTTGC
GGTTGATAACTGTGATTCCAAAGATCCGAAAGAAATTGTCGAATCTGTAA
AGTCTTCTAAACATGTTCCTTTCCGACCAAGTTTGGATGAAATAGATGGT
TGCTCTTCAGATTTGATCAAGATAATTAAACAAGCCTGGGATGAAGATCC
AAATAATAGACCAGACTTTCCCGGGATTAAAAATTCAATGAGGAAAATAG
ACAAAGGAAAAGAATCAGGAAATATATTAGATAATTTACTTTCGCGTATG
GAACAATACGCAAACAATCTCGAAGGTTTAGTTGCTCAACGAACTCAGGA
ATATTTAGAAGAAAAGAAGAGAGCTGAAGACTTATTGTATTCAATGTTGC
CAAAATCAGTTGCTCACCAATTAATCAAAAATCAAAGCGTTTCGGCGGAA
AGTTACGAGCAGGTCACGATTTATTTCAGTGACATTGTCGGATTTACATC
TTTGTCAGCCGATTCGACACCTATGCAGGTTATTGAACTGCTAAATCGCC
TTTATACGACATTTGACAGTATAATTGAAAATTTCGATGTGTATAAGGTT
GAAACCATAGGAGATGCTTATATGGTTGTGTCAGGTCTTCCAAACGTGAA
CGGTAGGAATCATGCCCGGGAAATCGCTAGAATGTGTTTGCAGTTCCTGT
CGGCGATATTTCGTTTCGTGATTCCTCATCGGCCAAATACGCAGCTGGAG
TTGCGAATTGGAGTCCATTCAGGTCCAGTTTGTGCGGGTGTTGTCGGGCA
TAAAATGCCAAGATATTGCTTATTCGGAGATACAGTCAACACTTCCAGTA
GAATGGAGAGCAACGGTTTACCATTGAAAATCCACATCAGCCATTCCACA
ATGGAAGTGTTGAAGTCATTTCAGACCTTTATCATGAGTGAGCGTGGAGA
AGTCGAAATGAAAGGCAAAGGAAAGCAACTGACATATTGGCTTCATGGAG
AAAATGATTTCATAGTCGATCCAGTACCGGAAAGTGCCAAAATAATTCAA
TGTGAATAAAAAATGATAATTATAAAAATCGTACAATAAACTATATCAAG
ATTTCCACTGTGATATATTTTTTTAAGTTGCTTTATTTAAAACAAATGGT
TAGAATTCTA
back to top

protein sequence of SMED30008651-orf-1

>SMED30008651-orf-1 ID=SMED30008651-orf-1|Name=SMED30008651-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1171bp
MCTRNHFGGWLIFILLISESNSSDNNDGNGITLLAGMGSYKCGKKLSPRE
FRIAVLMTNSNLEKNNGNNMIVENSKKLGPITDLALARIEKLKKKGELQG
FANYSLKLFFSESSTVSEHQNIMKRFFYFILDEPVHAFIGPNSIISLGTI
ARMSGTRFNRSLVSLGEAGYQFEFKDKVQYQGLTRIAGNHESLTNFMGKL
LKFYKWLPRPHKNIGVFYIDDKSYSDYFYSAKEMMERLKNYKTEGYKADA
SSLKEIREKLKLLSSMSRVIIICGASKYTRLIMLAAVEIKLDLSEFVFIH
IDLFTGLNPRPWFDQKSSDEVNESVRNAFRSMLIVKLPLNSEYWNSSIGN
DLRKIAREKYNFSYPKEELNYVTTSFYESIMLYALALNDLYAKNDTLDRI
TNYMWNRTFNGFMTPVKIDAEGNRVSDFSLFDLDPKSGNFQQVGFYNGST
ETYSLIEGKSIEWGNEKNEPPLDTPKCAFDGSLCKKDGTSTGLIFGCTTA
ALFVIGVIGGFFAYRRLKFQAELKAMNWIIPWESLDTVEKRKHRQSQISR
KDSTVNETLINGDKKLDKKDQKKKKSGNYQGSKEKIEMETTLLLNSPNSD
SDIDPMVAIRNGKHRGSASNESYMSLVTISGVQLENIQNTQVFIKTALFK
GNIVALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQY
LVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGH
LKSSNCVVDSRFVLKLTDFGLNILREIQKENSNEEPSHEYYKKMLWTSPE
ILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVES
VKSSKHVPFRPSLDEIDGCSSDLIKIIKQAWDEDPNNRPDFPGIKNSMRK
IDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSM
LPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLN
RLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQF
LSAIFRFVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTS
SRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLH
GENDFIVDPVPESAKIIQCE*
back to top
Aliases
The feature 'Guanylate cyclase' has the following synonyms
Synonym
gucy-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0016849phosphorus-oxygen lyase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004383guanylate cyclase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
GO:0009190cyclic nucleotide biosynthetic process
GO:0006468protein phosphorylation
GO:0006182cGMP biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR001170ANPR/GUC
IPR001054A/G_cyclase
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR001828ANF_lig-bd_rcpt
IPR018297A/G_cyclase_CS
IPR000719Prot_kinase_dom
IPR029787Nucleotide_cyclase
IPR028082Peripla_BP_I
IPR011009Kinase-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005622intracellular
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 911..931
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 640..937
e-value: 3.7E-58
score: 198.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 76..428
e-value: 3.1E-77
score: 262.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 192..479
e-value: 3.1E-77
score: 262.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 559..581
NoneNo IPR availablePANTHERPTHR11920:SF470GUANYLATE CYCLASEcoord: 136..581
coord: 622..1139
NoneNo IPR availablePANTHERPTHR11920ADENYLATE AND GUANYLATE CYCLASEScoord: 136..581
NoneNo IPR availablePANTHERPTHR11920ADENYLATE AND GUANYLATE CYCLASEScoord: 622..1139
NoneNo IPR availableCDDcd07302CHDcoord: 972..1139
e-value: 8.00019E-63
score: 209.358
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.742
NoneNo IPR availableTMHMMTMhelixcoord: 492..514
IPR001170Adenylyl cyclase class-4/guanylyl cyclasePRINTSPR00255NATPEPTIDERcoord: 376..394
score: 36.51
coord: 268..286
score: 43.75
coord: 494..516
score: 24.18
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclaseSMARTSM00044cyc_6coord: 938..1132
e-value: 1.7E-96
score: 336.5
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 966..1139
e-value: 4.0E-61
score: 205.8
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 974..1104
score: 49.395
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 652..896
e-value: 1.3E-37
score: 129.5
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 959..1139
e-value: 3.1E-74
score: 250.6
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 960..1139
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 123..436
e-value: 4.2E-24
score: 85.3
IPR018297Adenylyl cyclase class-4/guanylyl cyclase, conserved sitePROSITEPS00452GUANYLATE_CYCLASE_1coord: 1081..1104
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 609..901
score: 25.927
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 642..902
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 115..479