Endophilin-A3

Overview
NameEndophilin-A3
Smed IDSMED30008645
Length (bp)1534
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Endophilin-A3 (SMED30008645) t-SNE clustered cells

Violin plots show distribution of expression levels for Endophilin-A3 (SMED30008645) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Endophilin-A3 (SMED30008645) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Endophilin-A3 (SMED30008645) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008645

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30008645SMESG000043383.1 Contig1883GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30008645SMESG000043383.1 Contig1883GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30008645SMESG000043383.1 dd_Smed_v4_2835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Endophilin-A3 vs. Ensembl Human
Match: SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3 [Source:HGNC Symbol;Acc:HGNC:10832])

HSP 1 Score: 293.893 bits (751), Expect = 3.760e-95
Identity = 154/357 (43.14%), Postives = 229/357 (64.15%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA+QL +EK+  A+GT+L++++++ E+KID+   +  E+L+K TEYLQPNP+YRAKL  +N   KI G+      YPQ E  + +   KYGKEL + +TFG+ L+E  ES K MA++K SL+  +KQ F++P+  +Q+ D+KEI HH KK++GRRLDYD KK+   +  KI ++EV+ A EKFE+SK LA  +M NFL+++ E ++ LA FI+A ++YH ++ EIL+ L + +  +    S+      +   +K+ S   N  S +            +KT        Q  P CR LYDF+ E++ EL F EGD+I L  Q+D++W+EG  +   GFFPINYVEV
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTG-YPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKK---RVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTS----------VVKTTGSNIPMDQ--PCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEV 341          
BLAST of Endophilin-A3 vs. Ensembl Human
Match: SH3GL1 (SH3 domain containing GRB2 like 1, endophilin A2 [Source:HGNC Symbol;Acc:HGNC:10830])

HSP 1 Score: 280.796 bits (717), Expect = 9.999e-90
Identity = 144/371 (38.81%), Postives = 235/371 (63.34%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKA-----PASQRISSLKK---------CSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+QL++EKVG A+GT+L++D+ E EKK+D+      E+L +  EYLQPNP+ RAKLT +N   KI G+      YPQ E  + E   ++GKEL   + FG  L++  ES K +A++K SL+ ++KQNF++P+  + E D+KEI HH KK++GRRLD+D KK+ +    KI ++E++ A EKFE+SK +A  +M+N L+++ E ++ L+  + A+++YH +  +IL+ L   +  +  E S++      P  +    L +         C+ +   +++S   +S++ ++   ++     Q     P+C+ALYDF+ E++ EL F+EGDVI L  Q+D++W+EG  + + GFFP++YVEV
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPG-YPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQ---GKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQ-----PSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEV 362          
BLAST of Endophilin-A3 vs. Ensembl Human
Match: SH3GL3 (SH3 domain containing GRB2 like 3, endophilin A3 [Source:HGNC Symbol;Acc:HGNC:10832])

HSP 1 Score: 275.789 bits (704), Expect = 4.765e-88
Identity = 145/345 (42.03%), Postives = 218/345 (63.19%), Query Frame = 2
Query:  347 ANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            + QL +EK+  A+GT+L++++++ E+KID+   +  E+L+K TEYLQPNP+YRAKL  +N   KI G+      YPQ E  + +   KYGKEL + +TFG+ L+E  ES K MA++K SL+  +KQ F++P+  +Q+ D+KEI HH KK++GRRLDYD KK+   +  KI ++EV+ A EKFE+SK LA  +M NFL+++ E ++ LA FI+A ++YH ++ EIL+ L + +  +    S+      +   +K+ S   N  S +            +KT        Q  P CR LYDF+ E++ EL F EGD+I L  Q+D++W+EG  +   GFFPINYVEV
Sbjct:   21 SQQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTG-YPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKK---RVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTS----------VVKTTGSNIPMDQ--PCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEV 349          
BLAST of Endophilin-A3 vs. Ensembl Human
Match: SH3GL2 (SH3 domain containing GRB2 like 2, endophilin A1 [Source:HGNC Symbol;Acc:HGNC:10831])

HSP 1 Score: 270.011 bits (689), Expect = 9.856e-86
Identity = 138/357 (38.66%), Postives = 220/357 (61.62%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK-STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA Q ++EKVG A+GT+L++D+ E E+K+D+      E++ K  EYLQPNP+ RAKL+ +N   KI G+      YPQ E  ++E   K+G+EL     FG  L E  E+ ++++++K SL+ ++KQNF++P+  + + D++EI HH KK++GRRLD+D KK+ +    KI ++E++ A EKF++SK +A  +M N L+ + E ++ L+  ++A++EYH +  +IL+ +   + E+  + S++     +        +    S+      S      T   K    Q  Q  P CRALYDF+ E+E EL F EGD+I L  Q+D++W+EG  +   GFFPINYVE+
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPG-YPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQ---GKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSH-----TGTPKPSGVQMDQ--PCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEI 346          
BLAST of Endophilin-A3 vs. Ensembl Human
Match: SH3GL1 (SH3 domain containing GRB2 like 1, endophilin A2 [Source:HGNC Symbol;Acc:HGNC:10830])

HSP 1 Score: 228.024 bits (580), Expect = 5.012e-70
Identity = 125/370 (33.78%), Postives = 209/370 (56.49%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKA-----PASQRISSLKK---------CSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+QL++EKVG A+GT+L++D+ E EKK+D+      E+L +  EYLQPNP                                                G  L++  ES K +A++K SL+ ++KQNF++P+  + E D+KEI HH KK++GRRLD+D KK+ +    KI ++E++ A EKFE+SK +A  +M+N L+++ E ++ L+  + A+++YH +  +IL+ L   +  +  E S++      P  +    L +         C+ +   +++S   +S++ ++   ++     Q     P+C+ALYDF+ E++ EL F+EGDVI L  Q+D++W+EG  + + GFFP++YVEV
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNP------------------------------------------------GDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQ---GKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQ-----PSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEV 314          
BLAST of Endophilin-A3 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 279.256 bits (713), Expect = 1.828e-89
Identity = 146/379 (38.52%), Postives = 233/379 (61.48%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTT-FGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRI--SSLKKCSYSDNHSSNSETD---NSEQLVKLTIKTKHDTSQ-----------------STQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL+GL+KQ NKANQ ++E +GAA+ T+L++ + E EK +D   NL  +L+    EYLQPNP+ RAK+ T  A  K+ G T + + YPQ E  ++++  KYG++L   +  G  L + +E+++ MADIKY +ED +KQNF++P++ +Q  ++K++ HHR K++GRRLDYDCKKR + +     +DE+  AEEK E+SK LA  +M N L ++ E I+ L   I+A++++H +TA+ LE+L   +  + ++ + + P  + +  S L   S +    S + +D   NS     +  +     +Q                 S Q+ P CRAL+DF A+SE EL F EG +I+L+ Q+D++W+EG  N + G FP+ YV+V
Sbjct:    1 MSLSGLRKQFNKANQYLSETMGAAEPTKLDDVFNEMEKNVDTTYNLITDLVAGTNEYLQPNPATRAKMATQVALSKVRG-TTKTSPYPQTEGMLADVMQKYGQQLGDNSDLGKSLNDAAETYRQMADIKYQMEDNVKQNFLDPLTHLQNNELKDVNHHRTKLKGRRLDYDCKKRQQRR-----DDEMIQAEEKLEESKRLAEMSMFNVLSNDVEQISQLRALIEAQLDFHRQTAQCLENLQQQLGHRIKDAAAR-PREEHVPLSVLANESRTPRSRSPAPSDMSHNSTAAAAMPPQNGGGITQAPPSYQGPPPGGLPPPLSQQQKPQCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQV 372          
BLAST of Endophilin-A3 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 277.33 bits (708), Expect = 1.016e-88
Identity = 145/381 (38.06%), Postives = 232/381 (60.89%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTT-FGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRI-------------SSLKKCSYSD-NHSSNSETDNSEQ----------LVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL+GL+KQ NKANQ ++E +GAA+ T+L++ + E EK +D   NL  +L+    EYLQPNP+ RAK+ T  A  K+ G T + + YPQ E  ++++  KYG++L   +  G  L + +E+++ MADIKY +ED +KQNF++P++ +Q  ++K++ HHR K++GRRLDYDCKKR + +     +DE+  AEEK E+SK LA  +M N L ++ E I+ L   I+A++++H +TA+ LE+L   +  + ++ + + P  + +             SS +  + SD +H+S +      Q            +           S Q+ P CRAL+DF A+SE EL F EG +I+L+ Q+D++W+EG  N + G FP+ YV+V
Sbjct:    1 MSLSGLRKQFNKANQYLSETMGAAEPTKLDDVFNEMEKNVDTTYNLITDLVAGTNEYLQPNPATRAKMATQVALSKVRG-TTKTSPYPQTEGMLADVMQKYGQQLGDNSDLGKSLNDAAETYRQMADIKYQMEDNVKQNFLDPLTHLQNNELKDVNHHRTKLKGRRLDYDCKKRQQRR-----DDEMIQAEEKLEESKRLAEMSMFNVLSNDVEQISQLRALIEAQLDFHRQTAQCLENLQQQLGHRIKDAAAR-PREEHVPLSVLANESRTPRSSFRSPAPSDMSHNSTAAAAMPPQNGGGITQAPPSYQGPPPGGLPPPLSQQQKPQCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQV 374          
BLAST of Endophilin-A3 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 276.174 bits (705), Expect = 3.671e-88
Identity = 145/383 (37.86%), Postives = 232/383 (60.57%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTT-FGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRI--------SSLKKCSY-SDNHSSNSETDNSEQLVKLTIKTKHDTSQ-----------------STQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL+GL+KQ NKANQ ++E +GAA+ T+L++ + E EK +D   NL  +L+    EYLQPNP+ RAK+ T  A  K+ G T + + YPQ E  ++++  KYG++L   +  G  L + +E+++ MADIKY +ED +KQNF++P++ +Q  ++K++ HHR K++GRRLDYDCKKR + +     +DE+  AEEK E+SK LA  +M N L ++ E I+ L   I+A++++H +TA+ LE+L   +  + ++ + + P  + +        S   + S+ S   S  S    +    K+  +     +Q                 S Q+ P CRAL+DF A+SE EL F EG +I+L+ Q+D++W+EG  N + G FP+ YV+V
Sbjct:    1 MSLSGLRKQFNKANQYLSETMGAAEPTKLDDVFNEMEKNVDTTYNLITDLVAGTNEYLQPNPATRAKMATQVALSKVRG-TTKTSPYPQTEGMLADVMQKYGQQLGDNSDLGKSLNDAAETYRQMADIKYQMEDNVKQNFLDPLTHLQNNELKDVNHHRTKLKGRRLDYDCKKRQQRR-----DDEMIQAEEKLEESKRLAEMSMFNVLSNDVEQISQLRALIEAQLDFHRQTAQCLENLQQQLGHRIKDAAAR-PREEHVPLSVLANESRTPRSSFRSPAPSDMSHNSTAAAAFKMPPQNGGGITQAPPSYQGPPPGGLPPPLSQQQKPQCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQV 376          
BLAST of Endophilin-A3 vs. Ensembl Celegans
Match: F35A5.8 (pep chromosome:WBcel235:X:3800045:3802767:-1 gene:WBGene00001335.1 transcript:F35A5.8c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F35A5.8)

HSP 1 Score: 83.1889 bits (204), Expect = 3.661e-17
Identity = 77/356 (21.63%), Postives = 156/356 (43.82%), Query Frame = 2
Query:  338 LNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFH-KISGKTNQKALYPQPENQISEIFNKYGKELKSTT-FGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYD-CKKRNKEKGS----KISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKL--LQQVDDSWFEGEHNNRKGFFPINYVEV 1378
             ++A QL  E    A+ TEL+  +    ++ D  ++    LL+ I  YLQPNP+ R +         K  G   Q  L      Q+S    + G++   TT +GS L++ +++   +   +  L  Q   N + PI +  E DMK I   RK +  +RLD D CK R K+  +     ++E +V+ A+ +F+    +    +     +    +  L +F++A+M +++++ +++  L     E S   S +  ++  +++          ++         L+   + TK             + + D+ A    E+   + D++ +  L  +D  +   E   ++G  P++Y+E+
Sbjct:   16 FSRAKQLTEETFLKAERTELDSHFENLLQRADKTEDHTRRLLSAIEGYLQPNPTVRMEEVFYEKLELKKDGAIRQNNL-----EQLSTAMTEAGEQFGETTPYGSALLKVAQTENRLGQAERELCGQAATNTLLPIRRFLEGDMKTIQKERKVLNSKRLDLDACKSRLKKAKTVDLQTVAEADVRVAQAEFDKQSEITKLLLEGIQTAHNNQLKCLRDFVEAQMSFYAQSHQLMADLQR---ELSGTMSFRGSSAILVNNSGDPPNGRTMAAAIAAAKPSGLLPDDLGTKQ-----------AKVIMDYDAVLPQEISVTQNDILIVYRLPGMDAEYVMAEKGGKRGKLPVSYIEL 352          
BLAST of Endophilin-A3 vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 77.0258 bits (188), Expect = 3.958e-17
Identity = 31/59 (52.54%), Postives = 44/59 (74.58%), Query Frame = 2
Query: 1202 STQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            S Q+ P CRAL+DF A+SE EL F EG +I+L+ Q+D++W+EG  N + G FP+ YV+V
Sbjct:   39 SQQQKPQCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKTGLFPVTYVQV 97          
BLAST of Endophilin-A3 vs. Ensembl Fly
Match: EndoA (gene:FBgn0038659 transcript:FBtr0083699)

