MyoD-like protein

Overview
NameMyoD-like protein (AAN03696.1)
Smed IDSMED30008639
Uniprot Best hitMyoblast determination protein 1 homolog OS=Gallus gallus GN=MYOD1 PE=2 SV=2 (E=1.18243e-20)
Length (bp)1606
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MyoD-like protein (SMED30008639) t-SNE clustered cells

Violin plots show distribution of expression levels for MyoD-like protein (SMED30008639) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MyoD-like protein (SMED30008639) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MyoD-like protein (SMED30008639) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryogenesis

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

MyoD-like protein ( myoD ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the body wall musculature compartment, muscle progenitor and musculature system

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Muscle progenitors arise in the piwi-1+ blastomere population during S5. 

SPIM reconstructed S5 embryo costained with piwi-1 and VAL-like (both in red) and myoD (green). Muscle progenitors, coexpressing piwi-1 and myoD, are dispersed in the embryonic wall. As muscle progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of myoD. VAL-like is expressed the temporary embryonic pharynx (at bottom) and is not detected in piwi-1+ blastomeres

Homology
BLAST of MyoD-like protein vs. Ensembl Human
Match: MYOD1 (myogenic differentiation 1 [Source:HGNC Symbol;Acc:HGNC:7611])

HSP 1 Score: 88.9669 bits (219), Expect = 7.680e-19
Identity = 65/88 (73.86%), Postives = 73/88 (82.95%), Query Frame = 3
Query:  903 KEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELL 1157
            ++EHV  P  H   G+CLLWACKACK+KT + DRRKAATMRERRRL KVNEAFETLKR TS NPNQR+PKVEIL+NAI YIE L+ LL
Sbjct:   77 EDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALL 164          
BLAST of MyoD-like protein vs. Ensembl Human
Match: MYF5 (myogenic factor 5 [Source:HGNC Symbol;Acc:HGNC:7565])

HSP 1 Score: 87.8113 bits (216), Expect = 1.250e-18
Identity = 81/184 (44.02%), Postives = 113/184 (61.41%), Query Frame = 3
Query:  900 NKEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAENKYPETICKLPTTRKSYVASDLDQQIYQSNMLKSSTLDQLSSIVDKISTT 1442
            +++EHV  P  H   G CL+WACKACK+K+  +DRRKAATMRERRRL+KVN+AFETLKR T+ NPNQR+PKVEIL+NAI YIESL+EL             L+E+ +N       + +    P +  +D     N       +  +T  S    D+   +Y ++    S+LD LS+IVD+I+++
Sbjct:   50 DEDEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQEL-------------LREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNS--PVWSRKSSTFDSIYCPDV-SNVYATDKNSLSSLDCLSNIVDRITSS 217          
BLAST of MyoD-like protein vs. Ensembl Human
Match: MYF6 (myogenic factor 6 [Source:HGNC Symbol;Acc:HGNC:7566])

HSP 1 Score: 82.0333 bits (201), Expect = 8.024e-17
Identity = 60/93 (64.52%), Postives = 73/93 (78.49%), Query Frame = 3
Query:  906 EEHVLVPGSH------GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSV 1166
            EEHVL P         GQCL+WACK CK+K+   DRRKAAT+RERRRL+K+NEAFE LKRRT  NPNQR+PKVEIL++AI YIE L++LL+ +
Sbjct:   59 EEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRL 151          
BLAST of MyoD-like protein vs. Ensembl Human
Match: MYOG (myogenin [Source:HGNC Symbol;Acc:HGNC:7612])

HSP 1 Score: 75.485 bits (184), Expect = 1.016e-14
Identity = 55/77 (71.43%), Postives = 67/77 (87.01%), Query Frame = 3
Query:  936 GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSV 1166
            GQCL WACK CK+K+V VDRR+AAT+RE+RRL+KVNEAFE LKR T  NPNQR+PKVEIL++AI YIE L+ LL+S+
Sbjct:   63 GQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSL 139          
BLAST of MyoD-like protein vs. Ensembl Celegans
Match: hlh-1 (Myoblast determination protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:P22980])

HSP 1 Score: 70.0922 bits (170), Expect = 6.048e-13
Identity = 30/46 (65.22%), Postives = 38/46 (82.61%), Query Frame = 3
Query: 1038 VNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKL 1175
            VNEAFE +K+RT  NPNQR+PKVEIL++AIDYI +LE +L   GK+
Sbjct:  171 VNEAFEVVKQRTCPNPNQRLPKVEILRSAIDYINNLERMLQQAGKM 216          
BLAST of MyoD-like protein vs. Ensembl Celegans
Match: hlh-1 (Myoblast determination protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:P22980])

HSP 1 Score: 69.707 bits (169), Expect = 7.842e-13
Identity = 30/46 (65.22%), Postives = 38/46 (82.61%), Query Frame = 3
Query: 1038 VNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKL 1175
            VNEAFE +K+RT  NPNQR+PKVEIL++AIDYI +LE +L   GK+
Sbjct:  167 VNEAFEVVKQRTCPNPNQRLPKVEILRSAIDYINNLERMLQQAGKM 212          
BLAST of MyoD-like protein vs. Ensembl Celegans
Match: hlh-1 (Myoblast determination protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:P22980])

