Phospholipase B-like

Overview
NamePhospholipase B-like
Smed IDSMED30008623
Length (bp)1912
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholipase B-like (SMED30008623) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholipase B-like (SMED30008623) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipase B-like (SMED30008623) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipase B-like (SMED30008623) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008623

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008623SMESG000003859.1 Contig980GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008623SMESG000022762.1 Contig980GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30008623SMESG000022762.1 dd_Smed_v4_485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008623SMESG000022762.1 dd_Smed_v4_485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30008623SMESG000022762.1 dd_Smed_v6_485_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipase B-like vs. Ensembl Human
Match: PLBD2 (phospholipase B domain containing 2 [Source:HGNC Symbol;Acc:HGNC:27283])

HSP 1 Score: 379.022 bits (972), Expect = 2.494e-123
Identity = 214/521 (41.07%), Postives = 292/521 (56.05%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIESII--VKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNG-VLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            +  A     I  TGWA L L TS  Y D LQAY +G++E  +++ LI  H  NT  +YC        +C+ LK +   N+E +   ++S     YW  +RL L Q+KGL+D+Y+      +         +   +  G  LLQ  GDL  L   L      ++   +  +G GSCSA IK + G  D+  AH TW+ Y  MLR+ K Y   +R      + P++PG  + FSSYP  I S DDFY+  +GLV+ ETTIGN N +LWK ++ +    VLE++R   ANRL+  G  W   F   NSGTYNNQWM+V+Y   K    G P P   VL + EQIPG++V  D T  L + +YWASYNIP F+ V+  SG   +  +YGD+F+ D  PRA IF+R+   V +  S+++LMRYNDF +DPL+ C  C P  +GEN IS+RSDLN  NG YPF AL  R HGG D+K TS  L++ +  +  S PT+DQ P F W  +    + H   P  W F P+
Sbjct:   84 VAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAG--------KFTIKPLGFLLLQLSGDLEDLELAL------NKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFR-EGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGC--VLEWVRNIVANRLASDGATWADIFKRFNSGTYNNQWMIVDY---KAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPV 584          
BLAST of Phospholipase B-like vs. Ensembl Human
Match: PLBD2 (phospholipase B domain containing 2 [Source:HGNC Symbol;Acc:HGNC:27283])

HSP 1 Score: 335.109 bits (858), Expect = 8.335e-107
Identity = 196/520 (37.69%), Postives = 271/520 (52.12%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIESII--VKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            +  A     I  TGWA L L TS  Y D LQAY +G++E  +++ LI  H  NT  +YC        +C+ LK +   N+E +   ++S     YW  +RL L Q+KGL+D+Y+      +         +   +  G  LLQ  GDL  L   L      ++   +  +G GSCSA IK + G  D+  AH TW+ Y  MLR+ K Y   +R      + P++PG  + FSSYP  I S DDFY+  +GLV+ ETTIGN N +LWK ++ +    VLE++R   ANRL+  G  W   F   NSGT                                  G++V  D T  L + +YWASYNIP F+ V+  SG   +  +YGD+F+ D  PRA IF+R+   V +  S+++LMRYNDF +DPL+ C  C P  +GEN IS+RSDLN  NG YPF AL  R HGG D+K TS  L++ +  +  S PT+DQ P F W  +    + H   P  W F P+
Sbjct:   84 VAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAG--------KFTIKPLGFLLLQLSGDLEDLELAL------NKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFR-EGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGC--VLEWVRNIVANRLASDGATWADIFKRFNSGT----------------------------------GMVVVADKTSELYQKTYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPV 552          
BLAST of Phospholipase B-like vs. Ensembl Human
Match: PLBD1 (phospholipase B domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26215])

HSP 1 Score: 214.542 bits (545), Expect = 3.396e-61
Identity = 172/521 (33.01%), Postives = 247/521 (47.41%), Query Frame = 3
Query:  306 INSTGWAHLSLT----SMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPST------FCKNLKQYFSTNIESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQ-PAFDW-RNNKDPSVKHNMHPIKWNF-----KPII 1811
            + +TGW  L +     S    +E+  + +G LEG +T P +  H +N YP   +KPS       F +   ++   NI+     S     +W+     + QI GL          + + I E         +F I  L + GDL  L   L  ++ +      K    G CSA IK + G  +I  AH +W  Y  MLRI K+++F       V +        +SFSSYP  + S+DDFY+ S+GL+  +TT   +N +L   LK      +L + RV+ AN ++ SG  W   FS +NSGTYNNQ+MV++   +K  +    +  G LY+ EQIP  + Y + TD LR  YW SYN+PF + +Y  SGY  + +K G  ++ D  PRA IF+RD   VT+  S+  +MRYN+++ DP +R +        N I  R DLN PN   P G          D K     L+       IS PT     P F W R NK     H   P  +NF     KPI+
Sbjct:   74 VKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTNLYPQLITKPSIMDKVQDFMEKQDKWTRKNIKEYKTDS-----FWRHTGYVMAQIDGLYVG------AKKRAILEGTKPM---TLFQIQFLNSVGDLLDLIPSLSPTK-NGSLKVFKRWDMGHCSALIKVLPGFENILFAHSSWYTYAAMLRIYKHWDF------NVIDKDTS-SSRLSFSSYPGFLESLDDFYILSSGLILLQTTNSVFNKTL---LKQVIPETLLSWQRVRVANMMADSGKRWADIFSKYNSGTYNNQYMVLD---LKKVKLNHSLDKGTLYIVEQIPTYVEYSEQTDVLRKGYWPSYNVPFHEKIYNWSGYPLLVQKLGLDYSYDLAPRAKIFRRDQGKVTDTASMKYIMRYNNYKKDPYSRGDPC------NTICCREDLNSPNPS-PGGCY--------DTKVADIYLASQYTSYAISGPTVQGGLPVFRWDRFNK---TLHQGMPEVYNFDFITMKPIL 548          
BLAST of Phospholipase B-like vs. Ensembl Celegans
Match: Y37D8A.2 (Putative phospholipase B-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XWV2])

HSP 1 Score: 362.073 bits (928), Expect = 2.066e-117
Identity = 212/526 (40.30%), Postives = 293/526 (55.70%), Query Frame = 3
Query:  267 SKSLITKATFIQQINSTGWAHLSL--TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESII--VKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVI-GDGSCSAFIKYV--KGDIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSP---TYDQQPAFDWRNNK-DPSVKHNMHPIKWNFKPI 1808
            +K L T A F  ++N TGWA L +   S   P  LQ Y +G  EG  T+ LI  HI NT   YC     FC  L ++   N++ +   ++   +  YW+ + L + Q+ GL   Y+N    +         +Q+   V  IF++Q  GDL  L+      E       +KV  G G CSA +K +    DI  +HVTWS Y  MLRI K Y+F              PGQ  SFSSYPA I+S DDF +TSA L   ETTIGNYN    K L     + VL ++R + A+R + SGL+W   F  HNSGTYNN+W+VV+Y      +   P   G+++V EQ+PG IV+ D T +L R +YW  YN P++K + + S    M +K+GD+++ DK PRALIFKRD +TVT+  S++ LMR N++  DPL++C+C PPYS EN I+ RSDLN  NG YPF +L +R HG  D+K T+S L  +++F  +S P        P FDW+ +     V H   P +WNF P+
Sbjct:   49 AKRLAT-AYFHDEVNQTGWAFLEVDVISPKIPHYLQGYAAGFAEGRATRHLIDLHIINTVNGYCDGAKHFCDELGEFMVDNLKWMEQEIRENPEDEYWQQVNLTVNQLFGLIHGYENQLGAEID------FKQIA--VHPIFMIQIAGDLEDLAMKFKKPE-----NPKKVFSGPGHCSALVKLLPKNEDILFSHVTWSSYGTMLRINKKYSF----------KTGDPGQIYSFSSYPASITSTDDFVLTSAKLAILETTIGNYNE---KSLDLITPNTVLTWIRAEIAHRTASSGLQWAEAFGRHNSGTYNNEWVVVDYKQFHRGKEVQP-ETGIIHVVEQMPGHIVHSDKTAHLFRETYWPGYNQPYYKQIIRFSDTDKMVEKFGDWYSYDKTPRALIFKRDHNTVTDMSSMIALMRSNNYTKDPLSKCDCNPPYSAENAIACRSDLNPLNGTYPFKSLGFRDHGAIDVKVTNSKLINSLQFTAVSGPPGGVTKDVPIFDWKTSPLREKVPHFGQPDRWNFAPV 546          
BLAST of Phospholipase B-like vs. Ensembl Celegans
Match: F09B12.3 (Putative phospholipase B-like 2 [Source:UniProtKB/Swiss-Prot;Acc:O62146])

