Beta-hexosaminidase
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30008650 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 6
Homology
BLAST of Beta-hexosaminidase vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878]) HSP 1 Score: 46.595 bits (109), Expect = 6.304e-7 Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQI-ENVELLLVLFIHKQRKFTQGKVSFYGRG 188 +FPD ++H+G DEV CW ++P I+DFM+K E+ + L +I VS YG+G Sbjct: 311 VFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDI----VSSYGKG 369
BLAST of Beta-hexosaminidase vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878]) HSP 1 Score: 46.595 bits (109), Expect = 6.574e-7 Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQI-ENVELLLVLFIHKQRKFTQGKVSFYGRG 188 +FPD ++H+G DEV CW ++P I+DFM+K E+ + L +I VS YG+G Sbjct: 311 VFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDI----VSSYGKG 369
BLAST of Beta-hexosaminidase vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878]) HSP 1 Score: 46.595 bits (109), Expect = 6.846e-7 Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQI-ENVELLLVLFIHKQRKFTQGKVSFYGRG 188 +FPD ++H+G DEV CW ++P I+DFM+K E+ + L +I VS YG+G Sbjct: 322 VFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDI----VSSYGKG 380
BLAST of Beta-hexosaminidase vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878]) HSP 1 Score: 45.4394 bits (106), Expect = 1.626e-6 Identity = 16/31 (51.61%), Postives = 24/31 (77.42%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKK 95 +FPD ++H+G DEV CW ++P I+DFM+K Sbjct: 269 VFPDFYLHLGGDEVDFTCWKSNPEIQDFMRK 299
BLAST of Beta-hexosaminidase vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878]) HSP 1 Score: 45.4394 bits (106), Expect = 1.662e-6 Identity = 16/31 (51.61%), Postives = 24/31 (77.42%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKK 95 +FPD ++H+G DEV CW ++P I+DFM+K Sbjct: 311 VFPDFYLHLGGDEVDFTCWKSNPEIQDFMRK 341
BLAST of Beta-hexosaminidase vs. Ensembl Zebrafish
Match: hexa (hexosaminidase A (alpha polypeptide) [Source:ZFIN;Acc:ZDB-GENE-050417-283]) HSP 1 Score: 43.8986 bits (102), Expect = 3.667e-6 Identity = 15/31 (48.39%), Postives = 23/31 (74.19%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKK 95 +FPD++VH+G DEV CW ++P + FM+K Sbjct: 316 VFPDSYVHLGGDEVSFACWQSNPSVGKFMEK 346
BLAST of Beta-hexosaminidase vs. Ensembl Zebrafish
Match: hexa (hexosaminidase A (alpha polypeptide) [Source:ZFIN;Acc:ZDB-GENE-050417-283]) HSP 1 Score: 43.5134 bits (101), Expect = 5.113e-6 Identity = 15/31 (48.39%), Postives = 23/31 (74.19%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKK 95 +FPD++VH+G DEV CW ++P + FM+K Sbjct: 316 VFPDSYVHLGGDEVSFACWYSNPSVGKFMEK 346
BLAST of Beta-hexosaminidase vs. Ensembl Mouse
Match: Hexa (hexosaminidase A [Source:MGI Symbol;Acc:MGI:96073]) HSP 1 Score: 44.669 bits (104), Expect = 2.522e-6 Identity = 18/46 (39.13%), Postives = 28/46 (60.87%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIH 140 +FPD ++H+G DEV CW ++P I+ FMKK + + L +I Sbjct: 311 VFPDFYLHLGGDEVDFTCWKSNPNIQAFMKKKGFTDFKQLESFYIQ 356
BLAST of Beta-hexosaminidase vs. Ensembl Mouse
Match: Hexb (hexosaminidase B [Source:MGI Symbol;Acc:MGI:96074]) HSP 1 Score: 43.8986 bits (102), Expect = 3.882e-6 Identity = 16/31 (51.61%), Postives = 23/31 (74.19%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKK 95 +FPD +H+G DEV CWA++P I+ FMK+ Sbjct: 322 VFPDQFIHLGGDEVEFQCWASNPNIQGFMKR 352
BLAST of Beta-hexosaminidase vs. UniProt/SwissProt
Match: sp|P06865|HEXA_HUMAN (Beta-hexosaminidase subunit alpha OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=2) HSP 1 Score: 46.595 bits (109), Expect = 3.157e-6 Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQI-ENVELLLVLFIHKQRKFTQGKVSFYGRG 188 +FPD ++H+G DEV CW ++P I+DFM+K E+ + L +I VS YG+G Sbjct: 311 VFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDI----VSSYGKG 369