HSP 1 Score: 69.707 bits (169), Expect = 8.248e-13
Identity = 30/46 (65.22%), Postives = 38/46 (82.61%), Query Frame = 3
Query: 1038 VNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKL 1175
            VNEAFE +K+RT  NPNQR+PKVEIL++AIDYI +LE +L   GK+
Sbjct:  171 VNEAFEVVKQRTCPNPNQRLPKVEILRSAIDYINNLERMLQQAGKM 216          
BLAST of MyoD-like protein vs. Ensembl Fly
Match: nau (nautilus [Source:FlyBase gene name;Acc:FBgn0002922])

HSP 1 Score: 91.2781 bits (225), Expect = 9.671e-20
Identity = 70/90 (77.78%), Postives = 75/90 (83.33%), Query Frame = 3
Query:  906 EEHVLVP------GSHGQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELL 1157
            EEHVL P       S   CL WACKACKKK+V VDRRKAATMRERRRLRKVNEAFE LKRRTS NPNQR+PKVEIL+NAI+YIESLE+LL
Sbjct:  127 EEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEYIESLEDLL 216          
BLAST of MyoD-like protein vs. Ensembl Fly
Match: nau (nautilus [Source:FlyBase gene name;Acc:FBgn0002922])

HSP 1 Score: 90.8929 bits (224), Expect = 1.072e-19
Identity = 70/90 (77.78%), Postives = 75/90 (83.33%), Query Frame = 3
Query:  906 EEHVLVP------GSHGQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELL 1157
            EEHVL P       S   CL WACKACKKK+V VDRRKAATMRERRRLRKVNEAFE LKRRTS NPNQR+PKVEIL+NAI+YIESLE+LL
Sbjct:  127 EEHVLAPLVCSSAQSSRPCLTWACKACKKKSVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEYIESLEDLL 216          
BLAST of MyoD-like protein vs. Ensembl Zebrafish
Match: myod1 (myogenic differentiation 1 [Source:ZFIN;Acc:ZDB-GENE-980526-561])

HSP 1 Score: 89.7373 bits (221), Expect = 1.834e-19
Identity = 66/90 (73.33%), Postives = 75/90 (83.33%), Query Frame = 3
Query:  903 KEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNS 1163
            ++EHV  P  H   G+CLLWACKACK+KT + DRRKAATMRERRRL KVN+AFETLKR TS NPNQR+PKVEIL+NAI YIESL+ LL S
Sbjct:   52 EDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNDAFETLKRCTSTNPNQRLPKVEILRNAISYIESLQALLRS 141          
BLAST of MyoD-like protein vs. Ensembl Zebrafish
Match: myf5 (myogenic factor 5 [Source:ZFIN;Acc:ZDB-GENE-000616-6])

HSP 1 Score: 84.3445 bits (207), Expect = 9.119e-18
Identity = 67/110 (60.91%), Postives = 81/110 (73.64%), Query Frame = 3
Query:  840 TSSNSSPQKLSLAIEQHLCPNKE-EHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELL 1157
            ++  SSP+ L       L  ++E EHV  PG+    G CL WACKACK+K   VDRR+AATMRERRRL+KVN AFE L+R TS NP+QR+PKVEIL+NAI YIESL+ELL
Sbjct:   13 STCASSPEDLEFGASGELTGSEEDEHVRAPGAPHQPGHCLQWACKACKRKASTVDRRRAATMRERRRLKKVNHAFEALRRCTSANPSQRLPKVEILRNAIQYIESLQELL 122          
BLAST of MyoD-like protein vs. Ensembl Zebrafish
Match: myf5 (myogenic factor 5 [Source:ZFIN;Acc:ZDB-GENE-000616-6])

HSP 1 Score: 84.3445 bits (207), Expect = 9.119e-18
Identity = 67/110 (60.91%), Postives = 81/110 (73.64%), Query Frame = 3
Query:  840 TSSNSSPQKLSLAIEQHLCPNKE-EHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELL 1157
            ++  SSP+ L       L  ++E EHV  PG+    G CL WACKACK+K   VDRR+AATMRERRRL+KVN AFE L+R TS NP+QR+PKVEIL+NAI YIESL+ELL
Sbjct:   13 STCASSPEDLEFGASGELTGSEEDEHVRAPGAPHQPGHCLQWACKACKRKASTVDRRRAATMRERRRLKKVNHAFEALRRCTSANPSQRLPKVEILRNAIQYIESLQELL 122          
BLAST of MyoD-like protein vs. Ensembl Zebrafish
Match: myf6 (myogenic factor 6 [Source:ZFIN;Acc:ZDB-GENE-040309-2])

HSP 1 Score: 79.7221 bits (195), Expect = 2.611e-16
Identity = 58/92 (63.04%), Postives = 75/92 (81.52%), Query Frame = 3
Query:  906 EEHVLVPGS-----HGQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSV 1166
            EEHVL P        GQCL+WACK CK+K+   DRRKAAT+RERRRL+K+NEAF+ LK++T  NPNQR+PKVEIL++AI+YIE L++LL+S+
Sbjct:   59 EEHVLAPPGLQAHCEGQCLMWACKICKRKSAPTDRRKAATLRERRRLKKINEAFDALKKKTVPNPNQRLPKVEILRSAINYIEKLQDLLHSL 150          
BLAST of MyoD-like protein vs. Ensembl Zebrafish
Match: myog (myogenin [Source:ZFIN;Acc:ZDB-GENE-980526-265])