HSP 1 Score: 331.257 bits (848), Expect = 2.191e-105
Identity = 196/531 (36.91%), Postives = 286/531 (53.86%), Query Frame = 3
Query:  246 RLVKGHGSKSLITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTN---IESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIP-NGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRN-NKDPSVKHNMHPIKWNFKPII 1811
            +++ G   ++ +  A +   +N+TGW  L + T  NY  +LQAY +G LEG+++K ++  H+ N   DYC   + +C  L  + + N   I+S +        YW  +     Q+ GL DAY+             +  ++  ++  I  L  +GD   L   L      +R  A +  G G CS  IK   G  D++ + VT S +  MLR+ K Y F Y   F        PG   SFSSYP ++ S DDF + ++GL   ETTI  +N SL++   TK    +  ++R   +N+L++   EW   +SL+NSGTYNNQW V++Y   K ++   P+P NG+ YV EQ+PG IVY DLT ++ + SY+ SYNIPFFK + +ISG+   A K GD+F     PRA IF+RD   V +  SL  LMRYND++ND  ++C C PPYS E GIS+R DLN  NG Y F    +  HG  D K T+  L K ++FV    PT+ + P+F W   +    V H  HP +W F  ++
Sbjct:   70 QVLDGFDCRNQVAVARWQNAVNTTGWTFLEVETKENYCPQLQAYSAGYLEGLLSKTVLTYHLKNAQEDYCKNFTGYCSRLSDFLTENQKWIQSSLETVAPDDLYWGAVNRTYHQVSGLIDAYEG----------REFKPRITYELHPILYLNLNGDFYDLEKKLN----KTRDPAFEQTG-GKCSGLIKVAPGNADLFISQVTMSGFQNMLRVIKLYKFGYDRQF-------YPGYASSFSSYPGLLYSSDDFALQTSGLAVIETTISVFNTSLFE--NTKPVGQLPTWIRAIVSNQLARDAREWCKLYSLYNSGTYNNQWAVLDYKKFKPNQ---PLPKNGLFYVLEQMPGKIVYSDLTWFVEKYSYFPSYNIPFFKEITEISGFIGQAAKMGDWFKWGASPRAKIFERDHGNVHDLDSLTALMRYNDYKNDEFSKCKCNPPYSAEAGISARGDLNPANGTYEFPGQGHVNHGALDYKGTNVELMKKLQFVAQGGPTWGKVPSFKWSEFDFKDKVNHVGHPDEWKFNTLV 573          
BLAST of Phospholipase B-like vs. Ensembl Celegans
Match: Y54F10AM.8 (Putative phospholipase B-like 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9BL07])

HSP 1 Score: 318.931 bits (816), Expect = 1.266e-100
Identity = 186/522 (35.63%), Postives = 282/522 (54.02%), Query Frame = 3
Query:  267 SKSLITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESIIVKSRYQGG-----YWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPN-GVLYVAEQIPGLIVYKDLTDYLRT-SYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTP-PYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNF 1799
            + S +    +  Q+N+TGW  L + T  ++  ++QAY +G+ EG +T+  I  H  NT    C+  + FCK L  Y   N++   ++S+ Q       +W+ + L   Q+ G+ DAY             N   ++   +  I+++Q  GD+  L+ +L  +     +        G CS F+K   G  D++ AHV+ S  + M R+ K Y F Y +N        +PG  ++FS YP ++ S DD+ +TSAGL S ETTI  +N +L+     K    V  ++R   +N LS++G +W   F  +NSGTYNNQW V+++      +    +P+  VL+++EQ PG    +D+T YL+  +Y+ASYNIPF   V +ISG+ + A+++  +F     PRA IF RD   VT+  SL KLMRYND+ ++  ARC CTP PY+GE GIS+R DLN P G Y   ++ +R H G D K T+  + K MRF     P YD  P FDW +    +V+H   P  WNF
Sbjct:   68 AASRVALGKYSNQVNTTGWGILEIETFASHSYDVQAYGAGVAEGELTRLQIYYHYRNTIETMCNNHTLFCKRLYIYLQQNLD--WMRSQVQANPPTDPFWRQVNLTFAQLTGIYDAYSK----------RNLTPEIGFDLHPIYMMQLAGDMFDLNKLLNKTADPMEYPE-----GGRCSGFVKLAPGNKDMFMAHVSMSSLSWMQRVLKIYKFGYDVN-------EVPGHIVTFSGYPGVLISTDDYTITSAGLTSIETTIAIFNQTLYTDKFMKPEGQVHCWIRSMISNLLSRTGKQWVDMFGRYNSGTYNNQWTVLDWKQFTPEK---ELPDKDVLWISEQTPGYYETRDMTWYLKKYTYFASYNIPFLPKVSEISGFDNKARQFA-WFDWGGSPRARIFDRDHSKVTDIDSLTKLMRYNDYTHEEFARCKCTPNPYTGEGGISARGDLNTPGGTYEVESMGFRDHAGLDFKGTNYEMFKKMRFRAWGGPPYDPLPVFDWNHTNLTNVRHFGQPDVWNF 561          
BLAST of Phospholipase B-like vs. Ensembl Fly
Match: lama (gene:FBgn0016031 transcript:FBtr0077159)

HSP 1 Score: 126.331 bits (316), Expect = 5.454e-30
Identity = 119/473 (25.16%), Postives = 193/473 (40.80%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPST---FCKNLKQYFSTNIESIIVKSRYQGG--YWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQ-ADGDLSALSSILGGSEYHSRFAARKVIGDG--------SCSAFIKYVKGD-------IYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSA---GLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVN----------YNLMKGHRFGMPIP------------------NGVLYVAEQIPGLIVYKDLTDYLRT---SYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLA 1529
            + +  +   +   GWA + + T   YPD +QAY +G+LEG +T   I    SNT    C +  +   FC  L+   +TN   +  ++       YW  + L + Q++GL+  Y         D+ E          F  FLL  A  D+  L       E  +     +  G          S +   K V+ +       +   H T   Y+ MLRI K Y F Y  + ++  S  +PG +I+F+ YP I+ S DDFY         +     I N N  LWK +  K   +V    RV  ANR+S++   W +  S H   T   QW+ V+          YN+++G       P                    ++++AEQ+PG++  KD+T        + W +  +P+FKNV ++SG             ++      +   D   +T+  S+ K +R + F+ D L 
Sbjct:   74 VGRICYKDSVYENGWAQIEVETQRTYPDWVQAYAAGMLEGSLTWRNIYNQWSNTISSSCERDESTQKFCGWLRDLLTTNYHRLKRQTEKAENDHYWHQLHLFITQLEGLETGYKRGASRARSDLEEEI-------PFSDFLLMNAAADIQDLKIYYENYELQNSTEHTEEPGTDQPKNFFLPSATMLTKIVQEEESPQVLQLLFGHSTAGSYSSMLRIQKRYKFHYHFSSKL-RSNTVPGVDITFTGYPGILGSTDDFYTIKGRHLHAIVGGVGIKNENLQLWKTVDPK--KMVPLVARVMAANRISQNRQTWASAMSRH-PFTGAKQWITVDLNKMKVQDNLYNVLEGDDKHDDAPVVLNEKDRTAIQQRHDQLRDMVWIAEQLPGMMTKKDVTQGFLVPGNTSWLANGVPYFKNVLELSG-------------VNYSEDQQLTVADEEELTSLASVDKYLRTHGFRGDLLG 522          
BLAST of Phospholipase B-like vs. Ensembl Fly
Match: lama (gene:FBgn0016031 transcript:FBtr0333595)