BLAST of Beta-hexosaminidase vs. UniProt/SwissProt
Match: sp|Q6AXR4|HEXB_RAT (Beta-hexosaminidase subunit beta OS=Rattus norvegicus OX=10116 GN=Hexb PE=2 SV=1) HSP 1 Score: 46.595 bits (109), Expect = 3.485e-6 Identity = 18/36 (50.00%), Postives = 25/36 (69.44%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIEN 110 +FPD +H+G DEV CWA++P I++FMKK N Sbjct: 321 VFPDQFIHLGGDEVEFECWASNPNIQNFMKKKGFGN 356
BLAST of Beta-hexosaminidase vs. TrEMBL
Match: A0A2T0SM07 (Hexosaminidase OS=Spirosoma oryzae OX=1469603 GN=CLV58_11756 PE=4 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 2.415e-8 Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHKQRKFTQGK 167 LFP +VHIG DEV K W+ P ++ MK+ I+NVE L F+H+ +F Q K Sbjct: 333 LFPSPYVHIGADEVEKSTWSQTPACQELMKREGIKNVEELQSYFVHRMERFVQSK 387
BLAST of Beta-hexosaminidase vs. TrEMBL
Match: A0A1Q3WDA9 (Beta-hexosaminidase OS=Spirosoma sp. 48-14 OX=1895854 GN=BGO59_15525 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 7.490e-8 Identity = 26/55 (47.27%), Postives = 32/55 (58.18%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHKQRKFTQGK 167 LFP +VHIG DEV K WA ++ MK+ I NVE L F+H+ KF Q K Sbjct: 332 LFPSEYVHIGADEVEKSTWAQSQACQELMKREGIRNVEELQSYFVHRMEKFVQSK 386
BLAST of Beta-hexosaminidase vs. TrEMBL
Match: A0A514ZT12 (Family 20 glycosylhydrolase OS=Spirosoma sp. KCTC 42546 OX=2520506 GN=EXU85_03500 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 8.339e-8 Identity = 26/55 (47.27%), Postives = 33/55 (60.00%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHKQRKFTQGK 167 LFP +VHIG DEV K WA ++ MK+ I+NVE L F+H+ KF Q K Sbjct: 332 LFPSPYVHIGADEVEKSTWAQSAGCQELMKRENIKNVEELQSYFVHRIEKFVQSK 386
BLAST of Beta-hexosaminidase vs. TrEMBL
Match: A0A1S2VNP2 (Beta-hexosaminidase OS=Arsenicibacter rosenii OX=1750698 GN=BLX24_10575 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 1.085e-7 Identity = 25/55 (45.45%), Postives = 33/55 (60.00%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHKQRKFTQGK 167 LFP +VHIG DEV K WA P + MK+ ++NVE L F+H+ +F Q K Sbjct: 332 LFPSQYVHIGADEVEKSTWAQTPACLELMKRENLKNVEELQSYFVHRIEQFVQSK 386
BLAST of Beta-hexosaminidase vs. TrEMBL
Match: A0A2N1KRV2 (Beta-hexosaminidase OS=Siphonobacter sp. BAB-5404 OX=1864824 GN=BWI96_05085 PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 1.371e-7 Identity = 27/55 (49.09%), Postives = 33/55 (60.00%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHKQRKFTQGK 167 LFP +VH+G DEV K WA K+ MKK I+NVE L FIH+ +KF K Sbjct: 320 LFPSKYVHLGADEVEKTTWANSEACKELMKKEGIKNVEELQSYFIHRMQKFFTSK 374
BLAST of Beta-hexosaminidase vs. Ensembl Cavefish
Match: hexa (beta-hexosaminidase subunit alpha-like [Source:NCBI gene;Acc:103046771]) HSP 1 Score: 44.669 bits (104), Expect = 1.906e-6 Identity = 15/31 (48.39%), Postives = 23/31 (74.19%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKK 95 +FPD++VH+G DEV CW ++P ++ FM K Sbjct: 315 VFPDSYVHLGGDEVNFACWKSNPNVRAFMTK 345
BLAST of Beta-hexosaminidase vs. Ensembl Sea Lamprey
Match: hexa (hexosaminidase A (alpha polypeptide) [Source:ZFIN;Acc:ZDB-GENE-050417-283]) HSP 1 Score: 42.3578 bits (98), Expect = 2.152e-6 Identity = 15/30 (50.00%), Postives = 21/30 (70.00%), Query Frame = 3 Query: 6 FPDTHVHIGLDEVGKGCWATDPRIKDFMKK 95 FPD ++H+G DEV CW ++P I FM+K Sbjct: 291 FPDHYIHLGGDEVSFSCWQSNPDITSFMEK 320
BLAST of Beta-hexosaminidase vs. Ensembl Nematostella
Match: EDO49845 (Beta-hexosaminidase [Source:UniProtKB/TrEMBL;Acc:A7RET7]) HSP 1 Score: 45.4394 bits (106), Expect = 3.549e-7 Identity = 16/30 (53.33%), Postives = 23/30 (76.67%), Query Frame = 3 Query: 6 FPDTHVHIGLDEVGKGCWATDPRIKDFMKK 95 FPD ++H+G DEVG GCW ++P I +M+K Sbjct: 328 FPDQYIHLGGDEVGFGCWQSNPNITAWMEK 357