HSP 1 Score: 283.878 bits (725), Expect = 3.434e-91
Identity = 148/368 (40.22%), Postives = 221/368 (60.05%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK--STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTC----------RALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            M+  GLKKQ+NKANQ + EK+G A+GT+L+ D++E E+K D+   L +EL  K  E+LQPNP+ RAK+  +    K+SG+      YPQPE  ++E    YGK+L   ++ F   L+E  E+ K MAD+KYSL+D IKQNF+EP+  +Q  D+KE+MHHRKK+QGRRLD+DCK+R + K     +DE++ AE+KF +S  LA   M N L+++ EH++ L  F +A  ++HS+ A++L  L  ++ EK  E  ++ P ++ +         D        D +   +  +        +S  +              +ALYDF+ E+  EL F E D+I LL +VDD+WFEG  N R G+FP +YV+V
Sbjct:    1 MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQAKSNT-YPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAK-----DDEIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESR-PRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQV 361          
BLAST of Endophilin-A3 vs. Ensembl Fly
Match: EndoA (gene:FBgn0038659 transcript:FBtr0334522)

HSP 1 Score: 283.878 bits (725), Expect = 3.434e-91
Identity = 148/368 (40.22%), Postives = 221/368 (60.05%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK--STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTC----------RALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            M+  GLKKQ+NKANQ + EK+G A+GT+L+ D++E E+K D+   L +EL  K  E+LQPNP+ RAK+  +    K+SG+      YPQPE  ++E    YGK+L   ++ F   L+E  E+ K MAD+KYSL+D IKQNF+EP+  +Q  D+KE+MHHRKK+QGRRLD+DCK+R + K     +DE++ AE+KF +S  LA   M N L+++ EH++ L  F +A  ++HS+ A++L  L  ++ EK  E  ++ P ++ +         D        D +   +  +        +S  +              +ALYDF+ E+  EL F E D+I LL +VDD+WFEG  N R G+FP +YV+V
Sbjct:    1 MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQAKSNT-YPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAK-----DDEIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESR-PRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQV 361          
BLAST of Endophilin-A3 vs. Ensembl Fly
Match: EndoA (gene:FBgn0038659 transcript:FBtr0083698)

HSP 1 Score: 283.878 bits (725), Expect = 3.434e-91
Identity = 148/368 (40.22%), Postives = 221/368 (60.05%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK--STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTC----------RALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            M+  GLKKQ+NKANQ + EK+G A+GT+L+ D++E E+K D+   L +EL  K  E+LQPNP+ RAK+  +    K+SG+      YPQPE  ++E    YGK+L   ++ F   L+E  E+ K MAD+KYSL+D IKQNF+EP+  +Q  D+KE+MHHRKK+QGRRLD+DCK+R + K     +DE++ AE+KF +S  LA   M N L+++ EH++ L  F +A  ++HS+ A++L  L  ++ EK  E  ++ P ++ +         D        D +   +  +        +S  +              +ALYDF+ E+  EL F E D+I LL +VDD+WFEG  N R G+FP +YV+V
Sbjct:    1 MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQAKSNT-YPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAK-----DDEIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESR-PRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQV 361          
BLAST of Endophilin-A3 vs. Ensembl Fly
Match: EndoB (gene:FBgn0034433 transcript:FBtr0086559)

HSP 1 Score: 74.3294 bits (181), Expect = 4.766e-14
Identity = 84/368 (22.83%), Postives = 158/368 (42.93%), Query Frame = 2
Query:  338 LNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKAL--YPQPENQISEIFNKYGKELKSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYD-CKKRNKEK----GSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECS------NKAPASQ-RISSLKKC-SYSDNHSSNSETDNSEQLVKLTIKTKHDTSQ----STQRVPTCRAL--YDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            +++  QL  EK+G  + TE +  +    ++ D+ K   ++++      L PNP  R +      F KI  K+  K L         + E    +G++L    +G  L++  ++ + +   ++         F +P+ K  + +MK I   R  ++ +RLD D CK R K+     G + +E +++ A+ +F+    +    ++    S+  H+  L  FI+ ++ Y+ +  +++E L   +              N+A AS+  ISS        +NHS+N               T H  +Q    ST ++   R L  YD K  +E  L  NE   +     V++ +  G+    KG  P  +VE+
Sbjct:   21 ISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNPQNRVEDFI---FEKIE-KSKPKRLSNLEHLALDMIEAGGDFGQDLP---YGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQRELANLGGPTPYIPLDVNEASASKSNISSGAAARGPGNNHSANMAA------------TGHKPNQPMHVSTDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGLVPRAFVEM 369          
BLAST of Endophilin-A3 vs. Ensembl Fly
Match: EndoB (gene:FBgn0034433 transcript:FBtr0086558)

HSP 1 Score: 68.5514 bits (166), Expect = 3.685e-12
Identity = 82/380 (21.58%), Postives = 160/380 (42.11%), Query Frame = 2
Query:  338 LNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKAL--YPQPENQISEIFNKYGKELKSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYD-CKKRNKEKGSKI----------------SEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECS------NKAPASQ-RISSLKKC-SYSDNHSSNSETDNSEQLVKLTIKTKHDTSQ----STQRVPTCRALYDFKAESEAELQFNEGDVIKLLQ--QVDDSWFEGEHNNRKGFFPINYVEV 1378
            +++  QL  EK+G  + TE +  +    ++ D+ K   ++++      L PNP  R +      F KI  K+  K L         + E    +G++L    +G  L++  ++ + +   ++         F +P+ K  + +MK I   R  ++ +RLD D CK R K+  S +                +E +++ A+ +F+    +    ++    S+  H+  L  FI+ ++ Y+ +  +++E L   +              N+A AS+  ISS        +NHS+N               T H  +Q    ST ++   R L  + A+   EL  +  +VI + +   V++ +  G+    KG  P  +VE+
Sbjct:   21 ISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNPQNRVEDFI---FEKIE-KSKPKRLSNLEHLALDMIEAGGDFGQDLP---YGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQRELANLGGPTPYIPLDVNEASASKSNISSGAAARGPGNNHSANMAA------------TGHKPNQPMHVSTDQMQRARVLCSYDAKDHTELNLSANEVIFVTECSPVNEDYMYGKQGLLKGLVPRAFVEM 381          
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Match: sh3gl1a (SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4524])

HSP 1 Score: 287.73 bits (735), Expect = 6.904e-93
Identity = 150/359 (41.78%), Postives = 227/359 (63.23%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKAL-YPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRIS-SLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+QL++EKVG A+GT+L+ED+ + E+K D+      ++L K TEYLQPNP+ RA+LT  N   K+ G+   K+L YPQ E  + E   KYG+++ + T FG  L+E  E+ K +A++K SL+  +KQNF++P   I + D+K+I HH KK++GRRLDYD KK+ +    KI+++E++ A EKFE+S+  A  +M N LD++ E ++ L   +++++++H ++ ++LE L  ++ E+  +  ++ P  +R+  S     YSD   SN   + S         T  D        P CRALYDF+ E+E EL FNEGDVI L  Q+DD+W+EG    + G FP NYVEV
Sbjct:    1 MSVAGLKKQFYKASQLMSEKVGGAEGTKLDEDFKDLERKADITSKAISDVLCKTTEYLQPNPASRARLTMANTMSKMRGQV--KSLGYPQAEGLLGECMLKYGRDMGEDTNFGGALVEMGEAMKRLAEVKDSLDIDVKQNFIDPFQTIVDKDLKDIQHHLKKLEGRRLDYDYKKKRQ---GKIADEELRMAMEKFEESRDAAETSMQNLLDTDVEQVSQLCALVESQLQFHKQSMQVLEELAGAMRERVNKAQSQ-PRQKRMPVSRPSIDYSDPEDSNGGWNPSAAAPPSYSSTAADQ-------PCCRALYDFEPENEGELGFNEGDVITLTNQIDDNWYEGSFRGQTGLFPCNYVEV 346          
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Match: sh3gl1a (SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4524])

HSP 1 Score: 286.96 bits (733), Expect = 2.403e-92
Identity = 150/366 (40.98%), Postives = 231/366 (63.11%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKAL-YPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRIS-SLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQR-------VPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+QL++EKVG A+GT+L+ED+ + E+K D+      ++L K TEYLQPNP+ RA+LT  N   K+ G+   K+L YPQ E  + E   KYG+++ + T FG  L+E  E+ K +A++K SL+  +KQNF++P   I + D+K+I HH KK++GRRLDYD KK+ +    KI+++E++ A EKFE+S+  A  +M N LD++ E ++ L   +++++++H ++ ++LE L  ++ E+  +  ++ P  +R+  S     YSD   SN   + S         T    ++++ R        P CRALYDF+ E+E EL FNEGDVI L  Q+DD+W+EG    + G FP NYVEV
Sbjct:    1 MSVAGLKKQFYKASQLMSEKVGGAEGTKLDEDFKDLERKADITSKAISDVLCKTTEYLQPNPASRARLTMANTMSKMRGQV--KSLGYPQAEGLLGECMLKYGRDMGEDTNFGGALVEMGEAMKRLAEVKDSLDIDVKQNFIDPFQTIVDKDLKDIQHHLKKLEGRRLDYDYKKKRQ---GKIADEELRMAMEKFEESRDAAETSMQNLLDTDVEQVSQLCALVESQLQFHKQSMQVLEELAGAMRERVNKAQSQ-PRQKRMPVSRPSIDYSDPEDSNGGWNPSAAAPPSYSSTAPSFNRASSRQKRNSADQPCCRALYDFEPENEGELGFNEGDVITLTNQIDDNWYEGSFRGQTGLFPCNYVEV 360          
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Match: sh3gl1b (SH3-domain GRB2-like 1b [Source:ZFIN;Acc:ZDB-GENE-031001-6])

HSP 1 Score: 278.485 bits (711), Expect = 4.178e-89
Identity = 144/366 (39.34%), Postives = 231/366 (63.11%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKC-SYSD-NHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVP-------TCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+Q+++EKVG A+GT+L+E++ + E+K+D+      E+++K +EYLQPNP+ RAKL+ +N   KI G+      YPQ E  + E   KYG+EL + T FG  LME  ES K +A++K SL+  +KQNF++P+  + + D++EI HH KK++GRRLDYD KK+ +    KI ++E++ A EKF +SK +A  +M N L+++ E ++ L+  ++++++YH +  +IL+ L + + ++ ++   + P  + I   K    + + N  SN     S        ++ H   + T R P        C+ALYDF+ E+E EL F+EGD+I L  Q+D++W+EG    + GFFP+NYVEV
Sbjct:    1 MSVAGLKKQFYKASQMVSEKVGGAEGTKLDEEFKDLERKVDVTNKAVVEVISKTSEYLQPNPASRAKLSMLNTMSKIRGQVKSPG-YPQAEGLLGECMGKYGRELGEETNFGGALMEVGESMKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYDYKKKRQ---GKIPDEELRQALEKFHESKEVAEISMYNLLETDIEQVSQLSSLVESQLQYHRQAVQILDELSDKLRDRMKDAQTR-PRKEYIPKPKPVIDFGETNEQSNGGYTPSSAPPMRNAESYHQFGRITTRKPRLPAEQACCKALYDFEPENEGELGFHEGDIITLTNQIDENWYEGMLRGQSGFFPLNYVEV 361          
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Match: sh3gl2a (SH3 domain containing GRB2 like 2a, endophilin A1 [Source:ZFIN;Acc:ZDB-GENE-040121-3])

HSP 1 Score: 275.789 bits (704), Expect = 2.867e-88
Identity = 142/357 (39.78%), Postives = 224/357 (62.75%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA Q ++EKVG A+GT+L+ D+ E EKK+D       ++L K TEYLQPNP+ RAK++ M++  KI G  ++   Y Q E  + E   K G+EL + + FG  L++  E+ +++ ++K +L+ ++KQNF++P+  I + D+KEI HH KK++GRRLD+D KK+ +    K++EDE+K A EKF+DSK +A ++M N L+++ E ++ L+  ++A++ YH + AEIL+ L + I ++  E S K              +S+NH+ +       +            S +    P CRALYDF  E+E EL F EGD+I L  ++DD+W+EG  N + GFFP+NYV++
Sbjct:    1 MSVAGLKKQFHKATQRVSEKVGGAEGTKLDVDFTEMEKKVDTTSRAVLDILTKTTEYLQPNPATRAKMSMMSSMSKIRG-GDKGPGYTQTETTLGEAMQKAGRELGEESCFGVALIDVGEAMRELGEVKDALDMEVKQNFIDPLQNIHDKDLKEIQHHLKKLEGRRLDFDYKKKRQ---GKVTEDEIKQALEKFDDSKEIAEQSMFNLLENDIEQVSQLSALVQAQVNYHRQAAEILQQLSSKIEDRIREASCKPKREYVPKPRTSLDFSENHNGSIGHSGPSR------------SPAPMDQPCCRALYDFDPENEGELGFKEGDIITLTSKIDDNWYEGMVNGQSGFFPVNYVDI 341          
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Match: sh3gl1b (SH3-domain GRB2-like 1b [Source:ZFIN;Acc:ZDB-GENE-031001-6])

HSP 1 Score: 275.018 bits (702), Expect = 6.257e-88
Identity = 139/357 (38.94%), Postives = 227/357 (63.59%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+Q+++EKVG A+GT+L+E++ + E+K+D+      E+++K +EYLQPNP+ RAKL+ +N   KI G+      YPQ E  + E   KYG+EL + T FG  LME  ES K +A++K SL+  +KQNF++P+  + + D++EI HH KK++GRRLDYD KK+ +    KI ++E++ A EKF +SK +A  +M N L+++ E ++ L+  ++++++YH +  +IL+ L + + ++ ++   + P  + I   K     D   +N +++        T  +      +      C+ALYDF+ E+E EL F+EGD+I L  Q+D++W+EG    + GFFP+NYVEV
Sbjct:    1 MSVAGLKKQFYKASQMVSEKVGGAEGTKLDEEFKDLERKVDVTNKAVVEVISKTSEYLQPNPASRAKLSMLNTMSKIRGQVKSPG-YPQAEGLLGECMGKYGRELGEETNFGGALMEVGESMKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYDYKKKRQ---GKIPDEELRQALEKFHESKEVAEISMYNLLETDIEQVSQLSSLVESQLQYHRQAVQILDELSDKLRDRMKDAQTR-PRKEYIPKPKPV--IDFGETNEQSNGG-----YTPSSAPPMRNAAAEQACCKALYDFEPENEGELGFHEGDIITLTNQIDENWYEGMLRGQSGFFPLNYVEV 345          
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Match: gipc2 (GIPC PDZ domain containing family member 2 [Source:Xenbase;Acc:XB-GENE-946803])