HSP 1 Score: 126.331 bits (316), Expect = 5.454e-30
Identity = 119/473 (25.16%), Postives = 193/473 (40.80%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPST---FCKNLKQYFSTNIESIIVKSRYQGG--YWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQ-ADGDLSALSSILGGSEYHSRFAARKVIGDG--------SCSAFIKYVKGD-------IYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSA---GLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVN----------YNLMKGHRFGMPIP------------------NGVLYVAEQIPGLIVYKDLTDYLRT---SYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLA 1529
            + +  +   +   GWA + + T   YPD +QAY +G+LEG +T   I    SNT    C +  +   FC  L+   +TN   +  ++       YW  + L + Q++GL+  Y         D+ E          F  FLL  A  D+  L       E  +     +  G          S +   K V+ +       +   H T   Y+ MLRI K Y F Y  + ++  S  +PG +I+F+ YP I+ S DDFY         +     I N N  LWK +  K   +V    RV  ANR+S++   W +  S H   T   QW+ V+          YN+++G       P                    ++++AEQ+PG++  KD+T        + W +  +P+FKNV ++SG             ++      +   D   +T+  S+ K +R + F+ D L 
Sbjct:   74 VGRICYKDSVYENGWAQIEVETQRTYPDWVQAYAAGMLEGSLTWRNIYNQWSNTISSSCERDESTQKFCGWLRDLLTTNYHRLKRQTEKAENDHYWHQLHLFITQLEGLETGYKRGASRARSDLEEEI-------PFSDFLLMNAAADIQDLKIYYENYELQNSTEHTEEPGTDQPKNFFLPSATMLTKIVQEEESPQVLQLLFGHSTAGSYSSMLRIQKRYKFHYHFSSKL-RSNTVPGVDITFTGYPGILGSTDDFYTIKGRHLHAIVGGVGIKNENLQLWKTVDPK--KMVPLVARVMAANRISQNRQTWASAMSRH-PFTGAKQWITVDLNKMKVQDNLYNVLEGDDKHDDAPVVLNEKDRTAIQQRHDQLRDMVWIAEQLPGMMTKKDVTQGFLVPGNTSWLANGVPYFKNVLELSG-------------VNYSEDQQLTVADEEELTSLASVDKYLRTHGFRGDLLG 522          
BLAST of Phospholipase B-like vs. Ensembl Fly
Match: lama (gene:FBgn0016031 transcript:FBtr0077160)

HSP 1 Score: 126.331 bits (316), Expect = 5.454e-30
Identity = 119/473 (25.16%), Postives = 193/473 (40.80%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPST---FCKNLKQYFSTNIESIIVKSRYQGG--YWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQ-ADGDLSALSSILGGSEYHSRFAARKVIGDG--------SCSAFIKYVKGD-------IYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSA---GLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVN----------YNLMKGHRFGMPIP------------------NGVLYVAEQIPGLIVYKDLTDYLRT---SYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLA 1529
            + +  +   +   GWA + + T   YPD +QAY +G+LEG +T   I    SNT    C +  +   FC  L+   +TN   +  ++       YW  + L + Q++GL+  Y         D+ E          F  FLL  A  D+  L       E  +     +  G          S +   K V+ +       +   H T   Y+ MLRI K Y F Y  + ++  S  +PG +I+F+ YP I+ S DDFY         +     I N N  LWK +  K   +V    RV  ANR+S++   W +  S H   T   QW+ V+          YN+++G       P                    ++++AEQ+PG++  KD+T        + W +  +P+FKNV ++SG             ++      +   D   +T+  S+ K +R + F+ D L 
Sbjct:   74 VGRICYKDSVYENGWAQIEVETQRTYPDWVQAYAAGMLEGSLTWRNIYNQWSNTISSSCERDESTQKFCGWLRDLLTTNYHRLKRQTEKAENDHYWHQLHLFITQLEGLETGYKRGASRARSDLEEEI-------PFSDFLLMNAAADIQDLKIYYENYELQNSTEHTEEPGTDQPKNFFLPSATMLTKIVQEEESPQVLQLLFGHSTAGSYSSMLRIQKRYKFHYHFSSKL-RSNTVPGVDITFTGYPGILGSTDDFYTIKGRHLHAIVGGVGIKNENLQLWKTVDPK--KMVPLVARVMAANRISQNRQTWASAMSRH-PFTGAKQWITVDLNKMKVQDNLYNVLEGDDKHDDAPVVLNEKDRTAIQQRHDQLRDMVWIAEQLPGMMTKKDVTQGFLVPGNTSWLANGVPYFKNVLELSG-------------VNYSEDQQLTVADEEELTSLASVDKYLRTHGFRGDLLG 522          
BLAST of Phospholipase B-like vs. Ensembl Fly
Match: lama (gene:FBgn0016031 transcript:FBtr0077161)

HSP 1 Score: 126.331 bits (316), Expect = 5.454e-30
Identity = 119/473 (25.16%), Postives = 193/473 (40.80%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPST---FCKNLKQYFSTNIESIIVKSRYQGG--YWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQ-ADGDLSALSSILGGSEYHSRFAARKVIGDG--------SCSAFIKYVKGD-------IYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSA---GLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVN----------YNLMKGHRFGMPIP------------------NGVLYVAEQIPGLIVYKDLTDYLRT---SYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLA 1529
            + +  +   +   GWA + + T   YPD +QAY +G+LEG +T   I    SNT    C +  +   FC  L+   +TN   +  ++       YW  + L + Q++GL+  Y         D+ E          F  FLL  A  D+  L       E  +     +  G          S +   K V+ +       +   H T   Y+ MLRI K Y F Y  + ++  S  +PG +I+F+ YP I+ S DDFY         +     I N N  LWK +  K   +V    RV  ANR+S++   W +  S H   T   QW+ V+          YN+++G       P                    ++++AEQ+PG++  KD+T        + W +  +P+FKNV ++SG             ++      +   D   +T+  S+ K +R + F+ D L 
Sbjct:   74 VGRICYKDSVYENGWAQIEVETQRTYPDWVQAYAAGMLEGSLTWRNIYNQWSNTISSSCERDESTQKFCGWLRDLLTTNYHRLKRQTEKAENDHYWHQLHLFITQLEGLETGYKRGASRARSDLEEEI-------PFSDFLLMNAAADIQDLKIYYENYELQNSTEHTEEPGTDQPKNFFLPSATMLTKIVQEEESPQVLQLLFGHSTAGSYSSMLRIQKRYKFHYHFSSKL-RSNTVPGVDITFTGYPGILGSTDDFYTIKGRHLHAIVGGVGIKNENLQLWKTVDPK--KMVPLVARVMAANRISQNRQTWASAMSRH-PFTGAKQWITVDLNKMKVQDNLYNVLEGDDKHDDAPVVLNEKDRTAIQQRHDQLRDMVWIAEQLPGMMTKKDVTQGFLVPGNTSWLANGVPYFKNVLELSG-------------VNYSEDQQLTVADEEELTSLASVDKYLRTHGFRGDLLG 522          
BLAST of Phospholipase B-like vs. Ensembl Zebrafish
Match: PLBD2 (zgc:158619 [Source:ZFIN;Acc:ZDB-GENE-070209-116])

HSP 1 Score: 405.601 bits (1041), Expect = 2.655e-134
Identity = 227/531 (42.75%), Postives = 310/531 (58.38%), Query Frame = 3
Query:  249 LVKGHGSKSLITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPST---FCKNLKQYFSTNIESII--VKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNY-NLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLT-DYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARC-NCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            L++G  + S + +A F   IN+TGWA+L L TS  Y D LQAY +G++EG  T  L+  H  NT   YC   S+   FC+ LK Y STN++ +   +++     YW  +RL L Q+KGL+D Y+      S   + N         FG  L Q  GDL  L + L  S      +  + +G GSCSA IK + G  D+  +H TW+ Y  MLRI K Y+  YR +       +IPG    FSSYP  I S DDFY+ S+GLV+ ETTIGN NA+LWK ++ + +  V+E+LR   ANRL+  G  W   FS +NSGTYNNQWMVV+Y N + G         G+  V EQIPG+I   D T +  +T YWASYNIP+F+ V+  SG  ++ +KYG +F+  + PRA IF+R+   VT+  S+ +LMRYN++  DPL+RC  C P  + EN IS+RSDLN  NG YPFGAL  R HGGTD+K TSS + +    +  S P+ +Q P F W  +   S+ H   P +W+F  +
Sbjct:   36 LIEGARTHS-VAEANFTDHINTTGWAYLDLSTSAGYNDSLQAYAAGLVEGAATSQLLYKHWMNTLMGYCGPFSSDVGFCERLKDYISTNLQWMWQQMETHTHSPYWHQVRLSLLQLKGLEDGYNGRIDFPSGSFSIN--------PFGFLLFQMGGDLEDLEAALNKS------SQSRSVGSGSCSALIKLLPGHKDLLVSHDTWNNYQSMLRIMKRYSLSYRTS--PTEQDVIPGATQVFSSYPGSIFSGDDFYLISSGLVTLETTIGNSNAALWKFVQPRGS--VMEWLRNIVANRLAGDGQSWAQIFSRYNSGTYNNQWMVVDYKNFVPGQAVA---KQGLFTVLEQIPGMIKTADKTAELFQTGYWASYNIPYFEEVFNASGGQELVQKYGSWFSFSQNPRAQIFRRNQTQVTDLQSMERLMRYNNYLEDPLSRCEECDPHQNAENSISARSDLNPANGSYPFGALQQRPHGGTDMKMTSSSMFRQWELLAASGPSCEQTPVFQWSRSPYSSLMHMGQPDRWDFPTV 544          
BLAST of Phospholipase B-like vs. Ensembl Zebrafish
Match: plbd1 (phospholipase B domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050411-22])