HSP 1 Score: 75.485 bits (184), Expect = 9.013e-15
Identity = 61/108 (56.48%), Postives = 75/108 (69.44%), Query Frame = 3
Query:  882 EQHLCPNKEEHVLVPGSHGQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPATVGELKER 1205
            EQ  CP            GQCL WACK CK+K+V +DRRKAAT+RE+RRL+KVNEAFE LKR T  NPNQR+PKVEIL++AI YIE L+ L++S+ +     G L  R
Sbjct:   78 EQQHCP------------GQCLPWACKVCKRKSVTMDRRKAATLREKRRLKKVNEAFEALKRSTLMNPNQRLPKVEILRSAIQYIERLQALVSSLNQQEHEQGNLHYR 173          
BLAST of MyoD-like protein vs. Ensembl Xenopus
Match: myod1 (myogenic differentiation 1 [Source:Xenbase;Acc:XB-GENE-1017498])

HSP 1 Score: 90.8929 bits (224), Expect = 1.547e-20
Identity = 67/89 (75.28%), Postives = 75/89 (84.27%), Query Frame = 3
Query:  900 NKEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELL 1157
            N++EHV  P  H   G+CLLWACKACK+KT + DRRKAATMRERRRL KVNEAFETLKR TS NPNQR+PKVEIL+NAI YIESL+ LL
Sbjct:   62 NEDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSTNPNQRLPKVEILRNAIRYIESLQSLL 150          
BLAST of MyoD-like protein vs. Ensembl Xenopus
Match: myf5 (myogenic factor 5 [Source:Xenbase;Acc:XB-GENE-493550])

HSP 1 Score: 89.7373 bits (221), Expect = 9.130e-20
Identity = 89/190 (46.84%), Postives = 114/190 (60.00%), Query Frame = 3
Query:  900 NKEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAENKYPETICKLP------TTRKSYVASDLDQQIYQSNMLKSSTLDQLSSIVDKISTT 1442
            +++EHV  P  H   G CL+WACKACK+K+  +DRRKAATMRERRRL+KVN+AFETLKR T+ NPNQR+PKVEIL+NAI YIESL++LL           E  E   + P  S T       P +  +D          T C  P      ++  +   SDL Q  + S  L  S+LD LSSIVD+IS++
Sbjct:   50 DEDEHVRAPIGHHQAGNCLMWACKACKRKSSTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIKYIESLQDLLQ----------EQVENYYSLPGQSCTEPGS---PTSSCSDGM--------TDCSSPQWSGRNSSFDNVYCSDL-QTSFSSTKLTLSSLDCLSSIVDRISSS 217          
BLAST of MyoD-like protein vs. Ensembl Xenopus
Match: myf6 (myogenic factor 6 (herculin) [Source:Xenbase;Acc:XB-GENE-998203])

HSP 1 Score: 85.1149 bits (209), Expect = 2.809e-18
Identity = 61/94 (64.89%), Postives = 77/94 (81.91%), Query Frame = 3
Query:  900 NKEEHVLVPGS-----HGQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSV 1166
            ++EEHVL P        GQCL+WACK CK+K+   DRRKAAT+RERRRL+K+NEAFE LKRRT  NPNQR+PKVEIL++AI+YIE L++LL+S+
Sbjct:   57 SEEEHVLAPPGLQPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAINYIERLQDLLHSL 150          
BLAST of MyoD-like protein vs. Ensembl Xenopus
Match: myog (myogenin (myogenic factor 4) [Source:Xenbase;Acc:XB-GENE-490105])

HSP 1 Score: 75.485 bits (184), Expect = 4.092e-15
Identity = 55/79 (69.62%), Postives = 67/79 (84.81%), Query Frame = 3
Query:  936 GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGK 1172
            GQCL WACK CK+KTV +DRR+AAT+RE+RRL+KVNEAFE LKR T  NPNQR+PKVEIL++AI YIE L+ LL S+ +
Sbjct:   74 GQCLPWACKVCKRKTVSMDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQTLLASLNQ 152          
BLAST of MyoD-like protein vs. Ensembl Mouse
Match: Myod1 (myogenic differentiation 1 [Source:MGI Symbol;Acc:MGI:97275])

HSP 1 Score: 93.5893 bits (231), Expect = 1.846e-20
Identity = 87/188 (46.28%), Postives = 106/188 (56.38%), Query Frame = 3
Query:  903 KEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPATVGELKERRKNNPENSRTAIAG---KQKPLNKINDKQKAENKYPETICKLPTTRKSYVASDLDQQIYQSNMLKS---STLDQLSSIVDKIST 1439
            ++EHV  P  H   G+CLLWACKACK+KT + DRRKAATMRERRRL KVNEAFETLKR TS NPNQR+PKVEIL+NAI YIE L+ LL      P             P       +G      P +  +D     +  P      P  +  Y  +   +   +S   KS   S+LD LSSIV++IST
Sbjct:   77 EDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAFYAPGPLPPGRGSEHYSGDSDASSPRSNCSDGMMDYSGPPSG----PRRQNGYDTAYYSEAARESRPGKSAAVSSLDCLSSIVERIST 260          
BLAST of MyoD-like protein vs. Ensembl Mouse
Match: Myf5 (myogenic factor 5 [Source:MGI Symbol;Acc:MGI:97252])