BLAST of Beta-hexosaminidase vs. Ensembl Nematostella
Match: EDO32721 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU89]) HSP 1 Score: 45.0542 bits (105), Expect = 4.141e-7 Identity = 16/30 (53.33%), Postives = 23/30 (76.67%), Query Frame = 3 Query: 6 FPDTHVHIGLDEVGKGCWATDPRIKDFMKK 95 FPD ++H+G DEVG GCW ++P I +M+K Sbjct: 571 FPDQYIHLGGDEVGFGCWQSNPNITAWMEK 600
BLAST of Beta-hexosaminidase vs. Ensembl Medaka
Match: hexa (beta-hexosaminidase subunit alpha [Source:NCBI gene;Acc:101172329]) HSP 1 Score: 43.8986 bits (102), Expect = 2.821e-6 Identity = 14/31 (45.16%), Postives = 24/31 (77.42%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKK 95 +FPD+++H+G DEV CW ++P ++ FM+K Sbjct: 321 VFPDSYIHLGGDEVDFSCWRSNPHVRAFMQK 351
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Match: SMESG000008181.1 (SMESG000008181.1) HSP 1 Score: 168.703 bits (426), Expect = 1.080e-50 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHKQRKFTQGKVSFYGRGTKTRSFHFRICDLQ 230 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHKQRKFTQGKVSFYGRGTKTRSFHFRICDLQ Sbjct: 379 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHKQRKFTQGKVSFYGRGTKTRSFHFRICDLQ 454
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Match: SMESG000008181.1 (SMESG000008181.1) HSP 1 Score: 105.916 bits (263), Expect = 4.299e-28 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHK 143 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHK Sbjct: 379 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHK 425
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Match: SMESG000008181.1 (SMESG000008181.1) HSP 1 Score: 105.531 bits (262), Expect = 4.519e-28 Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHK 143 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHK Sbjct: 379 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIENVELLLVLFIHK 425
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Match: SMESG000037355.1 (SMESG000037355.1) HSP 1 Score: 45.0542 bits (105), Expect = 8.080e-7 Identity = 18/36 (50.00%), Postives = 24/36 (66.67%), Query Frame = 3 Query: 3 LFPDTHVHIGLDEVGKGCWATDPRIKDFMKKNQIEN 110 +FPDT +H+G DEV CW ++PRI +F KN N Sbjct: 302 IFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPN 337 The following BLAST results are available for this feature:
BLAST of Beta-hexosaminidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 5
BLAST of Beta-hexosaminidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of Beta-hexosaminidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of Beta-hexosaminidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 2
BLAST of Beta-hexosaminidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of Beta-hexosaminidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 2
BLAST of Beta-hexosaminidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 2
BLAST of Beta-hexosaminidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of Beta-hexosaminidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 1
BLAST of Beta-hexosaminidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 1
BLAST of Beta-hexosaminidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of Beta-hexosaminidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 2
BLAST of Beta-hexosaminidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 1
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 4
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30008650 ID=SMED30008650|Name=Beta-hexosaminidase|organism=Schmidtea mediterranea sexual|type=transcript|length=260bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|