HSP 1 Score: 248.44 bits (633), Expect = 3.886e-74
Identity = 177/509 (34.77%), Postives = 262/509 (51.47%), Query Frame = 3
Query:  312 STGWAHLSLTS----MNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIE--SIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSIL--GGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTY--DQQPAFDWRNNKDPSVKHNMHPIKWNF 1799
            STGW  L + +        D++  + +G LEG +T P I  H +N YP     P T    +K++ +   E   + VK       W    L L Q+ GLQ A  N W  Q        L Q   Q      L A GDL  L   L  G S    R+     I  G CSA IK + G  ++  AH +W  Y   +RI K+++F  R+       P      +SFSSYP  + S+DDFY+  +GL+ T+TT   +N SL+  +   +   +  + RV+ AN L+++G +W  TFS +NSGTYNNQ+M+V+ + +     G+ + +G L V EQIPGL+ + D T  LR  YW SYN+PF + +Y++SGY +M +KYG+ F+ D  PRA IF+RD   VT+  SL  +MRYN++++DP ++ N C         I  R+DL + +G  P G    ++   TD++   S +++A     I+ PT      PAF W +    S  H   P ++NF
Sbjct:   59 STGWGVLEVRAGYGDTTQTDDITMFTAGYLEGFLTAPQIFDHYTNMYPQIIQSPKTLIA-VKRFMAKQDEWSRLQVKRNTTDPLWIHTGLILAQLDGLQ-AGVNQWAKQH---GRKPLSQFAAQ-----FLNAVGDLLDLIPALSPGESTVRHRYPD---IPMGHCSALIKMLPGFENLLFAHSSWYTYAATMRIYKHWDF--RLT-----EPHTATGKLSFSSYPGFLVSLDDFYLLGSGLMMTQTTNNVFNMSLFSSVTPAS---LFAWQRVRLANTLARTGAQWANTFSRYNSGTYNNQYMIVDSSKVN---LGVSVDDGALTVVEQIPGLVEFSDQTQTLRRGYWPSYNVPFHRRIYELSGYDEMWRKYGEDFSYDLCPRAKIFRRDQSAVTDMSSLKHIMRYNEYKSDPYSQGNPC-------KSICCRNDLLE-HGASPGGCYDTKV---TDVRLARSFMAEA-----INGPTTAGGDLPAFSWTDFN--STTHTGLPERYNF 523          
BLAST of Phospholipase B-like vs. Ensembl Zebrafish
Match: si:ch73-139e5.2 (si:ch73-139e5.2 [Source:ZFIN;Acc:ZDB-GENE-130531-47])

HSP 1 Score: 223.016 bits (567), Expect = 6.715e-65
Identity = 154/457 (33.70%), Postives = 226/457 (49.45%), Query Frame = 3
Query:  294 FIQQINSTGWAHLSLTS----MNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESIIVKSRYQGG---YWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRL 1637
            F   ++ +GW  L + +        DE+  + +G LEG +T   +  H  N YP    K  +  K LK + S        + +  G     W  + L + Q+ GL    +   K++ K             +F + LL   GDL  L  +L      SR + R + G   CSA IK + G  ++   H +W  Y   +RI K++N   + N           + +SFSSYP  +SS+DDFY+   G   T+TT   +N SL+  +  KA   +L + RV+ A+ L+ +G +W   F+ HNSGTYN+Q+MVV+   +K    G  I +  L V EQIPGL+VY D +  LR  YWASYNIPF  ++YQ SGY  M KK+G  F+ D  PRA IF+RD   VT+  +L  +MRYND++ DP ++ +        N +  R     P G Y      YR+
Sbjct:   32 FNDSLSVSGWGVLEVQAGYGESQENDEVTYFLAGYLEGYLTASQMINHYFNMYPQII-KDRSVLKPLKCFMSEQNSWTRAQVKLNGKSDPLWHHVGLLVAQMDGLHAGAEFWAKSRQKK---------PLSMFAVQLLNGIGDLLDLIPVLKRHSNSSRDSFR-MPGMSHCSALIKMLPGYENLLLGHSSWYTYAASMRIYKHWNLKRKCN---------GIRRLSFSSYPGTLSSLDDFYLLGTGFFVTQTTNNVFNTSLFSLVTPKA---LLAWQRVRAAHSLACTGKQWAQIFAKHNSGTYNSQYMVVD---LKRISLGRQIEDWSLTVVEQIPGLVVYSDQSQALRQGYWASYNIPFHSDIYQASGYGVMWKKHGQDFSYDLSPRAKIFRRDQGKVTSLETLKDIMRYNDYRKDPYSKKHPCKSICCRNDLRLRRP--HPGGCYDTKVADYRM 460          
BLAST of Phospholipase B-like vs. Ensembl Zebrafish
Match: CR354584.1 (si:ch73-139e5.2 [Source:NCBI gene;Acc:792904])

HSP 1 Score: 221.09 bits (562), Expect = 1.463e-63
Identity = 170/532 (31.95%), Postives = 252/532 (47.37%), Query Frame = 3
Query:  294 FIQQINSTGWAHLSLTS----MNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESIIVKSRYQGG---YWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPT-YDQQPAFDW-RNNKDPSVKHNMHPIKWNF-----KPIITPFP*NLKQE 1841
            F   ++ +GW  L + +        DE+  + +G LEG +T   +  H  N YP    K  +  K LK + S        + +  G     W  + L + Q+ GL    +   K++ K             +F + LL   GDL  L  +L      S+ + R + G   CSA IK + G  ++   H +W  Y   +RI K++N   + N           + +SFSSYP  +SS+DDFY+   G   T+TT   +N SL+  +  KA   +L + RV+ A+ L+ +G +W   FS HNSGTYN+Q+MVV+   +K    G  I +  L V EQIPGL+V+ D +  LR  YWASYNIPF  ++YQ SGY  M KK+G  F+ D  PRA IF+RD   VT+  +L  +MRYND++ D         PYS ++   S    ND   + P     Y      D K     +++      ++ PT  +  P F W R N+     H   P  +NF     +P++  F    K E
Sbjct:   57 FNDSLSVSGWGVLEVQAGYGESQENDEVTYFLAGYLEGYLTASQMINHYFNMYPQII-KDRSVLKPLKCFMSEQNSWTRAQVKLNGKSDPLWHHVGLLVAQMDGLHAGAEFWAKSRQKK---------PLSMFAVQLLNGIGDLLDLIPVLKRHSNSSQDSFR-MPGMSHCSALIKMLPGYENLLLGHSSWYTYAASMRIYKHWNLKRKCN---------GIRRLSFSSYPGTLSSMDDFYLLGTGFFVTQTTNNVFNTSLFSLVTPKA---LLAWQRVRAAHSLACTGKQWAQIFSKHNSGTYNSQYMVVD---LKRISLGRQIEDWSLTVVEQIPGLVVFSDQSQALRQGYWASYNIPFHSDIYQASGYGVMWKKHGQDFSYDLSPRAKIFRRDQGKVTSLETLKDIMRYNDYRKD---------PYSKKHPCKSICCRNDLRLRRPHPGGCY------DTKVADYRMAQMFTAEAVNGPTSQNGLPLFSWSRFNR---TAHQGLPQTYNFTFITMQPLLFAFRDQAKTE 544          
BLAST of Phospholipase B-like vs. Ensembl Zebrafish
Match: CR354584.1 (si:ch73-139e5.2 [Source:NCBI gene;Acc:792904])