HSP 1 Score: 88.5817 bits (218), Expect = 4.395e-19
Identity = 64/89 (71.91%), Postives = 75/89 (84.27%), Query Frame = 3
Query:  900 NKEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELL 1157
            + EEHV  P  H   G CL+WACKACK+K+  +DRRKAATMRERRRL+KVN+AFETLKR T+ NPNQR+PKVEIL+NAI YIESL+ELL
Sbjct:   50 DDEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELL 138          
BLAST of MyoD-like protein vs. Ensembl Mouse
Match: Myf6 (myogenic factor 6 [Source:MGI Symbol;Acc:MGI:97253])

HSP 1 Score: 82.4185 bits (202), Expect = 3.667e-17
Identity = 60/93 (64.52%), Postives = 73/93 (78.49%), Query Frame = 3
Query:  906 EEHVLVPGSH------GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSV 1166
            EEHVL P         GQCL+WACK CK+K+   DRRKAAT+RERRRL+K+NEAFE LKRRT  NPNQR+PKVEIL++AI YIE L++LL+ +
Sbjct:   59 EEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRL 151          
BLAST of MyoD-like protein vs. Ensembl Mouse
Match: Myog (myogenin [Source:MGI Symbol;Acc:MGI:97276])

HSP 1 Score: 75.0998 bits (183), Expect = 8.649e-15
Identity = 55/77 (71.43%), Postives = 67/77 (87.01%), Query Frame = 3
Query:  936 GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSV 1166
            GQCL WACK CK+K+V VDRR+AAT+RE+RRL+KVNEAFE LKR T  NPNQR+PKVEIL++AI YIE L+ LL+S+
Sbjct:   63 GQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSL 139          
BLAST of MyoD-like protein vs. UniProt
Match: sp|P16075|MYOD1_CHICK (Myoblast determination protein 1 homolog OS=Gallus gallus GN=MYOD1 PE=2 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 1.182e-20
Identity = 91/192 (47.40%), Postives = 113/192 (58.85%), Query Frame = 3
Query:  897 PNKEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSV--GKLPATVGELKERRKNNPE-NSRTAIAGKQKPLNKINDKQKAENKYPETICKLPTTRKSYVASDLDQQIYQSNMLKSSTLDQLSSIVDKISTTNTTI 1454
            P +EEHV  P  H   G+CLLWACKACK+KT + DRRKAATMRERRRL KVNEAFETLKR TS NPNQR+PKVEIL+NAI YIESL+ LL        P       E   ++P  N    +     P      +   ++ Y             Y  S  D +  +S+++  S+LD LSSIV++IST N+T 
Sbjct:   66 PTEEEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERRRLSKVNEAFETLKRCTSTNPNQRLPKVEILRNAIRYIESLQALLREQEDAYYPVLEHYSGESDASSPRSNCSDGMMEYSGPPCSSRRRNSYDSSY-------------YTESPNDPKHGKSSVV--SSLDCLSSIVERISTDNSTC 242          
BLAST of MyoD-like protein vs. UniProt
Match: sp|Q00492|SUM1_LYTVA (Transcription factor SUM-1 OS=Lytechinus variegatus GN=SUM-1 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.380e-20
Identity = 66/87 (75.86%), Postives = 73/87 (83.91%), Query Frame = 3
Query:  909 EHVLVPGSHGQ----CLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELL 1157
            EHVL PG HGQ    CL+WACKACK+K V VD+RKAAT+RERRRLRKVNEAFE LKR T  NPNQR+PKVEIL+NAI+YIE LE LL
Sbjct:   81 EHVLAPGFHGQGERRCLMWACKACKRKNVAVDKRKAATLRERRRLRKVNEAFEALKRHTCANPNQRLPKVEILRNAIEYIEKLERLL 167          
BLAST of MyoD-like protein vs. UniProt
Match: sp|Q08856|MYF5_CHICK (Myogenic factor 5 OS=Gallus gallus GN=MYF5 PE=3 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 2.653e-20
Identity = 66/92 (71.74%), Postives = 77/92 (83.70%), Query Frame = 3
Query:  894 CPNKEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLN 1160
            CP +EEHV  P  H   G CL+WACKACK+K+  +DRRKAATMRERRRL+KVN+AFETLKR T+ NPNQR+PKVEIL+NAI YIESL+ELL 
Sbjct:   50 CPEEEEHVRAPSGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTANPNQRLPKVEILRNAIRYIESLQELLR 141          
BLAST of MyoD-like protein vs. UniProt
Match: sp|P34061|MYF5_COTJA (Myogenic factor 5 (Fragment) OS=Coturnix coturnix japonica GN=MYF5 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.213e-20
Identity = 65/92 (70.65%), Postives = 77/92 (83.70%), Query Frame = 3
Query:  894 CPNKEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLN 1160
            CP +EEH+  P  H   G CL+WACKACK+K+  +DRRKAATMRERRRL+KVN+AFETLKR T+ NPNQR+PKVEIL+NAI YIESL+ELL 
Sbjct:   38 CPEEEEHIRAPSGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTANPNQRLPKVEILRNAIRYIESLQELLR 129          
BLAST of MyoD-like protein vs. UniProt
Match: sp|Q91154|MYF5_NOTVI (Myogenic factor 5 OS=Notophthalmus viridescens GN=MYF-5 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.497e-20
Identity = 90/186 (48.39%), Postives = 117/186 (62.90%), Query Frame = 3
Query:  894 CPNKEEHVLVPGSH---GQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAENKYPETICKLPTTRKSYVASDLDQQIYQSNMLKS-STLDQLSSIVDKIST 1439
            C ++EEHV  P  H   G CLLWACKACK+K+  +DRRKAATMRERRRL+KVN AFETLKR T+ NPNQR+PKVEIL+NAI YIESL+EL             L+E+ +N         +    PL+  +D   AE   P    +  +   +Y  SD+   +Y ++ L + S+LD LSSIVD+IS+
Sbjct:   48 CSDEEEHVRAPSGHHQAGHCLLWACKACKRKSSTMDRRKAATMRERRRLKKVNSAFETLKRCTTANPNQRLPKVEILRNAISYIESLQEL-------------LREQVENYYTLPGQRCSEPGSPLSNCSDGM-AECNSPAWSRRNGSFDSAY-CSDI-PTMYPTDKLSTLSSLDCLSSIVDRISS 217          
BLAST of MyoD-like protein vs. TrEMBL
Match: tr|Q8MWP6|Q8MWP6_SCHMD (MyoD-like protein OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 465/466 (99.79%), Postives = 466/466 (100.00%), Query Frame = 3
Query:   93 MIHSGSFPGSTCPINYDYSGPYSAGLEAAPFLVNQTCPYNTGTNTMPPSLSLVDNMMMNNSMHLYDRLNTHHSASYFPQILNKIEQKLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQFPTYDLISSLNNSNYDMYDSPYAAYLAAGYYQSPGFALKQYDAAGTSQPSMTDLYHXXXXXXXXXXXXXXQHKSRHLSEDAGSCQDPQSQNITSNNHHNNSYSPTTADFGSPKALSSSSQSINDGRQPTSSNSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAENKYPETICKLPTTRKSYVASDLDQQIYQSNMLKSSTLDQLSSIVDKISTTNTTIADHSMDAKPENS 1490
            MIHSGSFPGSTCPINYDYSGPYSAGLEAAPFLVNQTCPYNTGTNTMPPSLSLVDNMMMNNSMHLYDRLNTHHSASYFPQILNKIEQKLPTTSSKTTPSTLVSTSSNSISNSEFNSSRSSSQFPTYDLISSLNNSNYDMYDSPYAAYLAAGYYQSPGFALKQYDAAGTSQPSMTDLYHSSLAASSGLNLNYSQHKSRHLSEDAGSCQDPQSQNITSNNHHNNSYSPTTADFGSPKALSSSSQSINDGRQPTSSNSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWACKACKKKTVHVDRRKAATMRERRRLRKVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAENKYPETICKLPTTRKSYVASD+DQQIYQSNMLKSSTLDQLSSIVDKISTTNTTIADHSMDAKPENS
Sbjct:    1 MIHSGSFPGSTCPINYDYSGPYSAGLEAAPFLVNQTCPYNTGTNTMPPSLSLVDNMMMNNSMHLYDRLNTHHSASYFPQILNKIEQKLPTTSSKTTPSTLVSTSSNSISNSEFNSSRSSSQFPTYDLISSLNNSNYDMYDSPYAAYLAAGYYQSPGFALKQYDAAGTSQPSMTDLYHSSLAASSGLNLNYSQHKSRHLSEDAGSCQDPQSQNITSNNHHNNSYSPTTADFGSPKALSSSSQSINDGRQPTSSNSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWACKACKKKTVHVDRRKAATMRERRRLRKVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAENKYPETICKLPTTRKSYVASDIDQQIYQSNMLKSSTLDQLSSIVDKISTTNTTIADHSMDAKPENS 466          
BLAST of MyoD-like protein vs. TrEMBL
Match: tr|U5YTB0|U5YTB0_SCHMD (MyoD protein (Fragment) OS=Schmidtea mediterranea GN=myoD PE=2 SV=1)