HSP 1 Score: 296.975 bits (759), Expect = 3.009e-96
Identity = 154/358 (43.02%), Postives = 231/358 (64.53%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPAS-QRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA+QL +EK+  A+GT+L++D+ E E+KID+   +  ELL+K TEYLQPNP+YRA+L  +N   KI G+      YPQ E  + +   ++G+EL   + FG  L++  E  K MA++K SL+  +KQNF++P+  +Q+ D+KEI++H K+++GRRLDYD KKR +    KI ++E++ A EKFE+SK LA  +M NFL+++ E ++ L+ F++A ++YH ++A+ILE L+N +  +    S++     Q  S +     ++    N    NS      +IK    +    Q  P CRALYDF+ E+E EL F EGD+I L  Q+D++WFEG  N   GFFPINYVEV
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDDDFQEMERKIDITNKVVAELLSKTTEYLQPNPAYRARLGMLNTMSKIRGQVKTTG-YPQTEGLLGDCMLRHGRELGDESEFGCALLDAGECMKQMAEVKDSLDINVKQNFIDPLQSLQDKDLKEILYHLKRLEGRRLDYDYKKRRQ---GKIPDEEIRQAVEKFEESKELAERSMFNFLENDIEQVSQLSVFVEAALDYHRQSAQILEDLHNRLHNRMNTASSRPKRELQHKSIIATLESNEKLHHNGIPSNS------SIKPSGSSGNLDQ--PCCRALYDFEPENEGELGFKEGDIITLTNQIDENWFEGMVNGESGFFPINYVEV 346          
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Match: sh3gl1 (SH3-domain GRB2-like 1 [Source:NCBI gene;Acc:619364])

HSP 1 Score: 278.485 bits (711), Expect = 3.478e-89
Identity = 142/357 (39.78%), Postives = 223/357 (62.46%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+QL++EKVG A+GT+L++++ E EKK+D+      ++L K  EYLQPNP+ RAKL+ +N   KI G+      YPQPE  + E   K+GK+L   + FG  L++  ES K +A++K SL+ ++KQNF++P+  + + D+KEI HH KK++GRRLDYD KK+ +    KI ++E++ A EKF +SK +A  +M N LD++ E ++ L   ++A+++YH +  +IL+ L   + ++  E S++     +    +   Y+++  SN    N       + K      Q     P C+ALYDF  E++ EL F E D+I L  Q+D++W+EG  N + GFFP+NYVE+
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDEFKEMEKKVDVTTKAVTDVLAKTIEYLQPNPASRAKLSMLNTMSKIRGQVKNPG-YPQPEGVLGETMIKFGKDLGDESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFLDPLQNLCDKDLKEIQHHLKKLEGRRLDYDYKKKRQ---GKIPDEELRQAMEKFIESKEVAETSMINLLDTDVEQVSQLTALVEAQLDYHRQAVQILDELSEKLKDRVRESSSRTKREFKPKPRESYEYAESEQSNGGFSNP------SSKAPAPLDQ-----PCCKALYDFDPENDGELGFRESDIITLTNQIDENWYEGMINGQSGFFPVNYVEI 342          
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Match: gipc2 (GIPC PDZ domain containing family member 2 [Source:Xenbase;Acc:XB-GENE-946803])

HSP 1 Score: 278.485 bits (711), Expect = 3.968e-89
Identity = 145/344 (42.15%), Postives = 219/344 (63.66%), Query Frame = 2
Query:  353 QLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTT-FGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPAS-QRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            QL +EK+  A+GT+L++D+ E E+KID+   +  ELL+K TEYLQPNP+YRA+L  +N   KI G+      YPQ E  + +   ++G+EL   + FG  L++  E  K MA++K SL+  +KQNF++P+  +Q+ D+KEI++H K+++GRRLDYD KKR +    KI ++E++ A EKFE+SK LA  +M NFL+++ E ++ L+ F++A ++YH ++A+ILE L+N +  +    S++     Q  S +     ++    N    NS      +IK    +    Q  P CRALYDF+ E+E EL F EGD+I L  Q+D++WFEG  N   GFFPINYVEV
Sbjct:   20 QLFSEKISGAEGTKLDDDFQEMERKIDITNKVVAELLSKTTEYLQPNPAYRARLGMLNTMSKIRGQVKTTG-YPQTEGLLGDCMLRHGRELGDESEFGCALLDAGECMKQMAEVKDSLDINVKQNFIDPLQSLQDKDLKEILYHLKRLEGRRLDYDYKKRRQ---GKIPDEEIRQAVEKFEESKELAERSMFNFLENDIEQVSQLSVFVEAALDYHRQSAQILEDLHNRLHNRMNTASSRPKRELQHKSIIATLESNEKLHHNGIPSNS------SIKPSGSSGNLDQ--PCCRALYDFEPENEGELGFKEGDIITLTNQIDENWFEGMVNGESGFFPINYVEV 351          
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Match: sh3gl1 (SH3-domain GRB2-like 1 [Source:NCBI gene;Acc:619364])

HSP 1 Score: 277.715 bits (709), Expect = 1.454e-88
Identity = 141/364 (38.74%), Postives = 224/364 (61.54%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRV-------PTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+QL++EKVG A+GT+L++++ E EKK+D+      ++L K  EYLQPNP+ RAKL+ +N   KI G+      YPQPE  + E   K+GK+L   + FG  L++  ES K +A++K SL+ ++KQNF++P+  + + D+KEI HH KK++GRRLDYD KK+ +    KI ++E++ A EKF +SK +A  +M N LD++ E ++ L   ++A+++YH +  +IL+ L   + ++  E S++     +    +   Y+++  SN    N       +   + +    T          P C+ALYDF  E++ EL F E D+I L  Q+D++W+EG  N + GFFP+NYVE+
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDEFKEMEKKVDVTTKAVTDVLAKTIEYLQPNPASRAKLSMLNTMSKIRGQVKNPG-YPQPEGVLGETMIKFGKDLGDESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFLDPLQNLCDKDLKEIQHHLKKLEGRRLDYDYKKKRQ---GKIPDEELRQAMEKFIESKEVAETSMINLLDTDVEQVSQLTALVEAQLDYHRQAVQILDELSEKLKDRVRESSSRTKREFKPKPRESYEYAESEQSNGGFSNPSSKAPASSSFRSEKPARTNNRSSAPLDQPCCKALYDFDPENDGELGFRESDIITLTNQIDENWYEGMINGQSGFFPVNYVEI 360          
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Match: gipc2 (GIPC PDZ domain containing family member 2 [Source:Xenbase;Acc:XB-GENE-946803])

HSP 1 Score: 278.1 bits (710), Expect = 1.660e-88
Identity = 145/344 (42.15%), Postives = 219/344 (63.66%), Query Frame = 2
Query:  353 QLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTT-FGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPAS-QRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            QL +EK+  A+GT+L++D+ E E+KID+   +  ELL+K TEYLQPNP+YRA+L  +N   KI G+      YPQ E  + +   ++G+EL   + FG  L++  E  K MA++K SL+  +KQNF++P+  +Q+ D+KEI++H K+++GRRLDYD KKR +    KI ++E++ A EKFE+SK LA  +M NFL+++ E ++ L+ F++A ++YH ++A+ILE L+N +  +    S++     Q  S +     ++    N    NS      +IK    +    Q  P CRALYDF+ E+E EL F EGD+I L  Q+D++WFEG  N   GFFPINYVEV
Sbjct:   48 QLFSEKISGAEGTKLDDDFQEMERKIDITNKVVAELLSKTTEYLQPNPAYRARLGMLNTMSKIRGQVKTTG-YPQTEGLLGDCMLRHGRELGDESEFGCALLDAGECMKQMAEVKDSLDINVKQNFIDPLQSLQDKDLKEILYHLKRLEGRRLDYDYKKRRQ---GKIPDEEIRQAVEKFEESKELAERSMFNFLENDIEQVSQLSVFVEAALDYHRQSAQILEDLHNRLHNRMNTASSRPKRELQHKSIIATLESNEKLHHNGIPSNS------SIKPSGSSGNLDQ--PCCRALYDFEPENEGELGFKEGDIITLTNQIDENWFEGMVNGESGFFPINYVEV 379          
BLAST of Endophilin-A3 vs. Ensembl Mouse
Match: Sh3gl3 (SH3-domain GRB2-like 3 [Source:MGI Symbol;Acc:MGI:700011])

HSP 1 Score: 293.123 bits (749), Expect = 5.431e-95
Identity = 154/357 (43.14%), Postives = 228/357 (63.87%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA+QL +EK+  A+GT+L+E+++  EKKID+      E+L+K TEYLQPNP+YRAKL  +N   K+ G+      YPQ E  + +   KYGKEL + + FG+ L++  E+ K MA++K SL+  +KQ F++P+  +Q+ D+KEI HH +K++GRRLDYD KKR   +  KI E+E++ A EKFE+SK LA  +M NFL+++ E ++ LA F++A ++YH ++ EIL+ L  S +E     ++K P  + +      S +D +     + +         KT    + S Q  P CR LYDF+ E+E EL F EGD+I L  Q+D++W+EG      GFFPINYVEV
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLNMEKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKLRGQVKATG-YPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKR---RVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQEL-QSKLELRISLASKVPKREFMPKPVNMSSTDANGVGPSSSS---------KTPGTDTPSDQ--PCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEV 341          
BLAST of Endophilin-A3 vs. Ensembl Mouse
Match: Sh3gl1 (SH3-domain GRB2-like 1 [Source:MGI Symbol;Acc:MGI:700010])

HSP 1 Score: 279.256 bits (713), Expect = 2.836e-89
Identity = 142/371 (38.27%), Postives = 236/371 (63.61%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKA-----PASQRISSLKK---------CSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+QL++EKVG A+GT+L++D+ + EKK+D+      E+L +  EYLQPNP+ RAKLT +N   KI G+      YPQ E  + E   ++GKEL   + FG  L++  ES K +A++K SL+ ++KQNF++P+  + + D+KEI HH KK++GRRLD+D KK+ +    KI ++E++ A EKFE+SK +A  +M+N L+++ E ++ L+  + A+++YH +  +ILE L + +  +  E S++      P  +    L +         C+ +   +++S   +S++ +++  K+     Q     P+C+ALYDF+ E++ EL F EGD+I L  Q+D++W+EG  + + GFFP++YV+V
Sbjct:    1 MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKDMEKKVDVTSKAVAEVLVRTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPG-YPQSEGLLGECMVRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQ---GKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILEELADKLKRRVREASSRPKREFKPRPREPFELGELEQPNGGFPCAPAPKITASSSFRSSDKPIRMPSKSMPPLDQ-----PSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQV 362          
BLAST of Endophilin-A3 vs. Ensembl Mouse
Match: Sh3gl2 (SH3-domain GRB2-like 2 [Source:MGI Symbol;Acc:MGI:700009])

HSP 1 Score: 270.781 bits (691), Expect = 2.835e-86
Identity = 138/357 (38.66%), Postives = 222/357 (62.18%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK-STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA Q ++EKVG A+GT+L++D+ E E+K+D+      E++ K  EYLQPNP+ RAKL+ +N   KI G+      YPQ E  ++E   K+G+EL     FG  L E  E+ ++++++K SL+ ++KQNF++P+  + + D++EI HH KK++GRRLD+D KK+ +    KI ++E++ A EKF++SK +A  +M N L+ + E ++ L+  ++A++EYH +  +IL+ +   + E+  + S++     +        ++   S+      S      T   K    Q  Q  P CRALYDF+ E+E EL F EGD+I L  Q+D++W+EG  + + GFFPINYVE+
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPG-YPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQ---GKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDSTQPNGGLSH-----TGTPKPPGVQMDQ--PCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEI 346          
BLAST of Endophilin-A3 vs. Ensembl Mouse
Match: Sh3gl3 (SH3-domain GRB2-like 3 [Source:MGI Symbol;Acc:MGI:700011])

HSP 1 Score: 254.988 bits (650), Expect = 9.672e-81
Identity = 136/321 (42.37%), Postives = 199/321 (61.99%), Query Frame = 2
Query:  419 EKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            EKKID+      E+L+K TEYLQPNP+YRAKL  +N   K+ G+      YPQ E  + +   KYGKEL + + FG+ L++  E+ K MA++K SL+  +KQ F++P+  +Q+ D+KEI HH +K++GRRLDYD KKR   +  KI E+E++ A EKFE+SK LA  +M NFL+++ E ++ LA F++A ++YH ++ EIL+ L  S +E     ++K P  + +      S +D +     + +         KT    + S Q  P CR LYDF+ E+E EL F EGD+I L  Q+D++W+EG      GFFPINYVEV
Sbjct:    2 EKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKLRGQVKATG-YPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKR---RVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQEL-QSKLELRISLASKVPKREFMPKPVNMSSTDANGVGPSSSS---------KTPGTDTPSDQ--PCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEV 306          
BLAST of Endophilin-A3 vs. Ensembl Mouse
Match: Sh3gl2 (SH3-domain GRB2-like 2 [Source:MGI Symbol;Acc:MGI:700009])

HSP 1 Score: 238.039 bits (606), Expect = 1.088e-72
Identity = 126/337 (37.39%), Postives = 206/337 (61.13%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK-STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDS 1318
            MS+ GLKKQ +KA Q ++EKVG A+GT+L++D+ E E+K+D+      E++ K  EYLQPNP+ RAKL+ +N   KI G+      YPQ E  ++E   K+G+EL     FG  L E  E+ ++++++K SL+ ++KQNF++P+  + + D++EI HH KK++GRRLD+D KK+ +    KI ++E++ A EKF++SK +A  +M N L+ + E ++ L+  ++A++EYH +  +IL+ +   + E+  + S++     +        ++   S+      S      T   K    Q  Q  P CRALYDF+ E+E EL F EGD+I L  Q+D++
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPG-YPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQ---GKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFATGDSTQPNGGLSH-----TGTPKPPGVQMDQ--PCCRALYDFEPENEGELGFKEGDIITLTNQIDEN 326          
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Match: sp|O35180|SH3G3_RAT (Endophilin-A3 OS=Rattus norvegicus OX=10116 GN=Sh3gl3 PE=1 SV=2)