HSP 1 Score: 221.09 bits (562), Expect = 1.478e-63
Identity = 170/532 (31.95%), Postives = 252/532 (47.37%), Query Frame = 3
Query:  294 FIQQINSTGWAHLSLTS----MNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESIIVKSRYQGG---YWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPT-YDQQPAFDW-RNNKDPSVKHNMHPIKWNF-----KPIITPFP*NLKQE 1841
            F   ++ +GW  L + +        DE+  + +G LEG +T   +  H  N YP    K  +  K LK + S        + +  G     W  + L + Q+ GL    +   K++ K             +F + LL   GDL  L  +L      S+ + R + G   CSA IK + G  ++   H +W  Y   +RI K++N   + N           + +SFSSYP  +SS+DDFY+   G   T+TT   +N SL+  +  KA   +L + RV+ A+ L+ +G +W   FS HNSGTYN+Q+MVV+   +K    G  I +  L V EQIPGL+V+ D +  LR  YWASYNIPF  ++YQ SGY  M KK+G  F+ D  PRA IF+RD   VT+  +L  +MRYND++ D         PYS ++   S    ND   + P     Y      D K     +++      ++ PT  +  P F W R N+     H   P  +NF     +P++  F    K E
Sbjct:   54 FNDSLSVSGWGVLEVQAGYGESQENDEVTYFLAGYLEGYLTASQMINHYFNMYPQII-KDRSVLKPLKCFMSEQNSWTRAQVKLNGKSDPLWHHVGLLVAQMDGLHAGAEFWAKSRQKK---------PLSMFAVQLLNGIGDLLDLIPVLKRHSNSSQDSFR-MPGMSHCSALIKMLPGYENLLLGHSSWYTYAASMRIYKHWNLKRKCN---------GIRRLSFSSYPGTLSSMDDFYLLGTGFFVTQTTNNVFNTSLFSLVTPKA---LLAWQRVRAAHSLACTGKQWAQIFSKHNSGTYNSQYMVVD---LKRISLGRQIEDWSLTVVEQIPGLVVFSDQSQALRQGYWASYNIPFHSDIYQASGYGVMWKKHGQDFSYDLSPRAKIFRRDQGKVTSLETLKDIMRYNDYRKD---------PYSKKHPCKSICCRNDLRLRRPHPGGCY------DTKVADYRMAQMFTAEAVNGPTSQNGLPLFSWSRFNR---TAHQGLPQTYNFTFITMQPLLFAFRDQAKTE 541          
BLAST of Phospholipase B-like vs. Ensembl Xenopus
Match: ccnl2 (cyclin L2 [Source:Xenbase;Acc:XB-GENE-956522])

HSP 1 Score: 405.986 bits (1042), Expect = 2.594e-134
Identity = 233/558 (41.76%), Postives = 323/558 (57.89%), Query Frame = 3
Query:  168 IYFVNPTDGAQEMSIEAVKNGTGYSFRLVKGHGSKSLITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNI---ESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            I+ +     AQ+  +  + +    +   V+       +  A     I   GWA L + T+  + D +QAY +G+ E  +T+ LI  H  NT   YC      +TFC+ L+ Y   N+   +  + K + Q  YW  I L L Q+KGL+D+Y           + N         FG  L Q  GDL  L   L  SE       ++V+G GSCSA +K + G  D++ +H TW+ Y  MLRI K Y FP+++       P++PG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N +LWK +K + +  V+E+LR   ANRL+  G EW + F   NSGTYNNQWM+V+YN  K +     +PNG+L + EQIPG++   D +D L +T YWASYN+P+F+ V+  SG   + +K+GD+FT DK PRALIF+RD   V +  S++KLMRYNDF +DPL+RC+ C PP +GEN IS+RSDLN  NG YPFGA+  R HGGTD+K TS  ++K    V ++ PT+DQ P F W  +   S+ H  HP  W F PI
Sbjct:    9 IFMLFSLGAAQQAVVSVLFDPATGNITTVEEKRVVGAVAWAELKDSILENGWAVLEVQTNGTFNDSIQAYAAGVAEAAVTQRLIFMHWMNTMMGYCGPYKYQATFCEKLRGYLEANLAWMQDEMEKGQDQE-YWHQIHLALLQLKGLEDSYSGRISFPQGKFHLN--------PFGFLLFQIGGDLEDLEPALNKSE------PKRVLGSGSCSALVKLLPGNKDLFVSHDTWNTYQSMLRIIKKYTFPFQMT--QNGGPVVPGWVQTFSSYPGTIFSGDDFYLLSSGLVTLETTIGNSNDALWKYIKPQDS--VMEWLRNIAANRLATGGQEWASIFKKFNSGTYNNQWMIVDYN--KFNIGQTDVPNGLLTILEQIPGMVAVADKSDVLYKTGYWASYNVPYFQEVFNASGLPALVEKFGDWFTYDKTPRALIFQRDHSKVKDMESMVKLMRYNDFLHDPLSRCSSCNPPENGENAISARSDLNTVNGTYPFGAMRQRQHGGTDMKLTSYEMAKKYEMVVVNGPTWDQVPPFQWSTSPFSSLMHMGHPDLWKFSPI 545          
BLAST of Phospholipase B-like vs. Ensembl Xenopus
Match: ccnl2 (cyclin L2 [Source:Xenbase;Acc:XB-GENE-956522])

HSP 1 Score: 395.971 bits (1016), Expect = 2.003e-131
Identity = 216/478 (45.19%), Postives = 289/478 (60.46%), Query Frame = 3
Query:  405 KPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNI---ESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            K LI  H  NT   YC      +TFC+ L+ Y   N+   +  + K + Q  YW  I L L Q+KGL+D+Y           + N         FG  L Q  GDL  L   L  SE       ++V+G GSCSA +K + G  D++ +H TW+ Y  MLRI K Y FP+++       P++PG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N +LWK +K + +  V+E+LR   ANRL+  G EW + F   NSGTYNNQWM+V+YN  K +     +PNG+L + EQIPG++   D +D L +T YWASYN+P+F+ V+  SG   + +K+GD+FT DK PRALIF+RD   V +  S++KLMRYNDF +DPL+RC+ C PP +GEN IS+RSDLN  NG YPFGA+  R HGGTD+K TS  ++K    V ++ PT+DQ P F W  +   S+ H  HP  W F PI
Sbjct:   17 KKLIFMHWMNTMMGYCGPYKYQATFCEKLRGYLEANLAWMQDEMEKGQDQE-YWHQIHLALLQLKGLEDSYSGRISFPQGKFHLN--------PFGFLLFQIGGDLEDLEPALNKSE------PKRVLGSGSCSALVKLLPGNKDLFVSHDTWNTYQSMLRIIKKYTFPFQMT--QNGGPVVPGWVQTFSSYPGTIFSGDDFYLLSSGLVTLETTIGNSNDALWKYIKPQDS--VMEWLRNIAANRLATGGQEWASIFKKFNSGTYNNQWMIVDYN--KFNIGQTDVPNGLLTILEQIPGMVAVADKSDVLYKTGYWASYNVPYFQEVFNASGLPALVEKFGDWFTYDKTPRALIFQRDHSKVKDMESMVKLMRYNDFLHDPLSRCSSCNPPENGENAISARSDLNTVNGTYPFGAMRQRQHGGTDMKLTSYEMAKKYEMVVVNGPTWDQVPPFQWSTSPFSSLMHMGHPDLWKFSPI 473          
BLAST of Phospholipase B-like vs. Ensembl Xenopus
Match: ccnl2 (cyclin L2 [Source:Xenbase;Acc:XB-GENE-956522])