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 406/408 (99.51%), Postives = 407/408 (99.75%), Query Frame = 3
Query:  111 FPGSTCPINYDYSGPYSAGLEAAPFLVNQTCPYNTGTNTMPPSLSLVDNMMMNNSMHLYDRLNTHHSASYFPQILNKIEQKLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQFPTYDLISSLNNSNYDMYDSPYAAYLAAGYYQSPGFALKQYDAAGTSQPSMTDLYHXXXXXXXXXXXXXXQHKSRHLSEDAGSCQDPQSQNITSNNHHNNSYSPTTADFGSPKALSSSSQSINDGRQPTSSNSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAENKYPETICKLPTTR 1334
            FPGSTCPINYDYSGPYSAGLEAAPFLVNQTCPYNTGTNTMPPSLSLVDNMMMNNSMHLYDRLNTHHSASYFPQILNKIEQKLPTTSSKTTPSTLVSTSSNSISNSEFNSSRSSSQFPTYDLISSLNNSNYDMYDSPYAAYLAAGYYQSPGFALKQYDAAGTSQPSMTDLYHSSLAASSGLNLNYSQHKSRHLSEDAGSCQDPQSQNITSNNHHNNSYSPTTADFGSPKALSSSSQ+INDGRQPTSSNSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWACKACKKKTVHVDRRKAATMRERRRLRKVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSV KLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAENKYPETICKLPTTR
Sbjct:    1 FPGSTCPINYDYSGPYSAGLEAAPFLVNQTCPYNTGTNTMPPSLSLVDNMMMNNSMHLYDRLNTHHSASYFPQILNKIEQKLPTTSSKTTPSTLVSTSSNSISNSEFNSSRSSSQFPTYDLISSLNNSNYDMYDSPYAAYLAAGYYQSPGFALKQYDAAGTSQPSMTDLYHSSLAASSGLNLNYSQHKSRHLSEDAGSCQDPQSQNITSNNHHNNSYSPTTADFGSPKALSSSSQAINDGRQPTSSNSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWACKACKKKTVHVDRRKAATMRERRRLRKVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVRKLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAENKYPETICKLPTTR 408          
BLAST of MyoD-like protein vs. TrEMBL
Match: tr|G1EN33|G1EN33_DUGJA (Myogenic determinant factor OS=Dugesia japonica GN=MDF PE=2 SV=1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 404/507 (79.68%), Postives = 440/507 (86.79%), Query Frame = 3
Query:   93 MIHSGSFPGSTCPINYDYSGPYSAGLEAAPFLVNQTCPYNTGTNTMPPSLSLVDNMMMNNSMHLYDRLNTHHSASYFPQILNKIEQKLPXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXQFPTYDLISSLNNSNYDMYDSPYAAYLAAGYYQSPGFALKQYDAAGTSQPSMTDLYHXXXXXXXXXXXXXXQHKSRHLSEDAGSCQDPQSQNITSNNHHNNSYS-------PTTADFGSPKALSSSSQSINDGRQPTSSNSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDK--QKAENKYPETICKLPTTRKSYVASDLDQQ-IYQSNMLKSSTLDQLSSIVDKISTTNTTIADHSMDAKPENS*IHNKTQQILY*PINFVLNSFALIHIVHF 1577
            MIHSGSFPGSTCPI+YDYSGPYSAGLEAAPFLVNQ CPY   TN MPPSLSLVDNMMMNNSMHLYDRLNTHHSASYFPQILNKI+QKLPTT SKT+PSTLVSTSSNS+SN+E     S SSSQFPTYDLISSLNNSNYDMYDSPYAAYLAAGYYQSP FAL+QYD++ ++QPSMTDLYHSSLAASS LNLNYSQHKSRHLSED GSC D Q+Q   SNN   N+ +       PTTADFGSPKALSSSSQSINDGRQPTSS+SSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWACKACKKKTVHVDRRKAATMRERRRLRKVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPA++GELK+RRKNN EN+R+ I GKQKP NKINDK  QK EN     +CK+ + RKSY+AS+LD Q +YQ+NMLKSSTLDQLSSIVDKIST N+T+ D+S++ KPE     N    + Y  +   LN+ ALI+IV+F
Sbjct:    1 MIHSGSFPGSTCPISYDYSGPYSAGLEAAPFLVNQNCPYTGSTNPMPPSLSLVDNMMMNNSMHLYDRLNTHHSASYFPQILNKIDQKLPTTVSKTSPSTLVSTSSNSLSNAEFNSTRSSSSSQFPTYDLISSLNNSNYDMYDSPYAAYLAAGYYQSPSFALRQYDSSSSTQPSMTDLYHSSLAASSTLNLNYSQHKSRHLSEDTGSCPDQQNQTNYSNNTTTNNSNNHNNSYSPTTADFGSPKALSSSSQSINDGRQPTSSHSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWACKACKKKTVHVDRRKAATMRERRRLRKVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPASMGELKDRRKNNTENTRSTITGKQKPSNKINDKIIQKTEN-----LCKMTSNRKSYIASELDHQVVYQANMLKSSTLDQLSSIVDKISTNNSTLLDNSVETKPEKK--LNLWNYLFY--LFHFLNTPALINIVNF 498          
BLAST of MyoD-like protein vs. TrEMBL
Match: tr|A0A068XP11|A0A068XP11_HYMMI (Transcription factor sum,myogenic determinant factor OS=Hymenolepis microstoma GN=HmN_000553800 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 8.459e-27
Identity = 87/126 (69.05%), Postives = 98/126 (77.78%), Query Frame = 3
Query:  807 SSQSINDGRQPTSSNSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKLPAT 1184
            SS  +++ R P S   S      + ++H   NKEEHVL PGSHGQCLLWACKACKKKT+ VDRRKAATMRERRRLRKVNEAFETLKRRT  NPNQRMPKVEIL+ AIDYIE+LEE+L+  G L  T
Sbjct:  298 SSLGMSEDRSPISMGDSGDDTCSSDDEHGPGNKEEHVLAPGSHGQCLLWACKACKKKTMQVDRRKAATMRERRRLRKVNEAFETLKRRTCSNPNQRMPKVEILRTAIDYIENLEEMLHRNGVLLGT 423          
BLAST of MyoD-like protein vs. TrEMBL
Match: tr|A0A158QDV4|A0A158QDV4_HYMDI (Uncharacterized protein OS=Hymenolepis diminuta PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.956e-26
Identity = 96/170 (56.47%), Postives = 110/170 (64.71%), Query Frame = 3
Query:  807 SSQSINDGRQPTSSNSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWXXXXXXXXTVHVDXXXXXXXXXXXXXXXVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIESLEELLNSVGKL--------PATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAE 1292
            SS  +++ R P S   S      + ++H   +KEEHVL PGSHGQCLLWACKACKKKT+ VDRRKAATMRERRRLRKVNEAFETLKRRT  NPNQRMPKVEIL+ AIDYIE+LEE+L+  G L        P T G L       P  + +       P NKIN    A 