HSP 1 Score: 295.049 bits (754), Expect = 6.993e-95
Identity = 153/357 (42.86%), Postives = 231/357 (64.71%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA+QL +EK+  A+GT+L+E++++ EKKID+      E+L+K TEYLQPNP+YRAKL  +N   K+ G+      YPQ E  + +   KYG+EL + + FG+ L+E  E+ K MA++K SL+  +KQ F++P+  +Q+ D+KEI HH +K++GRRLDYD KK+   +  KI E+E++ A EKFE+SK LA  +M NFL+++ E ++ LA F++A ++YH ++ EIL+ L N  +E     +++ P  +R    K  + S  +++  E  +S +L    I +           P CR LYDF+ E+E EL F EGD+I L  Q+D++W+EG      GFFPINYVEV
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLDMEKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTMSKLRGQVKATG-YPQTEGLLGDCMLKYGRELGEDSAFGNSLVEVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKK---RVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQELQNK-LELRIALASQVP--RRDYMPKPVNTSSTNANGVEPSSSSKLTGTDIPSDQ---------PCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEV 341          
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Match: sp|Q99963|SH3G3_HUMAN (Endophilin-A3 OS=Homo sapiens OX=9606 GN=SH3GL3 PE=1 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 1.806e-94
Identity = 154/357 (43.14%), Postives = 229/357 (64.15%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA+QL +EK+  A+GT+L++++++ E+KID+   +  E+L+K TEYLQPNP+YRAKL  +N   KI G+      YPQ E  + +   KYGKEL + +TFG+ L+E  ES K MA++K SL+  +KQ F++P+  +Q+ D+KEI HH KK++GRRLDYD KK+   +  KI ++EV+ A EKFE+SK LA  +M NFL+++ E ++ LA FI+A ++YH ++ EIL+ L + +  +    S+      +   +K+ S   N  S +            +KT        Q  P CR LYDF+ E++ EL F EGD+I L  Q+D++W+EG  +   GFFPINYVEV
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTG-YPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKK---RVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTS----------VVKTTGSNIPMDQ--PCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEV 341          
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Match: sp|Q62421|SH3G3_MOUSE (Endophilin-A3 OS=Mus musculus OX=10090 GN=Sh3gl3 PE=1 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 9.808e-94
Identity = 153/357 (42.86%), Postives = 228/357 (63.87%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA+QL +EK+  A+GT+L+E+++  EKKID+      E+L+K TEYLQPNP+YRAKL  +N   K+ G+      YPQ E  + +   KYGKEL + + FG+ L++  E+ K MA++K SL+  +KQ F++P+  +Q+ D+KEI HH +K++GRRLDYD KKR   +  KI E+E++ A EKFE+SK LA  +M NFL+++ E ++ LA F++A ++YH ++ EIL+ L  S +E     ++K P  + +      S +D +     + +         KT    + + Q  P CR LYDF+ E+E EL F EGD+I L  Q+D++W+EG      GFFPINYVEV
Sbjct:    1 MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLNMEKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKLRGQVKATG-YPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKR---RVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQEL-QSKLELRISLASKVPKREFMPKPVNMSSTDANGVGPSSSS---------KTPGTDTPADQ--PCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEV 341          
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Match: sp|Q8I1C0|SH3G3_DROPS (Endophilin-A OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=EndoA PE=3 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 3.335e-92
Identity = 150/368 (40.76%), Postives = 223/368 (60.60%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK--STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHD----------TSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            M+  GLKKQ+NKANQ + EK+G A+GT+L+ D+++ E+K D+   L +EL  K  E+LQPNP+ RAK+  +    K+SG+      YPQPE  ++E    YGK+L   ++ F   L+E  ES K MAD+KYSL+D IKQNF+EP+  +Q  D+KE+MHHRKK+QGRRLD+DCK+R + K     +DE++ AE+KF +S  LA   M N L+++ EH++ L  F +A  ++HS+ A++L  L  ++ EK  E  ++ P ++ +         D        D +   +  +                 + S Q+ P C+ALYDF  E+  EL F E D+I LL +VDD+W+EG  N R G+FP +YV+V
Sbjct:    1 MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMDMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQAKSNT-YPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGESLKQMADVKYSLDDNIKQNFLEPLHHMQMKDLKEVMHHRKKLQGRRLDFDCKRRRQAK-----DDEIRGAEDKFAESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESR-PRNEFVPKTLLDLNLDGGGGGLIDDGTPSHISSSASPLPSPMRSPAKSMAVTPSRQQQPCCQALYDFDPENPGELGFKENDIITLLNRVDDNWYEGAVNGRTGYFPQSYVQV 361          
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Match: sp|Q8I190|SH3G3_DROVI (Endophilin-A OS=Drosophila virilis OX=7244 GN=EndoA PE=3 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 7.316e-92
Identity = 149/368 (40.49%), Postives = 223/368 (60.60%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK--STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQST----------QRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            M+  GLKKQ+NKANQ + EK+G A+GT+L+ D+++ E+K D+   L +EL  K  E+LQPNP+ RAK+  +    K+SG+      YPQPE  ++E    YGK+L   ++ F   L+E  E+ K MAD+KYSL+D IKQNF+EP+  +Q  D+KE+MHHRKK+QGRRLD+DCK+R + K     +DE++ AE+KF +S  LA   M N L+++ EH++ L  F +A  ++HS+ A++L  L  ++ EK  E  ++ P ++ +         D        D +   +  +        +S           Q+ P C+ALYDF  E+  EL F E D+I LL +VDD+W+EG  N R G+FP +YV+V
Sbjct:    1 MAFAGLKKQINKANQYVTEKMGGAEGTKLDLDFMDMERKTDVTVELVEELQLKTKEFLQPNPTARAKMAAVKGISKLSGQAKSNT-YPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAK-----DDEIRGAEDKFAESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQEKRAEAESR-PRNEFVPKTLLDLNLDGGGGGLIDDGTPSHISSSASPLPSPMRSPAKSMAVTPNRQQQPCCQALYDFDPENPGELGFKENDIITLLNRVDDNWYEGAVNGRTGYFPQSYVQV 361          
BLAST of Endophilin-A3 vs. TrEMBL
Match: A0A4S2LB47 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008447 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 3.664e-119
Identity = 179/365 (49.04%), Postives = 258/365 (70.68%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKG---SKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKA-PA--SQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRV--PTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL G KKQLNKANQ ++EK+G  +GT+L+++Y+ETEKK+D+   L DE++ +  E+LQPNP++RAK+ TMN  +K+ GK  + ++YPQPE Q+ +   KYG++L   + +G CL+++ ESFK +ADIKY++ED +K NF++P+  IQ  ++KEI HHRKK++GRRLD+DCKKR ++K    +K+ EDE+K AEEKF +SK LA +AM NFL+SE E I AL E + A+++YH +  EI+E L   +I+K +E S+K  P    +R S+L        +  NS T +   L        H  + +   +  P+CR LYDF+AE+ +EL F+EGDVI+LLQQVD++WFEGE N R+G+FPINYVEV
Sbjct:    1 MSLAGFKKQLNKANQFVSEKIGGVEGTKLDDEYLETEKKVDVICKLIDEVVTQTQEFLQPNPAHRAKMLTMNTLNKLQGKA-KSSVYPQPEGQLGDCMQKYGRDLGPDSCYGQCLLQSGESFKYLADIKYTMEDHVKDNFLQPLHSIQTHELKEINHHRKKLEGRRLDFDCKKRKQDKAAATAKLPEDELKIAEEKFVESKILAEQAMINFLNSEVEQIQALTELVTAQVDYHRQATEIMEQLQKFLIDKKDEASSKPRPVYEPKRFSTLP-------NQVNSRTPSQSALSTPAKNGPHVNASAPSPILGPSCRGLYDFEAENASELPFSEGDVIRLLQQVDENWFEGELNGRRGYFPINYVEV 357          
BLAST of Endophilin-A3 vs. TrEMBL
Match: A0A1S3K9F9 (endophilin-A3 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106179882 PE=4 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 4.539e-116
Identity = 176/357 (49.30%), Postives = 250/357 (70.03%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL GL+KQ NKANQ ++EK+G AKGTEL+E+++E E+KID+   L ++++ +  EYLQPNP+ RAKL T+N   K+ G+  Q A YPQPE  + E   K+GK+L   ++FG CL+E  ESFK +AD+KY+LED +KQNF+EP+  +Q  D+KE+ HHRKK+ GRRLDYDCKKR K+KGS ISEDE++ AEEKFE+SK LA  AM+N L+++ E I+ LA FI+A+ +YH R A+IL+ L++++  K  E +++ P S+ +S  KK + S  +SS +  +N + L             S  +   C ALYDF  E+  EL F EGD+I L+ Q+D++W+EG  + + GFFP+NYVEV
Sbjct:    1 MSLAGLRKQFNKANQFMSEKIGGAKGTELDEEFLEMERKIDVTGKLVEDVMARTQEYLQPNPASRAKLMTVNTISKLRGQVKQTA-YPQPEGILGETMIKHGKDLGDDSSFGQCLVEAGESFKQLADVKYALEDSVKQNFLEPLQHLQNKDLKEVNHHRKKLGGRRLDYDCKKRKKDKGSAISEDELQQAEEKFEESKQLAETAMHNLLENDVEQISQLASFIEAQEDYHRRAADILQQLHDTLQSKRNEAASR-PRSEFVS--KKVTSSFRNSSPAFDNNLDSLDTTGYSLSPAQQSSEPQQACCTALYDFDPENPGELGFREGDMITLISQIDENWYEGSIHGQTGFFPVNYVEV 353          
BLAST of Endophilin-A3 vs. TrEMBL
Match: Q5DEG7 (SJCHGC01831 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 9.540e-116
Identity = 170/363 (46.83%), Postives = 260/363 (71.63%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKG---SKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIK---TKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL GLKKQLNKANQ ++EK+G A+GT+L+++Y+E EKK+D    LF++++ +  E+LQPNP+YRAKL TMN  +K+ GK+ + A YPQPENQ+ E   KYG++L   + +G CL++  ESFK +ADIKY++E+ +K+NF++P+  +Q  ++KEI HHRKK++GRRLD+DCKKR +++    S++ EDE+K AEEKF++SK LA  AM NFL+SE + + +L EFI A+ +YH +  +I+E L   +I+K +E  +K    ++    K+ + + NH +  +      ++    K   + H T  +    P+CRAL+DF+AE+++EL F+EGD+I L+ +VD++W+EGE N RKG+FP+NYVEV
Sbjct:    1 MSLAGLKKQLNKANQFMSEKIGGAEGTKLDDEYVEIEKKVDTISKLFEDVIAQTHEFLQPNPAYRAKLMTMNTLNKLQGKS-KNASYPQPENQLGECMIKYGRDLGPESCYGQCLVQAGESFKYLADIKYTMEEHVKENFLDPLHSVQTHELKEINHHRKKLEGRRLDFDCKKRKQDRSASNSRLPEDELKIAEEKFQESKLLAEPAMINFLNSETDQVQSLTEFITAQADYHRQATDIMEQLRKFLIDKKDETVSKP---RKFYEPKRVTGTLNHDTTDDKSPLNSVLNTPAKNGPSPHATKDAPIFGPSCRALFDFEAENDSELPFSEGDIISLILRVDENWYEGELNGRKGYFPVNYVEV 359          
BLAST of Endophilin-A3 vs. TrEMBL
Match: G4LV14 (Sh3-containing grb2-like protein 3 (Endophilin III) OS=Schistosoma mansoni OX=6183 GN=Smp_036990 PE=4 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 1.550e-114
Identity = 170/363 (46.83%), Postives = 261/363 (71.90%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTT-FGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKG---SKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNH---SSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL GLKKQ+NKANQ ++EK+G A+GT+L+++Y+E EKK+D    LF++++ +  EYLQPNP+YRAKL TMN  +K+ GK+   A YPQPENQ+ E   KYG++L   + +G CL+E  E+FK +A+IKY++E+ +K+NF++P+  +Q  ++KEI +HRKK++GRRLD+DCKKR +++    S++ EDE+K AEEKF++SK+LA +AM NFL+SE + + +L EF  ++ +YH + AEI+E L   +I+K EE  +K     ++  +K+ + + NH    S S  +++           H T  +    P+C+AL+DF+AE+++EL F+EGD+I L+ +VD++WFEGE N RKG+FP+NYVEV
Sbjct:    1 MSLAGLKKQINKANQFMSEKIGGAEGTKLDDEYVEIEKKVDTISKLFEDVIAQTHEYLQPNPAYRAKLMTMNTLNKLQGKSKCTA-YPQPENQLGECMIKYGRDLGPDSYYGQCLVEAGETFKCLANIKYTMEEHVKENFLDPLHSVQTHELKEINYHRKKLEGRRLDFDCKKRKQDRSANNSRLPEDELKVAEEKFQESKALAEQAMINFLNSETDQVQSLLEFTTSQADYHRQAAEIMEQLRKFLIDKKEESMSKP---HKLYEIKRVNDTLNHDISGSRSPLNSTLNTPTKNGPGSHTTKNAPILGPSCKALFDFEAENDSELSFSEGDIISLILRVDENWFEGELNGRKGYFPVNYVEV 359          
BLAST of Endophilin-A3 vs. TrEMBL
Match: A0A3Q0KEK2 (Sh3-containing grb2-like protein 3 (Endophilin III) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 4.136e-114
Identity = 170/360 (47.22%), Postives = 260/360 (72.22%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTT-FGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKG---SKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL GLKKQ+NKANQ ++EK+G A+GT+L+++Y+E EKK+D    LF++++ +  EYLQPNP+YRAKL TMN  +K+ GK+   A YPQPENQ+ E   KYG++L   + +G CL+E  E+FK +A+IKY++E+ +K+NF++P+  +Q  ++KEI +HRKK++GRRLD+DCKKR +++    S++ EDE+K AEEKF++SK+LA +AM NFL+SE + + +L EF  ++ +YH + AEI+E L   +I+K EE  +K     ++  +K+ + + NH    +   S   +  T+ T   T       P+C+AL+DF+AE+++EL F+EGD+I L+ +VD++WFEGE N RKG+FP+NYVEV
Sbjct:   20 MSLAGLKKQINKANQFMSEKIGGAEGTKLDDEYVEIEKKVDTISKLFEDVIAQTHEYLQPNPAYRAKLMTMNTLNKLQGKSKCTA-YPQPENQLGECMIKYGRDLGPDSYYGQCLVEAGETFKCLANIKYTMEEHVKENFLDPLHSVQTHELKEINYHRKKLEGRRLDFDCKKRKQDRSANNSRLPEDELKVAEEKFQESKALAEQAMINFLNSETDQVQSLLEFTTSQADYHRQAAEIMEQLRKFLIDKKEESMSKP---HKLYEIKRVNDTLNH----DISGSRSPLNSTLNTP--TKNGPVLGPSCKALFDFEAENDSELSFSEGDIISLILRVDENWFEGELNGRKGYFPVNYVEV 369          
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Match: sh3gl3a (endophilin-A3-like [Source:NCBI gene;Acc:103022507])