HSP 1 Score: 394.43 bits (1012), Expect = 1.247e-130
Identity = 215/476 (45.17%), Postives = 288/476 (60.50%), Query Frame = 3
Query:  411 LIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNI---ESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            LI  H  NT   YC      +TFC+ L+ Y   N+   +  + K + Q  YW  I L L Q+KGL+D+Y           + N         FG  L Q  GDL  L   L  SE       ++V+G GSCSA +K + G  D++ +H TW+ Y  MLRI K Y FP+++       P++PG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N +LWK +K + +  V+E+LR   ANRL+  G EW + F   NSGTYNNQWM+V+YN  K +     +PNG+L + EQIPG++   D +D L +T YWASYN+P+F+ V+  SG   + +K+GD+FT DK PRALIF+RD   V +  S++KLMRYNDF +DPL+RC+ C PP +GEN IS+RSDLN  NG YPFGA+  R HGGTD+K TS  ++K    V ++ PT+DQ P F W  +   S+ H  HP  W F PI
Sbjct:   36 LIFMHWMNTMMGYCGPYKYQATFCEKLRGYLEANLAWMQDEMEKGQDQE-YWHQIHLALLQLKGLEDSYSGRISFPQGKFHLN--------PFGFLLFQIGGDLEDLEPALNKSE------PKRVLGSGSCSALVKLLPGNKDLFVSHDTWNTYQSMLRIIKKYTFPFQMT--QNGGPVVPGWVQTFSSYPGTIFSGDDFYLLSSGLVTLETTIGNSNDALWKYIKPQDS--VMEWLRNIAANRLATGGQEWASIFKKFNSGTYNNQWMIVDYN--KFNIGQTDVPNGLLTILEQIPGMVAVADKSDVLYKTGYWASYNVPYFQEVFNASGLPALVEKFGDWFTYDKTPRALIFQRDHSKVKDMESMVKLMRYNDFLHDPLSRCSSCNPPENGENAISARSDLNTVNGTYPFGAMRQRQHGGTDMKLTSYEMAKKYEMVVVNGPTWDQVPPFQWSTSPFSSLMHMGHPDLWKFSPI 490          
BLAST of Phospholipase B-like vs. Ensembl Xenopus
Match: ccnl2 (cyclin L2 [Source:Xenbase;Acc:XB-GENE-956522])

HSP 1 Score: 392.504 bits (1007), Expect = 8.648e-130
Identity = 213/472 (45.13%), Postives = 286/472 (60.59%), Query Frame = 3
Query:  423 HISNTYPDYCSK---PSTFCKNLKQYFSTNI---ESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            H  NT   YC      +TFC+ L+ Y   N+   +  + K + Q  YW  I L L Q+KGL+D+Y           + N         FG  L Q  GDL  L   L  SE       ++V+G GSCSA +K + G  D++ +H TW+ Y  MLRI K Y FP+++       P++PG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N +LWK +K + +  V+E+LR   ANRL+  G EW + F   NSGTYNNQWM+V+YN  K +     +PNG+L + EQIPG++   D +D L +T YWASYN+P+F+ V+  SG   + +K+GD+FT DK PRALIF+RD   V +  S++KLMRYNDF +DPL+RC+ C PP +GEN IS+RSDLN  NG YPFGA+  R HGGTD+K TS  ++K    V ++ PT+DQ P F W  +   S+ H  HP  W F PI
Sbjct:   30 HWMNTMMGYCGPYKYQATFCEKLRGYLEANLAWMQDEMEKGQDQE-YWHQIHLALLQLKGLEDSYSGRISFPQGKFHLN--------PFGFLLFQIGGDLEDLEPALNKSE------PKRVLGSGSCSALVKLLPGNKDLFVSHDTWNTYQSMLRIIKKYTFPFQMT--QNGGPVVPGWVQTFSSYPGTIFSGDDFYLLSSGLVTLETTIGNSNDALWKYIKPQDS--VMEWLRNIAANRLATGGQEWASIFKKFNSGTYNNQWMIVDYN--KFNIGQTDVPNGLLTILEQIPGMVAVADKSDVLYKTGYWASYNVPYFQEVFNASGLPALVEKFGDWFTYDKTPRALIFQRDHSKVKDMESMVKLMRYNDFLHDPLSRCSSCNPPENGENAISARSDLNTVNGTYPFGAMRQRQHGGTDMKLTSYEMAKKYEMVVVNGPTWDQVPPFQWSTSPFSSLMHMGHPDLWKFSPI 480          
BLAST of Phospholipase B-like vs. Ensembl Xenopus
Match: ccnl2 (cyclin L2 [Source:Xenbase;Acc:XB-GENE-956522])

HSP 1 Score: 389.037 bits (998), Expect = 6.588e-129
Identity = 208/456 (45.61%), Postives = 281/456 (61.62%), Query Frame = 3
Query:  462 STFCKNLKQYFSTNI---ESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            +TFC+ L+ Y   N+   +  + K + Q  YW  I L L Q+KGL+D+Y           + N         FG  L Q  GDL  L   L  SE       ++V+G GSCSA +K + G  D++ +H TW+ Y  MLRI K Y FP+++       P++PG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N +LWK +K + +  V+E+LR   ANRL+  G EW + F   NSGTYNNQWM+V+YN  K +     +PNG+L + EQIPG++   D +D L +T YWASYN+P+F+ V+  SG   + +K+GD+FT DK PRALIF+RD   V +  S++KLMRYNDF +DPL+RC+ C PP +GEN IS+RSDLN  NG YPFGA+  R HGGTD+K TS  ++K    V ++ PT+DQ P F W  +   S+ H  HP  W F PI
Sbjct:   30 TTFCEKLRGYLEANLAWMQDEMEKGQDQE-YWHQIHLALLQLKGLEDSYSGRISFPQGKFHLN--------PFGFLLFQIGGDLEDLEPALNKSE------PKRVLGSGSCSALVKLLPGNKDLFVSHDTWNTYQSMLRIIKKYTFPFQMT--QNGGPVVPGWVQTFSSYPGTIFSGDDFYLLSSGLVTLETTIGNSNDALWKYIKPQDS--VMEWLRNIAANRLATGGQEWASIFKKFNSGTYNNQWMIVDYN--KFNIGQTDVPNGLLTILEQIPGMVAVADKSDVLYKTGYWASYNVPYFQEVFNASGLPALVEKFGDWFTYDKTPRALIFQRDHSKVKDMESMVKLMRYNDFLHDPLSRCSSCNPPENGENAISARSDLNTVNGTYPFGAMRQRQHGGTDMKLTSYEMAKKYEMVVVNGPTWDQVPPFQWSTSPFSSLMHMGHPDLWKFSPI 464          
BLAST of Phospholipase B-like vs. Ensembl Mouse
Match: Plbd2 (phospholipase B domain containing 2 [Source:MGI Symbol;Acc:MGI:1919022])

HSP 1 Score: 381.333 bits (978), Expect = 2.875e-124
Identity = 217/530 (40.94%), Postives = 295/530 (55.66%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIESIIVKSRY--QGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNG------VLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPIITPF 1820
            +  A     I  TGWA+L L T+  Y D LQAY +G++E  +++ LI  H  NT  +YC        +C+ LK +   N+E +  +        YW  +RL L Q+KGL+D+Y+      +         +   +  G  LLQ  GDL  L   L      ++   +  +G GSCSA IK + G  D+  AH TW+ Y  MLRI K Y   +R   +    P++ G N+ FSSYP  I S DDFY+  +GLV+ ETTIGN N +LWK ++ +    VLE++R   ANRL+  G  W   F   NSGTYNNQWM+V+Y           +PNG      VL + EQIPG++V  D T  L +T+YWASYNIP+F+ V+  SG   +  +YGD+F+  K PRA IF+RD   V +  ++++LMRYNDF +DPL+ C  C P  + EN IS+RSDLN  NG YPF AL  R HGG D+K TS  L+K M  +  S PT+DQ P F W  +   S+ H   P  W F PI  P+
Sbjct:   89 VAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTG--------RFTIKPLGFLLLQISGDLEDLEPAL------NKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQ-EEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGC--VLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAF--------LPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPW 593          
BLAST of Phospholipase B-like vs. Ensembl Mouse
Match: Plbd1 (phospholipase B domain containing 1 [Source:MGI Symbol;Acc:MGI:1914107])