Sbjct:  298 SSLGMSEDRSPISMGDSGDDTCSSDDEHGPGSKEEHVLAPGSHGQCLLWACKACKKKTMQVDRRKAATMRERRRLRKVNEAFETLKRRTCSNPNQRMPKVEILRTAIDYIENLEEMLHRNGVLLGASPTVTPPTAGNLLRSAGRYPSTNPST------PSNKINSVDGAR 461          
The following BLAST results are available for this feature:
BLAST of MyoD-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 4
Match NameE-valueIdentityDescription
MYOD17.680e-1973.86myogenic differentiation 1 [Source:HGNC Symbol;Acc... [more]
MYF51.250e-1844.02myogenic factor 5 [Source:HGNC Symbol;Acc:HGNC:756... [more]
MYF68.024e-1764.52myogenic factor 6 [Source:HGNC Symbol;Acc:HGNC:756... [more]
MYOG1.016e-1471.43myogenin [Source:HGNC Symbol;Acc:HGNC:7612][more]
back to top
BLAST of MyoD-like protein vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 3
Match NameE-valueIdentityDescription
hlh-16.048e-1365.22Myoblast determination protein 1 homolog [Source:... [more]
hlh-17.842e-1365.22Myoblast determination protein 1 homolog [Source:... [more]
hlh-18.248e-1365.22Myoblast determination protein 1 homolog [Source:... [more]
back to top
BLAST of MyoD-like protein vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 2
Match NameE-valueIdentityDescription
nau9.671e-2077.78nautilus [Source:FlyBase gene name;Acc:FBgn0002922... [more]
nau1.072e-1977.78nautilus [Source:FlyBase gene name;Acc:FBgn0002922... [more]
back to top
BLAST of MyoD-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
myod11.834e-1973.33myogenic differentiation 1 [Source:ZFIN;Acc:ZDB-GE... [more]
myf59.119e-1860.91myogenic factor 5 [Source:ZFIN;Acc:ZDB-GENE-000616... [more]
myf59.119e-1860.91myogenic factor 5 [Source:ZFIN;Acc:ZDB-GENE-000616... [more]
myf62.611e-1663.04myogenic factor 6 [Source:ZFIN;Acc:ZDB-GENE-040309... [more]
myog9.013e-1556.48myogenin [Source:ZFIN;Acc:ZDB-GENE-980526-265][more]
back to top
BLAST of MyoD-like protein vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 4
Match NameE-valueIdentityDescription
myod11.547e-2075.28myogenic differentiation 1 [Source:Xenbase;Acc:XB-... [more]
myf59.130e-2046.84myogenic factor 5 [Source:Xenbase;Acc:XB-GENE-4935... [more]
myf62.809e-1864.89myogenic factor 6 (herculin) [Source:Xenbase;Acc:X... [more]
myog4.092e-1569.62myogenin (myogenic factor 4) [Source:Xenbase;Acc:X... [more]
back to top
BLAST of MyoD-like protein vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 4
Match NameE-valueIdentityDescription
Myod11.846e-2046.28myogenic differentiation 1 [Source:MGI Symbol;Acc:... [more]
Myf54.395e-1971.91myogenic factor 5 [Source:MGI Symbol;Acc:MGI:97252... [more]
Myf63.667e-1764.52myogenic factor 6 [Source:MGI Symbol;Acc:MGI:97253... [more]
Myog8.649e-1571.43myogenin [Source:MGI Symbol;Acc:MGI:97276][more]
back to top
BLAST of MyoD-like protein vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16075|MYOD1_CHICK1.182e-2047.40Myoblast determination protein 1 homolog OS=Gallus... [more]
sp|Q00492|SUM1_LYTVA1.380e-2075.86Transcription factor SUM-1 OS=Lytechinus variegatu... [more]
sp|Q08856|MYF5_CHICK2.653e-2071.74Myogenic factor 5 OS=Gallus gallus GN=MYF5 PE=3 SV... [more]
sp|P34061|MYF5_COTJA3.213e-2070.65Myogenic factor 5 (Fragment) OS=Coturnix coturnix ... [more]
sp|Q91154|MYF5_NOTVI3.497e-2048.39Myogenic factor 5 OS=Notophthalmus viridescens GN=... [more]
back to top
BLAST of MyoD-like protein vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|Q8MWP6|Q8MWP6_SCHMD0.000e+099.79MyoD-like protein OS=Schmidtea mediterranea PE=2 S... [more]
tr|U5YTB0|U5YTB0_SCHMD0.000e+099.51MyoD protein (Fragment) OS=Schmidtea mediterranea ... [more]
tr|G1EN33|G1EN33_DUGJA0.000e+079.68Myogenic determinant factor OS=Dugesia japonica GN... [more]
tr|A0A068XP11|A0A068XP11_HYMMI8.459e-2769.05Transcription factor sum,myogenic determinant fact... [more]
tr|A0A158QDV4|A0A158QDV4_HYMDI2.956e-2656.47Uncharacterized protein OS=Hymenolepis diminuta PE... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 10..27
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.52
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.464
NoneNo IPR availableTMHMMTMhelixcoord: 20..37
IPR002546Myogenic basic muscle-specific proteinSMARTSM00520basiccoord: 222..306
e-value: 1.8E-9
score: 47.5
IPR002546Myogenic basic muscle-specific proteinPFAMPF01586Basiccoord: 245..301
e-value: 1.0E-10
score: 42.5
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 307..358
e-value: 1.0E-14
score: 64.9
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainGENE3DG3DSA:4.10.280.10coord: 292..357
e-value: 5.2E-28
score: 95.9
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 302..353
e-value: 4.9E-12
score: 45.5
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 301..352
score: 15.917
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 301..360