HSP 1 Score: 296.59 bits (758), Expect = 5.835e-96
Identity = 161/382 (42.15%), Postives = 238/382 (62.30%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQ-----RISSLKKC-----------------SYSDNHSSNSETDNSEQLVKLT---IKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA+QL++EK+  A+GT+L+ED++E E+KID+      ELL K TEYLQPNP+ RAKL  +N   KI G+      YPQ E  + +   KYG+EL   +TFG+ L++  E+ K M D+K SL+  +KQNF++P+  +Q+ D+KEI HH KK++GRRLD+D KK+ +    KI ++E++ A EKFE+SK LA  +M NFL+++ E ++ LA  I+A +EYH ++ EILE L NS ++     +N  P  +      +SSL+                    +   HS N +TD+   +  +T    ++  D ++     P CR+LYDF+ E+E EL F EGD+I L  Q+D++W+EG  N   GFFPINYV+V
Sbjct:    1 MSVAGLKKQFHKASQLLSEKISGAEGTKLDEDFMEMERKIDVTNKSVFELLTKTTEYLQPNPASRAKLGMLNTMSKIRGQVKTTG-YPQTEGLLGDCMLKYGRELGDESTFGAALVDVGEAMKQMGDVKDSLDIGVKQNFIDPLQTLQDKDLKEIGHHLKKLEGRRLDFDYKKKRQ---GKIPDEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLASLIEAALEYHRQSYEILEDL-NSKLQNRIATANSQPRKEFKPKSIMSSLETIDNDQQNGLSYSSSLKSSDHQVTHSVNGKTDHVSYIPPMTHTWPESPRDKTELHMDQPCCRSLYDFEPENEGELGFKEGDIIILTNQIDENWYEGMINGESGFFPINYVDV 377          
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Match: ENSAMXT00000053701.1 (endophilin-A1 [Source:NCBI gene;Acc:103033999])

HSP 1 Score: 292.738 bits (748), Expect = 5.519e-95
Identity = 148/359 (41.23%), Postives = 236/359 (65.74%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRI--SSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA Q ++EKVG A+GT+L++D+ E EKK+D       +++ + TEYLQPNP+ RAKLT +N   KI G+      YPQ E+ + E   K+G+EL + ++FG  L++ SE+ +++ ++K +L+ ++KQNF++P+  + + D+KEI HH KK++GRRLD+D KK+ +    K+++DE+K A EKF++SK +A ++M N L+S+ E ++ LA  +KA++EYH +  ++L+ L + + E+ +E SNK P  + I    ++    S+NH+    T  S              S +    P+CRALYDF+ E+E EL F EGD+I L  Q+DD+W+EG  + + GFFPINYV++
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMEKKVDTTSRAVLDIMARTTEYLQPNPASRAKLTMINTMSKIRGQEKGPG-YPQAESVLGEAMQKFGRELGEESSFGLALIDASEAMRELGEVKDALDMEVKQNFIDPLQNLHDKDIKEIQHHLKKMEGRRLDFDYKKKRQ---GKVTDDEIKQALEKFDESKEIAEQSMFNLLESDIEQVSQLAALVKAQLEYHRQATDVLQQLSSKMEERIKEASNK-PRKEYIPKPRMELQLPSENHNGGIHTAKSPA-----------RSPAPLDQPSCRALYDFEPENEGELGFKEGDIITLTNQIDDNWYEGMIHGQSGFFPINYVDI 343          
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Match: sh3gl3a (endophilin-A3-like [Source:NCBI gene;Acc:103022507])

HSP 1 Score: 293.508 bits (750), Expect = 5.835e-95
Identity = 157/365 (43.01%), Postives = 228/365 (62.47%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQR--------VPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA+QL++EK+  A+GT+L+ED++E E+KID+      ELL K TEYLQPNP+ RAKL  +N   KI G+      YPQ E  + +   KYG+EL   +TFG+ L++  E+ K M D+K SL+  +KQNF++P+  +Q+ D+KEI HH KK++GRRLD+D KK+ +    KI ++E++ A EKFE+SK LA  +M NFL+++ E ++ LA  I+A +EYH ++ EILE L NS ++     +N  P   R     K   S   + +++  N          + H  + S            P CR+LYDF+ E+E EL F EGD+I L  Q+D++W+EG  N   GFFPINYV+V
Sbjct:    1 MSVAGLKKQFHKASQLLSEKISGAEGTKLDEDFMEMERKIDVTNKSVFELLTKTTEYLQPNPASRAKLGMLNTMSKIRGQVKTTG-YPQTEGLLGDCMLKYGRELGDESTFGAALVDVGEAMKQMGDVKDSLDIGVKQNFIDPLQTLQDKDLKEIGHHLKKLEGRRLDFDYKKKRQ---GKIPDEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLASLIEAALEYHRQSYEILEDL-NSKLQNRIATANSQP---RKEFKPKSIMSSLETIDNDQQNGLSYSSSLKSSDHQVTHSVNGKKTELHMDQPCCRSLYDFEPENEGELGFKEGDIIILTNQIDENWYEGMINGESGFFPINYVDV 357          
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Match: sh3gl3a (endophilin-A3-like [Source:NCBI gene;Acc:103022507])

HSP 1 Score: 292.352 bits (747), Expect = 1.610e-94
Identity = 160/374 (42.78%), Postives = 235/374 (62.83%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQ-----RISSLKKCSYSDNHSSNS---------ETDNSEQLVKLT---IKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA+QL++EK+  A+GT+L+ED++E E+KID+      ELL K TEYLQPNP+ RAKL  +N   KI G+      YPQ E  + +   KYG+EL   +TFG+ L++  E+ K M D+K SL+  +KQNF++P+  +Q+ D+KEI HH KK++GRRLD+D KK+ +    KI ++E++ A EKFE+SK LA  +M NFL+++ E ++ LA  I+A +EYH ++ EILE L NS ++     +N  P  +      +SSL+     DN   N            D+   +  +T    ++  D ++     P CR+LYDF+ E+E EL F EGD+I L  Q+D++W+EG  N   GFFPINYV+V
Sbjct:    1 MSVAGLKKQFHKASQLLSEKISGAEGTKLDEDFMEMERKIDVTNKSVFELLTKTTEYLQPNPASRAKLGMLNTMSKIRGQVKTTG-YPQTEGLLGDCMLKYGRELGDESTFGAALVDVGEAMKQMGDVKDSLDIGVKQNFIDPLQTLQDKDLKEIGHHLKKLEGRRLDFDYKKKRQ---GKIPDEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLASLIEAALEYHRQSYEILEDL-NSKLQNRIATANSQPRKEFKPKSIMSSLETI---DNDQQNGLSYSSSLKSSADHVSYIPPMTHTWPESPRDKTELHMDQPCCRSLYDFEPENEGELGFKEGDIIILTNQIDENWYEGMINGESGFFPINYVDV 366          
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Match: sh3gl1b (SH3 domain containing GRB2 like 1, endophilin A2 [Source:NCBI gene;Acc:103032391])

HSP 1 Score: 281.952 bits (720), Expect = 1.602e-90
Identity = 148/367 (40.33%), Postives = 235/367 (64.03%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKC---SYSDNH-------SSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+Q+++EKVG A+GT+L+E++ + E+K+D+      EL++K +EYLQPNP+ RAKL+ +N   KI G+      YPQ E  + E   KYG++L + T FG  LM+  ES K +A++K SL+  +KQNF++P+  + + D++EI HH KK++GRRLDYD KK+ +    KI ++EVK A EKF +SK +A  +M N L+++ E ++ L+  ++++++YH +  +ILE L + + ++  E  ++ P  + I   K       +++H       SS   T NSE  +KL   ++       ++   C+ALYDF+ E+E EL F EGD+I L  Q+D++W+EG  + + GFFP+NYVEV
Sbjct:    1 MSVAGLKKQFYKASQMVSEKVGGAEGTKLDEEFKDLERKVDVTSKAVVELISKTSEYLQPNPASRAKLSMLNTMSKIRGQVKSPG-YPQAEGLLGECMGKYGRDLGEETNFGLALMDVGESMKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYDYKKKRQ---GKIPDEEVKQALEKFHESKEVAEISMYNLLETDIEQVSQLSSLVESQLQYHKQAVQILEELSDKLKDRIGEAQSR-PRKEYIPKPKPVFDFGETNDHSNGGFAPSSAPPTRNSEPNLKLGKSSRKPRLTPAEQA-CCKALYDFEPENEGELGFREGDIITLTNQIDENWYEGMLHGQSGFFPLNYVEV 361          
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Match: SH3GL1 (SH3 domain containing GRB2 like 1, endophilin A2 [Source:HGNC Symbol;Acc:HGNC:10830])

HSP 1 Score: 265.774 bits (678), Expect = 4.537e-85
Identity = 141/347 (40.63%), Postives = 215/347 (61.96%), Query Frame = 2
Query:  341 NKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            +K  Q ++EKVG A+GT+L++D+ E EKK D       +++ K  EYLQPNP+ RAKL  +N   KI G+      YPQPE  + E   KYGK++ + + FG  L +  ES K MA+IK SL+  +KQNF++P+  +Q+ ++KEI HH KK++GRRLD+D KK+   +  KI ++E++ AEEKFE+S+ +A  +M+N ++SE E ++ LA  + A++EYH R+A +L+ L  ++ E+  E S K P  +     K    S  H ++      E +      +   ++ S    P+ +ALYDF  E+E EL F EGD+I L +Q+DD+W+EG      GFFP+NYV+V
Sbjct:   13 HKCTQFVSEKVGGAEGTKLDDDFTEMEKKYDTTNKAVMDIITKTQEYLQPNPASRAKLGMLNTMSKIRGQVKSTG-YPQPEGLLGEAMAKYGKDMGTESCFGLALADVGESMKQMAEIKDSLDIDVKQNFLDPMQALQDKELKEIGHHLKKLEGRRLDFDYKKK---RLGKIPDEEIRQAEEKFEESREVAASSMHNLVESEIEQVSQLAALVDAQLEYHQRSAAVLQDLQAALQERKNEAS-KMPKKE----FKAKPMSTFHENSWGNGGGENIYPAMSGSASASASSRSSAPSAKALYDFDPENEGELGFQEGDIITLTKQIDDNWYEGTVRGHSGFFPVNYVDV 350          
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Match: SH3GL1 (SH3 domain containing GRB2 like 1, endophilin A2 [Source:HGNC Symbol;Acc:HGNC:10830])

HSP 1 Score: 125.561 bits (314), Expect = 1.984e-34
Identity = 62/148 (41.89%), Postives = 99/148 (66.89%), Query Frame = 2
Query:  503 RAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSE 943
            RAKL  +N   KI G+      YPQPE  + E   KYG++L + + FG  L++  ES+K+MA++K  L+  +KQNF++P+  +QE +++EI  H KK++GRRLD+D KK+ +    KI E++++ + EKFE+SK +A  +M N L+S+
Sbjct:    3 RAKLGMLNTMSKIRGQVKSTG-YPQPEGTLGECMVKYGQDLGEESNFGQALVDVGESYKEMAEVKDGLDIGVKQNFIDPLQGLQEKELREIGQHLKKLEGRRLDFDYKKKRQ---GKILEEDIRQSAEKFEESKEVAESSMFNLLESD 146          
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Match: SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2 [Source:HGNC Symbol;Acc:HGNC:10834])

HSP 1 Score: 78.1814 bits (191), Expect = 7.554e-16
Identity = 86/395 (21.77%), Postives = 162/395 (41.01%), Query Frame = 2
Query:  338 LNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKY----GKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYD-CKKRNKEK--------------------------GSKISEDEVKAAEEKFEDSKS----------LAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVK----LTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKL--LQQVDDSWFEGEHNNRKGFFPINYVEV 1378
             ++A Q   EK+G A+ TEL+  +     + ++ ++  D+++ +    LQPNP+ R +      F K+ GK   +A         SE   +Y    G+E    T +G  L++   + K++   +          F+ P+    + D + I   +K ++ +RLD D CK R K+                            + +  DEV  AE++   +++          L +E + +   +   H  AL EF++A+  Y+++        Y S++E  +E  +   +    ++L   + S   S+ +    S   V     L + +              R LYD+ A   +EL     +V+ +  L  +D  W  GE  N+KG  P+ Y+E+
Sbjct:   16 FSRAVQFTEEKLGQAERTELDAHFENLLGRAEMTRHWTDKIMRQAETLLQPNPNARIE---DYFFEKLEGKAPLRATN-------SEYLGQYMIEAGQEFGPGTAYGCALIKCGTTQKELGISEKDFIQTTANGFLTPLRNFLDGDFRTIAKEKKILENKRLDLDACKSRLKKARSAEAKAATEPDFNEIRPRNYVLSASAAGLWADEVARAEQELRVTQTEFDRQAEITRLLLEGIGS---THANHHRALKEFVEAQAAYYAKC-------YQSMVELQKELGSFPTSFVSNNNLAGAAGSGAASAGTGGGGSAPPVPTPSILGLPSAEGAPPLVTGTRRARVLYDYDAADMSELSLLADEVVTVYSLPGMDSDWLMGERGNQKGKVPVTYLEL 390          
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Match: SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2 [Source:HGNC Symbol;Acc:HGNC:10834])