HSP 1 Score: 234.572 bits (597), Expect = 8.895e-69
Identity = 172/520 (33.08%), Postives = 254/520 (48.85%), Query Frame = 3
Query:  306 INSTGWAHLSLT----SMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPST------FCKNLKQYFSTNIESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTY-DQQPAFDWRNNKDPSVKHNMHPIKWNF---KPIIT 1814
            I +TGW  L +     S    +E+  + +G LEG +T   +  H +N YP     PS       F +  + +   NI     K++    +W+     + Q+ GL       +    K  +E  ++ +   +F I  L A GDL  L   L  ++  S     K+   G CSA IK + G  +IY AH +W  Y  MLRI K+++F  +  + ++       + +SFSSYP  + S+DDFY+ S+GL+  +TT   YN +L   LK      +L + RV+ AN +++ G EW   FS HNSGTYNNQ+MV++   +K       +  G LY+ EQIP  + Y D T+ LR  YWASYNIPF K +Y  SGY  +  K G  ++ D  PRA IF+RD   VT+  S+  +MRYN+++ DP ++ + C+        I  R DL   NG  P     Y      D K     L+   +   IS PT  D  P F+W    D   +       +NF   KPI++
Sbjct:   75 IKTTGWGILEIRAGYGSQVLSNEIIMFLAGYLEGYLTALHMYDHFTNLYPQLFKNPSIVKKVQDFMEKQEMWTRQNI-----KAQKDDPFWRHTGYVVTQLDGL-------YLGAQKRASEEKIKPM--TMFQIQFLNAVGDLLDLIPSLSPTK-SSSMMKFKIWEMGHCSALIKVLPGFENIYFAHSSWYTYAAMLRIYKHWDFNIKDKYTLS-------KRLSFSSYPGFLESLDDFYILSSGLILLQTTNSVYNKTL---LKQVVPKTLLAWQRVRVANMMAEGGKEWAQIFSKHNSGTYNNQYMVLD---LKKVTINRSLDKGTLYIVEQIPTYVEYSDQTNVLRKGYWASYNIPFHKTIYNWSGYPLLVHKLGLDYSYDLAPRAKIFRRDQGNVTDMASMKYIMRYNNYKEDPYSKGDPCST-------ICCREDL---NGASPSPGGCY------DTKVADIFLASQYKAYAISGPTVQDGLPPFNWNRFNDTLHRGMPEVFDFNFVTMKPILS 550          
BLAST of Phospholipase B-like vs. UniProt/SwissProt
Match: sp|Q4QQW8|PLBL2_RAT (Putative phospholipase B-like 2 OS=Rattus norvegicus OX=10116 GN=Plbd2 PE=1 SV=2)

HSP 1 Score: 382.874 bits (982), Expect = 3.817e-124
Identity = 218/530 (41.13%), Postives = 298/530 (56.23%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIESIIVKSRY--QGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNG------VLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPIITPF 1820
            +  A     I  TGWA+L L T+ +Y D LQAY +G++E  +++ LI  H  NT  +YC        +C+ LK +   N+E +  +        YW  +RL L Q+KGL+D+Y+      +   N   L        G  LLQ  GDL  L   L      ++   +  +G GSCSA IK + G  D+  AH TW+ Y  MLRI K Y   +R   +    P+I G N+ FSSYP  I S DDFY+  +GLV+ ETTIGN N +LWK ++ +    VLE++R   ANRL+  G  W   F   NSGTYNNQWM+V+Y           IPNG      VL + EQIPG++V  D T  L +T+YWASYNIP+F++V+  SG   +  +YGD+F+  + PRA IF+RD   V +  ++++LMRYNDF +DPL+ C  C+P  + EN IS+RSDLN  NG YPF AL  R HGG D+K TS  L+K M  +  S PT+DQ P F W  +   ++ H   P  W F P+  P+
Sbjct:   80 VAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPL--------GFLLLQISGDLEDLEPAL------NKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQ-EEYPLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGC--VLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAF--------IPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDFLHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYMSMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPW 584          
BLAST of Phospholipase B-like vs. UniProt/SwissProt
Match: sp|Q3TCN2|PLBL2_MOUSE (Putative phospholipase B-like 2 OS=Mus musculus OX=10090 GN=Plbd2 PE=1 SV=2)

HSP 1 Score: 381.333 bits (978), Expect = 2.011e-123
Identity = 217/530 (40.94%), Postives = 295/530 (55.66%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIESIIVKSRY--QGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNG------VLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPIITPF 1820
            +  A     I  TGWA+L L T+  Y D LQAY +G++E  +++ LI  H  NT  +YC        +C+ LK +   N+E +  +        YW  +RL L Q+KGL+D+Y+      +         +   +  G  LLQ  GDL  L   L      ++   +  +G GSCSA IK + G  D+  AH TW+ Y  MLRI K Y   +R   +    P++ G N+ FSSYP  I S DDFY+  +GLV+ ETTIGN N +LWK ++ +    VLE++R   ANRL+  G  W   F   NSGTYNNQWM+V+Y           +PNG      VL + EQIPG++V  D T  L +T+YWASYNIP+F+ V+  SG   +  +YGD+F+  K PRA IF+RD   V +  ++++LMRYNDF +DPL+ C  C P  + EN IS+RSDLN  NG YPF AL  R HGG D+K TS  L+K M  +  S PT+DQ P F W  +   S+ H   P  W F PI  P+
Sbjct:   89 VAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTG--------RFTIKPLGFLLLQISGDLEDLEPAL------NKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQ-EEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGC--VLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAF--------LPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPW 593          
BLAST of Phospholipase B-like vs. UniProt/SwissProt
Match: sp|Q8NHP8|PLBL2_HUMAN (Putative phospholipase B-like 2 OS=Homo sapiens OX=9606 GN=PLBD2 PE=1 SV=2)