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002546Basic
IPR011598bHLH_dom
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007517muscle organ development
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046983protein dimerization activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor
PLANA:0007549body wall musculature compartment
PLANA:0000428musculature system
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000007Stage 7
PLANA:0000006Stage 6
PLANA:0000005Stage 5
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008639 ID=SMED30008639|Name=MyoD-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1606bp
GTTCATATTACCAACTGTTCGCCATTAATTCAGCCTGTTTTACGCCTCGT
AACAACTGTTACTTCAACAATACCGATCCAGCCCAATAAACAATGATACA
CTCCGGATCATTTCCAGGTTCCACTTGTCCGATTAACTATGACTATTCCG
GTCCATACTCAGCAGGTCTTGAGGCAGCTCCATTTTTAGTCAATCAAACC
TGTCCATATAACACTGGAACAAATACAATGCCTCCTTCGTTGTCACTAGT
AGATAATATGATGATGAATAATTCCATGCATCTTTATGATAGACTGAATA
CTCATCATTCAGCGTCGTATTTTCCTCAGATTTTAAACAAAATCGAACAG
AAATTACCAACAACCTCGAGTAAAACCACTCCATCAACATTGGTTTCAAC
ATCCTCCAATTCCATATCGAATTCTGAGTTTAATTCGTCGCGATCTTCGT
CACAATTTCCAACATACGATTTGATTTCGTCACTCAATAATAGCAACTAC
GACATGTACGATTCGCCCTATGCCGCCTATCTGGCCGCTGGTTATTATCA
ATCTCCTGGATTTGCGCTCAAACAGTACGACGCTGCTGGAACATCTCAAC
CATCAATGACAGATTTGTACCATTCATCACTAGCAGCCAGTTCAGGCTTA
AATTTGAATTATTCACAGCATAAATCGAGACATTTATCAGAAGATGCTGG
ATCATGCCAAGATCCGCAGTCTCAAAATATCACAAGCAATAATCATCATA
ACAATTCGTATAGTCCAACAACTGCTGATTTCGGATCACCAAAAGCCTTA
TCAAGTAGCAGCCAGTCCATAAATGATGGAAGACAACCGACCAGTAGTAA
TTCCAGTCCTCAAAAACTATCACTAGCAATTGAACAACACTTATGTCCAA
ATAAAGAGGAACATGTGCTAGTTCCAGGGTCACATGGTCAATGCTTGTTG
TGGGCCTGTAAAGCTTGCAAAAAGAAAACGGTTCACGTTGATCGCCGCAA
AGCGGCAACAATGCGTGAAAGACGTCGATTGAGAAAAGTGAATGAAGCTT
TTGAAACATTGAAACGAAGAACGAGCGGTAACCCAAATCAAAGAATGCCA
AAAGTCGAAATTCTAAAGAACGCGATTGATTACATTGAGAGTTTGGAAGA
GTTGTTGAATTCCGTGGGAAAATTACCTGCAACCGTTGGAGAATTGAAAG
AACGCCGCAAAAACAACCCAGAAAATTCGAGAACAGCAATCGCCGGAAAA
CAAAAGCCACTAAATAAAATTAATGATAAACAGAAAGCTGAAAACAAATA
TCCCGAGACCATCTGCAAACTCCCGACGACTAGGAAATCCTATGTTGCTT
CCGACCTTGATCAGCAGATTTATCAATCAAACATGTTGAAGAGTTCAACT
CTTGATCAACTTTCCTCGATAGTAGACAAAATCTCTACGACTAATACAAC
AATTGCCGACCATTCAATGGACGCTAAGCCCGAAAATAGTTGAATACATA
ACAAAACGCAACAAATATTATATTAACCTATTAATTTTGTTCTAAACTCG
TTTGCCCTGATACATATTGTACATTTTCTTTCAATAGAATGTTCTTATAA
TTATAA
back to top