HSP 1 Score: 74.3294 bits (181), Expect = 1.769e-15
Identity = 49/226 (21.68%), Postives = 111/226 (49.12%), Query Frame = 2
Query:  353 QLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK-STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESL 1027
            Q+  E VG A+ TEL+  +++    +D+ +N  D+L+ ++   +QPNPS ++  + ++  + + G++    +       + + F   G+EL   T +G+ L +  E+ K +   +      + ++F+ P+ K  + D+  I   RK ++ +RLD D  +   ++ +   E+E + A+ +F+         +     +   H+  L  ++ A+ +YH    + L++L
Sbjct:    1 QMAGETVGQAEKTELDASFLKLFGDVDITRNWTDKLIKQVEVVIQPNPS-KSHFSGVSTIYYVRGRS----VGWTDTEILGQSFVDAGQELGPGTNYGAALTKAGETHKQLGTSEKEYIHVVSKDFLGPLHKFLDNDVAIIARERKALEAKRLDLDTLRSKLKRCT--DEEEKQKAQAQFDHQAETTKILLEGLKSTHVSHLACLHHYVDAKAKYHEDCLQKLKTL 219          
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Match: sorbs1 (sorbin and SH3 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-090313-168])

HSP 1 Score: 69.707 bits (169), Expect = 7.378e-13
Identity = 27/53 (50.94%), Postives = 40/53 (75.47%), Query Frame = 2
Query: 1220 TCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            T RA Y+F+A+S+ EL  ++GDV+ + +QVD +W+EGEH+ R G FP  YVE+
Sbjct:  398 TARAKYNFRAQSQKELPLHKGDVVYINRQVDQNWYEGEHHGRVGIFPATYVEL 450          

HSP 2 Score: 48.1358 bits (113), Expect = 3.531e-6
Identity = 20/51 (39.22%), Postives = 34/51 (66.67%), Query Frame = 2
Query: 1229 ALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRK--GFFPINYVE 1375
            A+Y++K ++E EL+   GDV++++++ DD WF G     +  G FP NYV+
Sbjct:  588 AIYNYKPQNEDELELLVGDVVEVMEKCDDGWFVGTSRRTRLFGTFPGNYVK 638          
BLAST of Endophilin-A3 vs. Ensembl Yeast
Match: LSB3 (Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization; protein abundance increases in response to DNA replication stress; LSB3 has a paralog, YSC84, that arose from the whole genome duplication [Source:SGD;Acc:S000002968])

HSP 1 Score: 61.6178 bits (148), Expect = 1.058e-10
Identity = 33/91 (36.26%), Postives = 48/91 (52.75%), Query Frame = 2
Query: 1112 YSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVD--DSWFEGEHNNRKGFFPINYVEV 1378
            +S +  S++ T  + Q  + T  T   TS      P   ALY F  E   +L F +GDVI +L++ D  + W+ G  N R+G FP NYVE+
Sbjct:  374 FSKSRISSASTPQTSQ-GRFTAPTSPSTSS-----PKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVEL 458          
BLAST of Endophilin-A3 vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 60.077 bits (144), Expect = 3.378e-10
Identity = 25/57 (43.86%), Postives = 35/57 (61.40%), Query Frame = 2
Query: 1214 VPTCRALYDFKAESEAELQFNEGDVIKLLQQVD--DSWFEGEHNNRKGFFPINYVEV 1378
             PT  ALY+F  E   +L F +GDVI +L++ D  + W+ G  N ++G FP NYV V
Sbjct:  411 TPTAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVRV 467          
BLAST of Endophilin-A3 vs. Ensembl Yeast
Match: LSB1 (Negative regulator of actin nucleation-promoting factor activity; interacts with Las17p, a homolog of human Wiskott-Aldrich Syndrome protein (WASP), via an N-terminal SH3 domain, and along with PIN3 cooperatively inhibits the nucleation of actin filaments; overexpression blocks receptor-mediated endocytosis; protein increases in abundance and forms nuclear foci in response to DNA replication stress; LSB1 has a paralog, PIN3, that arose from the whole genome duplication [Source:SGD;Acc:S000003368])

HSP 1 Score: 58.151 bits (139), Expect = 4.127e-10
Identity = 28/77 (36.36%), Postives = 45/77 (58.44%), Query Frame = 2
Query: 1157 QLVKLTIKTKHDTSQ-STQRVPT---CRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVE 1375
            +L+   +  K D +Q S Q   T     ALYDF+A+ + +L    GD I++L+++   W+ G+ NN+ G FP NYV+
Sbjct:   32 ELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108          
BLAST of Endophilin-A3 vs. Ensembl Yeast
Match: RVS167 (Calmodulin-binding actin-associated protein; roles in endocytic membrane tabulation and constriction, and exocytosis; N-BAR domain protein that interacts with Rvs161p to regulate actin cytoskeleton, endocytosis, and viability following starvation or osmotic stress; recruited to bud tips by Gyl1p and Gyp5p during polarized growth; homolog of mammalian amphiphysin [Source:SGD;Acc:S000002796])

HSP 1 Score: 56.9954 bits (136), Expect = 3.657e-9
Identity = 22/55 (40.00%), Postives = 37/55 (67.27%), Query Frame = 2
Query: 1220 TCRALYDFKAESEAELQFNEGDVIKLLQQVDD--SWFEGEHNNRKGFFPINYVEV 1378
            T  ALYD++A++  +L F  G VI+++Q+  D   W+ G +N ++G FP NYV++
Sbjct:  425 TVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQL 479          
BLAST of Endophilin-A3 vs. Ensembl Yeast
Match: HSE1 (Subunit of the endosomal Vps27p-Hse1p complex; complex is required for sorting of ubiquitinated membrane proteins into intralumenal vesicles prior to vacuolar degradation, as well as for recycling of Golgi proteins and formation of lumenal membranes [Source:SGD;Acc:S000000994])

HSP 1 Score: 55.8398 bits (133), Expect = 8.250e-9
Identity = 23/50 (46.00%), Postives = 29/50 (58.00%), Query Frame = 2
Query: 1223 CRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYV 1372
             RALYD       EL F +GDVI +L+QV   W++G      G FP+NYV
Sbjct:  222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYV 271          
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Match: EDO31161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYP4])

HSP 1 Score: 288.5 bits (737), Expect = 1.051e-93
Identity = 152/356 (42.70%), Postives = 236/356 (66.29%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTT-FGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVE 1375
            MS  G KKQ+NKANQ ++EK+G+AKG++LEE+++E E+K D    L +++L+K  EYLQPNP+ RAKL+   A HK+ G+  +   YPQPE  + E   K G++L  T+ FG  ++E  E+F  +A++K +L+  +KQNF++P+++++  D+KEIM HRKK+QGRRLDYDCKKR   K +K+  ++++ AEEKFE+SK L   +M N LD E E I+ L+   +A ++YH   AE+++SL +++ ++  E S++ P S+R S   K  ++D+  S+S   +   L   T      +S   ++V   +ALYDF+ E++ EL F+EGD+I +   VD++W EG  + R G FP NYVE
Sbjct:    1 MSFAGFKKQINKANQYMSEKIGSAKGSQLEEEFVELERKTDSTAKLIEDVLHKTKEYLQPNPAARAKLSMQGAVHKVRGEA-RSTRYPQPEGNLGETMVKGGQDLGDTSLFGQAMVEAGETFLQLAEVKDALDANVKQNFLDPLTQLENRDIKEIMQHRKKMQGRRLDYDCKKR---KSNKLPLEDIRIAEEKFEESKELCYNSMMNLLDGEAEQISQLSALSEAILDYHKHAAEVMQSLVSTLNDRVTEASSR-PRSERPSFTPK--FNDDDDSSSGGGSMPSLPTPTPSAPPPSSGGKEKV---KALYDFEPENDGELGFSEGDIITIESTVDENWLEGSVHGRTGLFPRNYVE 346          
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Match: EDO47212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMW0])

HSP 1 Score: 209.92 bits (533), Expect = 2.331e-63
Identity = 122/362 (33.70%), Postives = 204/362 (56.35%), Query Frame = 2
Query:  317 LTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL----KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILE----SLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
              GLKKQ+NKANQ ++EK+G+A+GT++E+++IE E+K D    L   L  K  EYLQPN +Y AK+      H     T     YP  E  + ++    G+E+    K + + + L++ + +  ++A+ ++ L++++  NF+ P+  ++  D+KE+  +RKK+QGRRLDYDCKKR   KG+K+S +E+K A+ KFE+SK+L  + M   L +E + I  L + +   +EYH ++ E LE     L   I+      +    ++ + +  +  +  + H    E+ N   L K        +S S +  P+C+A +D+KA+ E EL F EG +I L  + DD W+EG  + + G FP   V++
Sbjct:    5 FAGLKKQINKANQYVSEKMGSAEGTKMEDEFIEMERKTDALIELVANLTPKTKEYLQPNATYNAKVK----MH----MTQPDEKYPYTEGLMGDVMMLAGQEIGQVGKGSDYAAALLDFAGALHELAETRHELDEKVHSNFLGPLHDLEANDLKELTFNRKKLQGRRLDYDCKKR---KGNKVSIEEIKTAQFKFEESKNLCKQGMAKLLGNEMDMIEQLCQLVVDMLEYHKKSTESLEIAMSQLNKRIVNARRNQAEAEASAPKQAPEEPENVPEQHEKAPESTNP--LAK--------SSDSDKLKPSCKAKFDYKAKKEGELSFTEGQIITLSGKRDDEWYEGTLDGKFGIFPSALVQI 345          
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Match: EDO38201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDK8])

HSP 1 Score: 93.2041 bits (230), Expect = 7.506e-21
Identity = 80/355 (22.54%), Postives = 155/355 (43.66%), Query Frame = 2
Query:  338 LNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYD-CKK--RNKEKGSKI--SEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKL--LQQVDDSWFEGEHNNRKGFFPINYVEV 1378
             ++A Q   E++G A+ TE +  +    ++ D  K   + LL +    LQPNP  RA+      + K+  K  ++  + +    + +I    G EL   T++GS L++   + K +A  +     +   +++ P+    E DMK I   R+ +  +RLD D CK   R  +   +I  +E E++ A+ +F+    +    ++    S   H  AL  FI+A+ +Y+++  + ++ L   +           P +  +  +   + S          N+     +T K K               LYD+ A   +EL     +VI +  +  +D+ W  GE  +++G  P+ Y+E+
Sbjct:   19 FSRAKQYTEEQLGKAEATEFDARFESLLERADRTKQWTERLLKQTEALLQPNPGIRAE---EYFYSKLGEKKPERLTHLE---TLGKIMEDAGNELGPGTSYGSTLVKCGATEKKLASAERDFMTKSVSHYLHPLKSFLEGDMKTISTERRTLLAKRLDLDSCKAKVRKAQTPERIQQAESELRVAQAEFDRQYEVTKLLLDGIATSHANHHRALQSFIEAQAQYYAQCFQYMQDLQRQL--------GTPPPTDSVPLVPPTAPSAADVRGVLDVNAYPRPSVTKKAK--------------VLYDYDATDSSELSLLSDEVITVYNVPGMDNDWMVGERGSQRGKVPVTYLEL 345          
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Match: EDO44404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVL2])

HSP 1 Score: 67.781 bits (164), Expect = 5.006e-13
Identity = 31/70 (44.29%), Postives = 44/70 (62.86%), Query Frame = 2
Query: 1169 LTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            L  K  + + Q T + P  R LYDF+   + +L   +GD + LL+QVD++WFEG+ N  +GF P NYVEV
Sbjct:   78 LNRKRPNSSDQRTTK-PCARVLYDFEPREQGDLALCKGDFVYLLRQVDENWFEGQVNGCQGFLPSNYVEV 146          

HSP 2 Score: 64.3142 bits (155), Expect = 6.938e-12
Identity = 28/55 (50.91%), Postives = 40/55 (72.73%), Query Frame = 2
Query: 1217 PTCRALYDFKAESEAE-LQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            P  +ALYDF    E + L F +GDVI ++++VD++W EG+ NN+ G FPIN+VEV
Sbjct:  160 PVAKALYDFDGGEEQDILPFKQGDVISVIRKVDENWCEGKLNNKCGIFPINFVEV 214          
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Match: EDO43872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXM7])

HSP 1 Score: 61.6178 bits (148), Expect = 3.131e-10
Identity = 21/51 (41.18%), Postives = 37/51 (72.55%), Query Frame = 2
Query: 1223 CRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVE 1375
            C+A+YD++A    EL  + GD+I +  ++D+ W++G+ NN++G FP +YVE
Sbjct:  439 CKAIYDYQATQSDELTIHPGDIITVTARLDNGWWQGDLNNQQGIFPASYVE 489          
BLAST of Endophilin-A3 vs. Ensembl Medaka
Match: ENSORLT00000037055.1 (endophilin-A1 [Source:NCBI gene;Acc:101160542])

HSP 1 Score: 292.738 bits (748), Expect = 7.251e-95
Identity = 151/365 (41.37%), Postives = 236/365 (64.66%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNK-----APASQRISSLKKCSYSDN---HSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA Q ++EKVG A+GT+L++D+ E EKK+D+      +++ K TEYLQPNP+ RAKL+ +N   KI G+ ++   YPQ E  + +   K+G+EL + ++FG  L++  ES K++ ++K +L+ ++KQNF++P+  + + D+KEI HH KK++GRRLD+D KK+ +    K+ ++E+K A EKF++SK +A ++M N L+S+ E ++ LA  ++A++EYHSR AEIL+ L + + ++ +E S+K     +P  +    L   S S N   HS+ S                   S +    P CRALYDF+ E+E EL F EGD+I L  Q+DD+W+EG  N + GFFPINYV++
Sbjct:    1 MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMEKKVDITSRAVLDIMTKTTEYLQPNPASRAKLSMINTMSKIRGQ-DKGPGYPQAETILGDAMLKFGRELGEESSFGMALIDAGESIKELGEVKDALDMEVKQNFIDPLQNLHDKDLKEIQHHLKKMEGRRLDFDYKKKRQ---GKVQDEEIKQALEKFDESKEIAEQSMFNLLESDIEQVSQLAALVQAQLEYHSRAAEILQQLSSKMEDRIKEVSSKPRKEYSPKPRMTLELLPPSESHNGGIHSAKSPG----------------RSPAPMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDDNWYEGMINGQSGFFPINYVDI 345          
BLAST of Endophilin-A3 vs. Ensembl Medaka
Match: sh3gl1b (endophilin-A2 [Source:NCBI gene;Acc:101164792])

HSP 1 Score: 285.804 bits (730), Expect = 3.219e-92
Identity = 143/358 (39.94%), Postives = 228/358 (63.69%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKC-SYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ  KA+Q+++EKVG A+GT+L++D+ + E+K+D+      E+++K +EYLQPNP+ RAKL+ +N   KI G+      YPQ E  + E   KYG+EL + T FG  L++  ES K +A++K SL+  +KQNF++P+  + + D++EI HH KK++GRRLDYD KK+ +    KI ++E++ A EKF +SK +A  +M N L+++ E ++ L+  + ++++YH +  ++LE L + + E+  E  ++ P  +     K    + DN  SN            T+      + +    P+C+ALYDF+ E+E EL F+EGDVI L  Q+D++W+EG  N + GFFP+NYVEV
Sbjct:    1 MSVAGLKKQFYKASQMVSEKVGGAEGTKLDDDFRDLERKVDVTSKAVAEVISKTSEYLQPNPASRAKLSMLNTMSKIRGQVKNPG-YPQAEGLLGECMAKYGRELGEDTNFGGALVDVGESMKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYDYKKKRQ---GKIPDEEIRQALEKFHESKDVAETSMYNLLETDIEQVSQLSALVDSQLQYHRQAVQVLEELSDKLRERMNEAQSR-PRREYTPKPKPIFDFGDNSHSNGG-------YPTTMAPPPSRNPAPPEQPSCKALYDFEPENEGELGFHEGDVITLTNQIDENWYEGMLNGQSGFFPLNYVEV 346          
BLAST of Endophilin-A3 vs. Ensembl Medaka
Match: sh3gl1a (endophilin-A2 [Source:NCBI gene;Acc:101161753])

HSP 1 Score: 285.034 bits (728), Expect = 6.084e-92
Identity = 143/357 (40.06%), Postives = 224/357 (62.75%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK-STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GL+KQ+NKA Q+INEKVG A+GT+L+ED+ E E+K D+      E+++K TEYLQPNP+ RAKLT +N   KI G+      YPQPE  + E   KYG+++   T FG  L++  E+ K MA++K SL+  +KQNF++P+  + + D+K+I HH KK++GRRLDYD KK+ +    KI ++E++ A EKF +S+ LA  +M N L+++ E ++ L+ F+ + ++YH    +IL+ L   + E+  +  ++    + I   ++ S+   H    E D+S              S +    P C+A+YDF+ E++ EL F EGD+I L+ ++D++W+EG    R G+FP NYVEV
Sbjct:    1 MSVAGLRKQINKATQMINEKVGGAEGTKLDEDFKELERKADITSKAMLEVISKTTEYLQPNPATRAKLTMLNTVSKIRGQVKSPG-YPQPEGLLGEAMLKYGRDMGDDTNFGGALLDVGETMKRMAEVKDSLDIDVKQNFIDPLQAVADKDIKDIQHHLKKLEGRRLDYDYKKKRQ---GKIPDEELRQALEKFHESRDLAETSMYNLLETDVEQVSQLSAFVDSLLQYHQEATQILQELNGRLKERVSDAQSR--PKREIPKKRQESFEYGH----EQDDSNGGYSPAAINPPSYSAAD---PCCKAMYDFEPENDGELGFREGDIITLVSKIDENWYEGRLQGRSGYFPTNYVEV 344          
BLAST of Endophilin-A3 vs. Ensembl Medaka
Match: sh3gl1a (endophilin-A2 [Source:NCBI gene;Acc:101161753])

HSP 1 Score: 284.263 bits (726), Expect = 2.022e-91
Identity = 144/366 (39.34%), Postives = 226/366 (61.75%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELK-STTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNH-SSNSETDNSEQLVKLTIKTKHDTSQSTQRV--------PTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GL+KQ+NKA Q+INEKVG A+GT+L+ED+ E E+K D+      E+++K TEYLQPNP+ RAKLT +N   KI G+      YPQPE  + E   KYG+++   T FG  L++  E+ K MA++K SL+  +KQNF++P+  + + D+K+I HH KK++GRRLDYD KK+ +    KI ++E++ A EKF +S+ LA  +M N L+++ E ++ L+ F+ + ++YH    +IL+ L   + E+  +  ++    + I   ++ S+   H   +S    S   +     +      S QR         P C+A+YDF+ E++ EL F EGD+I L+ ++D++W+EG    R G+FP NYVEV
Sbjct:    1 MSVAGLRKQINKATQMINEKVGGAEGTKLDEDFKELERKADITSKAMLEVISKTTEYLQPNPATRAKLTMLNTVSKIRGQVKSPG-YPQPEGLLGEAMLKYGRDMGDDTNFGGALLDVGETMKRMAEVKDSLDIDVKQNFIDPLQAVADKDIKDIQHHLKKLEGRRLDYDYKKKRQ---GKIPDEELRQALEKFHESRDLAETSMYNLLETDVEQVSQLSAFVDSLLQYHQEATQILQELNGRLKERVSDAQSR--PKREIPKKRQESFEYGHEQDDSNGGYSPAAINPPSYSAAAQYPSFQRPSVKKKPTDPCCKAMYDFEPENDGELGFREGDIITLVSKIDENWYEGRLQGRSGYFPTNYVEV 360          
BLAST of Endophilin-A3 vs. Ensembl Medaka
Match: sh3gl2a (endophilin-A1 [Source:NCBI gene;Acc:101155008])

HSP 1 Score: 275.018 bits (702), Expect = 8.601e-88
Identity = 143/362 (39.50%), Postives = 229/362 (63.26%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKEL-KSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKC---SYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRV--PTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MS+ GLKKQ +KA Q ++EKVG A+GT+L++D+   EK++D       +++ K TEYLQPNP+ RAK++ MN+  ++ G+      Y Q E  + E   ++G+EL + ++FG  L++  E+ ++++D+K +L+ ++KQNF++P+  + E D+KEI HH KK++GRRLD+D KK+ +    K++EDE+K A EKF+DSK +A  +M N L+S+ E ++ LA  + A++EYHSR+ EIL  L + + E+  E S K P  + +   +     S ++ H+       S              ++S   +  P+CRALYDF  E+E EL F EGD+I L  ++DD+W+EG  +   GFFPINYV++
Sbjct:    1 MSVAGLKKQFHKATQRVSEKVGGAEGTKLDDDFTVMEKRVDTTSRAVMDVITKTTEYLQPNPATRAKMSMMNSMSRMRGQEKGPG-YTQTEAVLGESMQRFGRELGEDSSFGLALIDVGEAMRELSDVKDALDMEVKQNFIDPMQNLHEKDLKEIQHHLKKLEGRRLDFDYKKKRQ---GKVTEDEIKQALEKFDDSKEIAELSMFNLLESDIEQVSQLAALVNAQLEYHSRSTEILTQLSSKMDERIREASGK-PRKEYVPKPRPSLDFSITETHNGGMHGARSPGARSPARSPARSPARSPAPLDQPSCRALYDFDPENEGELGFKEGDIITLTNKIDDNWYEGMLHGNSGFFPINYVDI 357          
BLAST of Endophilin-A3 vs. Planmine SMEST
Match: SMESG000043383.1 (SMESG000043383.1)

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 356/356 (100.00%), Postives = 356/356 (100.00%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV
Sbjct:    1 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 356          
BLAST of Endophilin-A3 vs. Planmine SMEST
Match: SMESG000061276.1 (SMESG000061276.1)

HSP 1 Score: 385.956 bits (990), Expect = 2.334e-131
Identity = 191/360 (53.06%), Postives = 263/360 (73.06%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEEC--SNKAPASQRISSLKKCSYS--DNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            M+  G+KKQ NKANQLI+EK+G  KGTEL  +Y+E EK ID  K+LFD++L K TEYLQPNP++R KL     FHKI+GK  +K LYPQ E QISE F KY  E     FG  LME S++FK++ + KY LED I QNF+ P++K++++D++EI  HR+KVQGRRL +D  KRNKEKG+K+++ ++  A++KFE++K++A +AM+NFLDSE EHIN ++ FIKAE +YH + A+I ESLY+ +++K +E   S K  A + ++S K  S+   D +S NS+ ++ +Q      K  +D SQ T  +PTCRALYDF AES  ELQF++GD+IKL+QQVD++WFEGE   + GFFPIN+VEV
Sbjct:    1 MAFAGIKKQFNKANQLISEKIGGVKGTELSSEYLENEKLIDNYKHLFDDILLKTTEYLQPNPAHRTKLLAAKTFHKIAGKDGEKPLYPQIEGQISETFAKYSNESGGNVFGKSLMEISDTFKELEEKKYGLEDTIMQNFISPLTKLRQSDIREINLHRRKVQGRRLTFDGLKRNKEKGNKVTDADLDDAQKKFEEAKNIASDAMDNFLDSEAEHINIISSFIKAERDYHHQAADIFESLYSKLMQKRDEANSSEKPKAPRNVNSYKTASWGSEDTNSLNSQPNSPKQ--PYIFKKGYD-SQLT--IPTCRALYDFAAESPNELQFSDGDIIKLIQQVDENWFEGEFQGKTGFFPINFVEV 355          
BLAST of Endophilin-A3 vs. Planmine SMEST
Match: SMESG000022674.1 (SMESG000022674.1)

HSP 1 Score: 363.614 bits (932), Expect = 1.292e-122
Identity = 179/360 (49.72%), Postives = 258/360 (71.67%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKA---PASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL+GLKKQ NKANQLI+EK+G AKGTEL+ ++++ EKKID+   L +E++ +  E++QPNP+ RA+L TMN  HK SGK  + +LYPQPE  + E   KYGK+L   + FG  L+ET + F+ MA+IKY LED IKQNF+EP S +Q  +++EI HHRKK++GRRLD+DCKKR ++KG+KI ++E+K AE+KFE+SKSLA  AM NFL SE EHI AL  FI+++MEYH+   ++L+ L N +  KS++   K    P  +R +S  +  Y +N  +++    +      T  +++ T+  + + P  R L+DF+AE+E EL F EG+++KL+QQVD++WFEGE N R+G+FP+NYVE+
Sbjct:    1 MSLSGLKKQFNKANQLISEKIGGAKGTELDSEFLDYEKKIDILGKLIEEMIARTHEFMQPNPATRARLMTMNTLHKFSGK-GKSSLYPQPEGLLGECMMKYGKDLGDDSQFGEALIETGDVFRQMAEIKYQLEDNIKQNFLEPFSNLQIRELREINHHRKKLEGRRLDFDCKKRKQDKGAKILDEEIKTAEDKFEESKSLAELAMTNFLSSEVEHIQALQSFIQSQMEYHAEANKLLQELNNLLTVKSDKAKLKPKPQPMPKRSTS-SRSLYEENPVNDAALSGNSLFKSNT--SQYPTANGSLKEPCARGLFDFEAENETELCFKEGEIVKLIQQVDENWFEGEVNGRQGYFPVNYVEI 356          
BLAST of Endophilin-A3 vs. Planmine SMEST
Match: SMESG000022674.1 (SMESG000022674.1)

HSP 1 Score: 363.229 bits (931), Expect = 8.490e-122
Identity = 179/360 (49.72%), Postives = 258/360 (71.67%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKA---PASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL+GLKKQ NKANQLI+EK+G AKGTEL+ ++++ EKKID+   L +E++ +  E++QPNP+ RA+L TMN  HK SGK  + +LYPQPE  + E   KYGK+L   + FG  L+ET + F+ MA+IKY LED IKQNF+EP S +Q  +++EI HHRKK++GRRLD+DCKKR ++KG+KI ++E+K AE+KFE+SKSLA  AM NFL SE EHI AL  FI+++MEYH+   ++L+ L N +  KS++   K    P  +R +S  +  Y +N  +++    +      T  +++ T+  + + P  R L+DF+AE+E EL F EG+++KL+QQVD++WFEGE N R+G+FP+NYVE+
Sbjct:    1 MSLSGLKKQFNKANQLISEKIGGAKGTELDSEFLDYEKKIDILGKLIEEMIARTHEFMQPNPATRARLMTMNTLHKFSGK-GKSSLYPQPEGLLGECMMKYGKDLGDDSQFGEALIETGDVFRQMAEIKYQLEDNIKQNFLEPFSNLQIRELREINHHRKKLEGRRLDFDCKKRKQDKGAKILDEEIKTAEDKFEESKSLAELAMTNFLSSEVEHIQALQSFIQSQMEYHAEANKLLQELNNLLTVKSDKAKLKPKPQPMPKRSTS-SRSLYEENPVNDAALSGNSLFKSNT--SQYPTANGSLKEPCARGLFDFEAENETELCFKEGEIVKLIQQVDENWFEGEVNGRQGYFPVNYVEI 356          
BLAST of Endophilin-A3 vs. Planmine SMEST
Match: SMESG000022674.1 (SMESG000022674.1)