protein sequence of SMED30008639-orf-1

>SMED30008639-orf-1 ID=SMED30008639-orf-1|Name=SMED30008639-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=467bp
MIHSGSFPGSTCPINYDYSGPYSAGLEAAPFLVNQTCPYNTGTNTMPPSL
SLVDNMMMNNSMHLYDRLNTHHSASYFPQILNKIEQKLPTTSSKTTPSTL
VSTSSNSISNSEFNSSRSSSQFPTYDLISSLNNSNYDMYDSPYAAYLAAG
YYQSPGFALKQYDAAGTSQPSMTDLYHSSLAASSGLNLNYSQHKSRHLSE
DAGSCQDPQSQNITSNNHHNNSYSPTTADFGSPKALSSSSQSINDGRQPT
SSNSSPQKLSLAIEQHLCPNKEEHVLVPGSHGQCLLWACKACKKKTVHVD
RRKAATMRERRRLRKVNEAFETLKRRTSGNPNQRMPKVEILKNAIDYIES
LEELLNSVGKLPATVGELKERRKNNPENSRTAIAGKQKPLNKINDKQKAE
NKYPETICKLPTTRKSYVASDLDQQIYQSNMLKSSTLDQLSSIVDKISTT
NTTIADHSMDAKPENS*
back to top
Aliases
The feature 'MyoD-like protein' has the following synonyms
Synonym
myoD
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30008639
GenBankAAN03696.1