HSP 1 Score: 363.229 bits (931), Expect = 1.957e-120
Identity = 179/360 (49.72%), Postives = 258/360 (71.67%), Query Frame = 2
Query:  311 MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDELLNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNKYGKELKS-TTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETDMKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLAIEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEECSNKA---PASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQRVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFPINYVEV 1378
            MSL+GLKKQ NKANQLI+EK+G AKGTEL+ ++++ EKKID+   L +E++ +  E++QPNP+ RA+L TMN  HK SGK  + +LYPQPE  + E   KYGK+L   + FG  L+ET + F+ MA+IKY LED IKQNF+EP S +Q  +++EI HHRKK++GRRLD+DCKKR ++KG+KI ++E+K AE+KFE+SKSLA  AM NFL SE EHI AL  FI+++MEYH+   ++L+ L N +  KS++   K    P  +R +S  +  Y +N  +++    +      T  +++ T+  + + P  R L+DF+AE+E EL F EG+++KL+QQVD++WFEGE N R+G+FP+NYVE+
Sbjct:    1 MSLSGLKKQFNKANQLISEKIGGAKGTELDSEFLDYEKKIDILGKLIEEMIARTHEFMQPNPATRARLMTMNTLHKFSGK-GKSSLYPQPEGLLGECMMKYGKDLGDDSQFGEALIETGDVFRQMAEIKYQLEDNIKQNFLEPFSNLQIRELREINHHRKKLEGRRLDFDCKKRKQDKGAKILDEEIKTAEDKFEESKSLAELAMTNFLSSEVEHIQALQSFIQSQMEYHAEANKLLQELNNLLTVKSDKAKLKPKPQPMPKRSTS-SRSLYEENPVNDAALSGNSLFKSNT--SQYPTANGSLKEPCARGLFDFEAENETELCFKEGEIVKLIQQVDENWFEGEVNGRQGYFPVNYVEI 356          
The following BLAST results are available for this feature:
BLAST of Endophilin-A3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SH3GL33.760e-9543.14SH3 domain containing GRB2 like 3, endophilin A3 [... [more]
SH3GL19.999e-9038.81SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
SH3GL34.765e-8842.03SH3 domain containing GRB2 like 3, endophilin A3 [... [more]
SH3GL29.856e-8638.66SH3 domain containing GRB2 like 2, endophilin A1 [... [more]
SH3GL15.012e-7033.78SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-571.828e-8938.52Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-571.016e-8838.06Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-573.671e-8837.86Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
F35A5.83.661e-1721.63pep chromosome:WBcel235:X:3800045:3802767:-1 gene:... [more]
unc-573.958e-1752.54Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EndoA3.434e-9140.22gene:FBgn0038659 transcript:FBtr0083699[more]
EndoA3.434e-9140.22gene:FBgn0038659 transcript:FBtr0334522[more]
EndoA3.434e-9140.22gene:FBgn0038659 transcript:FBtr0083698[more]
EndoB4.766e-1422.83gene:FBgn0034433 transcript:FBtr0086559[more]
EndoB3.685e-1221.58gene:FBgn0034433 transcript:FBtr0086558[more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3gl1a6.904e-9341.78SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
sh3gl1a2.403e-9240.98SH3-domain GRB2-like 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
sh3gl1b4.178e-8939.34SH3-domain GRB2-like 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
sh3gl2a2.867e-8839.78SH3 domain containing GRB2 like 2a, endophilin A1 ... [more]
sh3gl1b6.257e-8838.94SH3-domain GRB2-like 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gipc23.009e-9643.02GIPC PDZ domain containing family member 2 [Source... [more]
sh3gl13.478e-8939.78SH3-domain GRB2-like 1 [Source:NCBI gene;Acc:61936... [more]
gipc23.968e-8942.15GIPC PDZ domain containing family member 2 [Source... [more]
sh3gl11.454e-8838.74SH3-domain GRB2-like 1 [Source:NCBI gene;Acc:61936... [more]
gipc21.660e-8842.15GIPC PDZ domain containing family member 2 [Source... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh3gl35.431e-9543.14SH3-domain GRB2-like 3 [Source:MGI Symbol;Acc:MGI:... [more]
Sh3gl12.836e-8938.27SH3-domain GRB2-like 1 [Source:MGI Symbol;Acc:MGI:... [more]
Sh3gl22.835e-8638.66SH3-domain GRB2-like 2 [Source:MGI Symbol;Acc:MGI:... [more]
Sh3gl39.672e-8142.37SH3-domain GRB2-like 3 [Source:MGI Symbol;Acc:MGI:... [more]
Sh3gl21.088e-7237.39SH3-domain GRB2-like 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Endophilin-A3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35180|SH3G3_RAT6.993e-9542.86Endophilin-A3 OS=Rattus norvegicus OX=10116 GN=Sh3... [more]
sp|Q99963|SH3G3_HUMAN1.806e-9443.14Endophilin-A3 OS=Homo sapiens OX=9606 GN=SH3GL3 PE... [more]
sp|Q62421|SH3G3_MOUSE9.808e-9442.86Endophilin-A3 OS=Mus musculus OX=10090 GN=Sh3gl3 P... [more]
sp|Q8I1C0|SH3G3_DROPS3.335e-9240.76Endophilin-A OS=Drosophila pseudoobscura pseudoobs... [more]
sp|Q8I190|SH3G3_DROVI7.316e-9240.49Endophilin-A OS=Drosophila virilis OX=7244 GN=Endo... [more]
back to top
BLAST of Endophilin-A3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LB473.664e-11949.04Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S3K9F94.539e-11649.30endophilin-A3 isoform X3 OS=Lingula unguis OX=7574... [more]
Q5DEG79.540e-11646.83SJCHGC01831 protein OS=Schistosoma japonicum OX=61... [more]
G4LV141.550e-11446.83Sh3-containing grb2-like protein 3 (Endophilin III... [more]
A0A3Q0KEK24.136e-11447.22Sh3-containing grb2-like protein 3 (Endophilin III... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3gl3a5.835e-9642.15endophilin-A3-like [Source:NCBI gene;Acc:103022507... [more]
ENSAMXT00000053701.15.519e-9541.23endophilin-A1 [Source:NCBI gene;Acc:103033999][more]
sh3gl3a5.835e-9543.01endophilin-A3-like [Source:NCBI gene;Acc:103022507... [more]
sh3gl3a1.610e-9442.78endophilin-A3-like [Source:NCBI gene;Acc:103022507... [more]
sh3gl1b1.602e-9040.33SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SH3GL14.537e-8540.63SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
SH3GL11.984e-3441.89SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
SH3GLB27.554e-1621.77SH3 domain containing GRB2 like, endophilin B2 [So... [more]
SH3GLB21.769e-1521.68SH3 domain containing GRB2 like, endophilin B2 [So... [more]
sorbs17.378e-1350.94sorbin and SH3 domain containing 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
LSB31.058e-1036.26Protein containing a C-terminal SH3 domain; binds ... [more]
YSC843.378e-1043.86Actin-binding protein; involved in bundling of act... [more]
LSB14.127e-1036.36Negative regulator of actin nucleation-promoting f... [more]
RVS1673.657e-940.00Calmodulin-binding actin-associated protein; roles... [more]
HSE18.250e-946.00Subunit of the endosomal Vps27p-Hse1p complex; com... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO311611.051e-9342.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472122.331e-6333.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382017.506e-2122.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444045.006e-1344.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438723.131e-1041.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Endophilin-A3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037055.17.251e-9541.37endophilin-A1 [Source:NCBI gene;Acc:101160542][more]
sh3gl1b3.219e-9239.94endophilin-A2 [Source:NCBI gene;Acc:101164792][more]
sh3gl1a6.084e-9240.06endophilin-A2 [Source:NCBI gene;Acc:101161753][more]
sh3gl1a2.022e-9139.34endophilin-A2 [Source:NCBI gene;Acc:101161753][more]
sh3gl2a8.601e-8839.50endophilin-A1 [Source:NCBI gene;Acc:101155008][more]
back to top
BLAST of Endophilin-A3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043383.10.000e+0100.00SMESG000043383.1[more]
SMESG000061276.12.334e-13153.06SMESG000061276.1[more]
SMESG000022674.11.292e-12249.72SMESG000022674.1[more]
SMESG000022674.18.490e-12249.72SMESG000022674.1[more]
SMESG000022674.11.957e-12049.72SMESG000022674.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008645 ID=SMED30008645|Name=Endophilin-A3|organism=Schmidtea mediterranea sexual|type=transcript|length=1534bp
AGAAAATCCAAATAAATTTATGATGATTTTATTGAACTGATTTTATTTTG
TAAGTTGAATTTAATAAATTTTTGTATCATGATTTATTTTTAAAGATTTT
TATTTGTTCTAGTATTATGAAATAAAGAATTTGTCTTGAACAACTGCTTA
TGATGAAAAAATGTCATCAGCAGTTGTTCCATTGACAAGTTATATTTCAT
TGATATTCATGGATTTTATATAAATTACATTGTTCAAATTGTCTAGGTTA
AATTTGTTTAAATATATCACTAAATATCAACGTTTCAAATTTTTATTTTC
ATTATTAATAATGTCTCTAACTGGATTAAAGAAGCAACTTAATAAAGCAA
ATCAGTTAATCAATGAAAAAGTTGGAGCAGCTAAAGGAACTGAATTAGAA
GAAGACTATATTGAAACTGAAAAGAAAATAGATCTATGTAAAAATTTATT
CGATGAATTATTGAATAAAATCACAGAATATCTTCAACCTAATCCTTCAT
ACAGAGCTAAGTTGACCACTATGAATGCATTCCATAAAATATCTGGAAAA
ACTAACCAAAAAGCTCTATATCCACAACCAGAAAATCAAATATCTGAAAT
ATTTAATAAATATGGCAAAGAATTAAAATCAACTACTTTTGGCTCTTGTC
TTATGGAAACGTCAGAGTCTTTCAAAGACATGGCAGATATCAAATATTCA
CTAGAAGATCAAATAAAACAAAATTTTGTCGAACCAATTTCCAAAATACA
GGAAACTGATATGAAAGAAATTATGCACCATCGGAAAAAAGTCCAAGGTA
GACGACTTGATTATGATTGTAAGAAACGTAATAAGGAAAAAGGATCGAAA
ATATCTGAAGATGAGGTAAAAGCAGCCGAAGAAAAATTCGAAGATTCAAA
ATCGTTAGCGATTGAAGCAATGAATAATTTTCTTGATTCTGAAGGGGAAC
ACATAAACGCATTAGCGGAATTTATTAAAGCTGAAATGGAATATCATAGC
AGAACTGCGGAAATTTTAGAATCTCTCTACAACAGTATCATTGAAAAAAG
TGAAGAATGCAGCAATAAAGCCCCAGCTTCACAGCGAATATCTTCTTTGA
AGAAATGTTCCTATAGTGATAACCATTCGAGTAACAGTGAAACTGATAAT
TCTGAACAACTCGTCAAATTAACGATTAAAACCAAACACGACACATCACA
ATCCACTCAGAGAGTTCCAACTTGTCGAGCTCTTTATGATTTTAAAGCGG
AAAGTGAAGCGGAATTACAGTTCAATGAAGGAGACGTTATCAAACTTCTT
CAACAAGTCGATGACAGTTGGTTCGAAGGTGAGCACAATAATCGAAAAGG
ATTCTTTCCAATAAATTACGTTGAAGTTTTGATACCTCTTAGTGAACAGT
AATTATTGTTATTGATTGTTCATTTAATCGGTGCTAATATATTTTAAATG
ATAAATCTGATCCCTTTTCTAGTCTATCTAATCATCGATAATATATTTGT
TTTTTTCGGATAATTAGTTGAAACCTGATTTGTC
back to top

protein sequence of SMED30008645-orf-1

>SMED30008645-orf-1 ID=SMED30008645-orf-1|Name=SMED30008645-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
MSLTGLKKQLNKANQLINEKVGAAKGTELEEDYIETEKKIDLCKNLFDEL
LNKITEYLQPNPSYRAKLTTMNAFHKISGKTNQKALYPQPENQISEIFNK
YGKELKSTTFGSCLMETSESFKDMADIKYSLEDQIKQNFVEPISKIQETD
MKEIMHHRKKVQGRRLDYDCKKRNKEKGSKISEDEVKAAEEKFEDSKSLA
IEAMNNFLDSEGEHINALAEFIKAEMEYHSRTAEILESLYNSIIEKSEEC
SNKAPASQRISSLKKCSYSDNHSSNSETDNSEQLVKLTIKTKHDTSQSTQ
RVPTCRALYDFKAESEAELQFNEGDVIKLLQQVDDSWFEGEHNNRKGFFP
INYVEVLIPLSEQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR028501Endophilin-A
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR004148BAR_dom
IPR027267AH/BAR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 334..343
score: 27.12
coord: 317..332
score: 32.9
coord: 345..357
score: 44.63
coord: 303..313
score: 43.65
IPR001452SH3 domainSMARTSM00326SH3_2coord: 303..358
e-value: 2.7E-21
score: 86.8
IPR001452SH3 domainPFAMPF00018SH3_1coord: 306..350
e-value: 2.8E-14
score: 52.4
IPR001452SH3 domainPROSITEPS50002SH3coord: 300..359
score: 26.795
NoneNo IPR availablePRINTSPR00499P67PHOXcoord: 305..325
score: 34.52
coord: 341..354
score: 32.14
coord: 325..341
score: 47.06
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 292..361
e-value: 3.3E-25
score: 89.4
NoneNo IPR availablePANTHERPTHR14167SH3 DOMAIN-CONTAININGcoord: 2..361
IPR004148BAR domainSMARTSM007215barcoord: 5..245
e-value: 6.1E-54
score: 195.2
IPR004148BAR domainPFAMPF03114BARcoord: 6..241
e-value: 2.1E-58
score: 197.8
IPR004148BAR domainPROSITEPS51021BARcoord: 18..252
score: 25.906
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 1..250
e-value: 2.7E-70
score: 239.2
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 11..243
IPR028501Endophilin-APANTHERPTHR14167:SF45ENDOPHILIN-A3coord: 2..361
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 299..357