HSP 1 Score: 379.022 bits (972), Expect = 1.198e-122
Identity = 214/521 (41.07%), Postives = 292/521 (56.05%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIESII--VKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNG-VLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            +  A     I  TGWA L L TS  Y D LQAY +G++E  +++ LI  H  NT  +YC        +C+ LK +   N+E +   ++S     YW  +RL L Q+KGL+D+Y+      +         +   +  G  LLQ  GDL  L   L      ++   +  +G GSCSA IK + G  D+  AH TW+ Y  MLR+ K Y   +R      + P++PG  + FSSYP  I S DDFY+  +GLV+ ETTIGN N +LWK ++ +    VLE++R   ANRL+  G  W   F   NSGTYNNQWM+V+Y   K    G P P   VL + EQIPG++V  D T  L + +YWASYNIP F+ V+  SG   +  +YGD+F+ D  PRA IF+R+   V +  S+++LMRYNDF +DPL+ C  C P  +GEN IS+RSDLN  NG YPF AL  R HGG D+K TS  L++ +  +  S PT+DQ P F W  +    + H   P  W F P+
Sbjct:   84 VAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVNYCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAG--------KFTIKPLGFLLLQLSGDLEDLELAL------NKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQFR-EGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGC--VLEWVRNIVANRLASDGATWADIFKRFNSGTYNNQWMIVDY---KAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQKTYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTSPFSGLLHMGQPDLWKFAPV 584          
BLAST of Phospholipase B-like vs. UniProt/SwissProt
Match: sp|Q2KIY5|PLBL2_BOVIN (Putative phospholipase B-like 2 OS=Bos taurus OX=9913 GN=PLBD2 PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 4.475e-119
Identity = 225/533 (42.21%), Postives = 296/533 (55.53%), Query Frame = 3
Query:  243 FRLVKGHGSKSLITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIESIIVKSRYQGG--YWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNG-VLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
             RLV G    + +  A     I  TGWA L L T+  + D LQAY +G++E  +++ LI  +  NT  +YC        +C+ LK +   N+E +  +     G  YW  +RL L Q+KGL+D+Y+ S    +       L        G  LLQ  GDL  L   L      ++      +G GSCSA IK + G  D+  AH TW  Y  MLRI K Y F +R   + A S   PG  + FSSYP  I S DDFY+  +GLV+ ETTIGN N +LWK    +    VLE++R   ANRL+  G  W   F   NSGTYNNQWM+V+Y   K    G P P   VL V EQIPG++V  D T  L + +YWASYNIP F++V+  SG   +  +YG +F+ D  PRA IF+R+   V +  S+M+LMRYNDF +DPL+ C  CTP  +GEN IS+RSDLN  NG YPF AL  R HGG D+K TS+ L+KA+R + +S PT+DQ P F W  +    + H   P    F PI
Sbjct:   73 LRLVDGRHPDA-VAWANLTNAIRETGWAFLELHTNGRFNDSLQAYAAGVVEAAVSEELIYMYWMNTVVNYCGPFEYEVGYCERLKNFLEANLEWMQKEMELNNGSAYWHQVRLTLLQLKGLEDSYEGSVAFPTGKFTVKPL--------GFLLLQISGDLEDLEVAL------NKTKTNHAMGSGSCSALIKLLPGQRDLLVAHNTWHSYQYMLRIMKKYWFQFREGPQ-AESTRAPGNKVIFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWK--YVQPTGCVLEWMRNVVANRLALDGDSWADIFKRFNSGTYNNQWMIVDY---KAFVPGGPSPGRRVLTVLEQIPGMVVVADRTSELYQKTYWASYNIPSFESVFNASGLPALVARYGPWFSYDGSPRAQIFRRNHSLVHDLDSMMRLMRYNDFLHDPLSLCKACTPKPNGENAISARSDLNPANGSYPFQALHQRSHGGIDVKVTSTALAKALRLLAVSGPTWDQLPPFQWSTSPFSGMLHMGQPDLRKFSPI 584          
BLAST of Phospholipase B-like vs. UniProt/SwissProt
Match: sp|Q9XWV2|PLBL1_CAEEL (Putative phospholipase B-like 1 OS=Caenorhabditis elegans OX=6239 GN=Y37D8A.2 PE=1 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 2.628e-116
Identity = 212/526 (40.30%), Postives = 293/526 (55.70%), Query Frame = 3
Query:  267 SKSLITKATFIQQINSTGWAHLSL--TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESII--VKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVI-GDGSCSAFIKYV--KGDIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSP---TYDQQPAFDWRNNK-DPSVKHNMHPIKWNFKPI 1808
            +K L T A F  ++N TGWA L +   S   P  LQ Y +G  EG  T+ LI  HI NT   YC     FC  L ++   N++ +   ++   +  YW+ + L + Q+ GL   Y+N    +         +Q+   V  IF++Q  GDL  L+      E       +KV  G G CSA +K +    DI  +HVTWS Y  MLRI K Y+F              PGQ  SFSSYPA I+S DDF +TSA L   ETTIGNYN    K L     + VL ++R + A+R + SGL+W   F  HNSGTYNN+W+VV+Y      +   P   G+++V EQ+PG IV+ D T +L R +YW  YN P++K + + S    M +K+GD+++ DK PRALIFKRD +TVT+  S++ LMR N++  DPL++C+C PPYS EN I+ RSDLN  NG YPF +L +R HG  D+K T+S L  +++F  +S P        P FDW+ +     V H   P +WNF P+
Sbjct:   49 AKRLAT-AYFHDEVNQTGWAFLEVDVISPKIPHYLQGYAAGFAEGRATRHLIDLHIINTVNGYCDGAKHFCDELGEFMVDNLKWMEQEIRENPEDEYWQQVNLTVNQLFGLIHGYENQLGAEID------FKQIA--VHPIFMIQIAGDLEDLAMKFKKPE-----NPKKVFSGPGHCSALVKLLPKNEDILFSHVTWSSYGTMLRINKKYSF----------KTGDPGQIYSFSSYPASITSTDDFVLTSAKLAILETTIGNYNE---KSLDLITPNTVLTWIRAEIAHRTASSGLQWAEAFGRHNSGTYNNEWVVVDYKQFHRGKEVQP-ETGIIHVVEQMPGHIVHSDKTAHLFRETYWPGYNQPYYKQIIRFSDTDKMVEKFGDWYSYDKTPRALIFKRDHNTVTDMSSMIALMRSNNYTKDPLSKCDCNPPYSAENAIACRSDLNPLNGTYPFKSLGFRDHGAIDVKVTNSKLINSLQFTAVSGPPGGVTKDVPIFDWKTSPLREKVPHFGQPDRWNFAPV 546          
BLAST of Phospholipase B-like vs. TrEMBL
Match: A0A4Q8K263 (Phospholipase B-like OS=Liphistius thaleban OX=1905330 PE=3 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 3.027e-148
Identity = 239/519 (46.05%), Postives = 323/519 (62.24%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESI---IVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLR-TSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDW-RNNKDPSVKHNMHPIKWNFKPII 1811
            +  ATF  +I  TGW++L + T+  YPD +QAY +G++EG++T  LIK + +N    YC   +++C+ LK +   N++ I   I KSR    YW  + L L Q+ GL+D Y N   +    I+          V  + LL   GDL  L +IL      +R   R  +G GSCSA IK +    D+Y A  TWS YN MLR  K YN       +   SP++PG+ ++FSS P +I S DDFY+ S+GL + ETT+GN N SLWK +K K A  VLE++R   +NRL+K G EWT  F L+NSGTYNNQWMVVNY   K    G P+ +G+L+V EQIPG I  +D+T+ LR  +YW SYN+P+F++++ +SG     +KYGD+FT DK PRALIFKRD   V +  S++KLMRYND+ NDPL+RCNCTPPYS EN IS+R DLN  NG YP  AL +R HG TD+K T+S L + ++FV    PTYD  P F W + +   ++ H  HP  W F+PI+
Sbjct:   45 VAYATFTDEIFLTGWSYLEVSTNEKYPDSVQAYAAGLVEGVLTADLIKKNWNNQGKMYCKGETSYCQRLKNFLQINLDFINFNIAKSRKYVPYWHQVALVLEQLSGLEDGYKNISGSPRTQID----------VMDLMLLNIFGDLEDLEAIL------NRTVTRHPLGSGSCSALIKVLPNNKDLYVAQDTWSSYNTMLRTLKKYNISVHTGMQ-RGSPVVPGRAVAFSSQPGLIFSGDDFYLISSGLAAVETTVGNNNVSLWKYIKAKGA--VLEWIRNIVSNRLAKDGEEWTKVFELYNSGTYNNQWMVVNY---KKFITGEPLQDGLLWVLEQIPGYIHSEDVTNILRKQNYWPSYNVPYFQDIFNLSGGQINVEKYGDWFTYDKTPRALIFKRDEVNVHDIPSMIKLMRYNDYTNDPLSRCNCTPPYSAENAISARCDLNPANGTYPIAALGHRPHGATDMKLTTSSLYQKLQFVAFGGPTYDPLPPFQWSKTDFGKTMPHEGHPDLWKFEPIV 541          
BLAST of Phospholipase B-like vs. TrEMBL
Match: A0A4Q8K1X1 (Phospholipase B-like OS=Liphistius sp. SGP-2016 OX=1905180 PE=3 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 3.027e-148
Identity = 239/519 (46.05%), Postives = 323/519 (62.24%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESI---IVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLR-TSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDW-RNNKDPSVKHNMHPIKWNFKPII 1811
            +  ATF  +I  TGW++L + T+  YPD +QAY +G++EG++T  LIK + +N    YC   +++C+ LK +   N++ I   I KSR    YW  + L L Q+ GL+D Y N   +    I+          V  + LL   GDL  L +IL      +R   R  +G GSCSA IK +    D+Y A  TWS YN MLR  K YN       +   SP++PG+ ++FSS P +I S DDFY+ S+GL + ETT+GN N SLWK +K K A  VLE++R   +NRL+K G EWT  F L+NSGTYNNQWMVVNY   K    G P+ +G+L+V EQIPG I  +D+T+ LR  +YW SYN+P+F++++ +SG     +KYGD+FT DK PRALIFKRD   V +  S++KLMRYND+ NDPL+RCNCTPPYS EN IS+R DLN  NG YP  AL +R HG TD+K T+S L + ++FV    PTYD  P F W + +   ++ H  HP  W F+PI+
Sbjct:   45 VAYATFTDEIFLTGWSYLEVSTNEKYPDSVQAYAAGLVEGVLTADLIKKNWNNQGKMYCKGETSYCQRLKNFLQINLDFINFNIAKSRKYVPYWHQVALVLEQLSGLEDGYKNISGSPRTQID----------VMDLMLLNIFGDLEDLEAIL------NRTVTRHPLGSGSCSALIKVLPNNKDLYVAQDTWSSYNTMLRTLKKYNISVHTGMQ-RGSPVVPGRAVAFSSQPGLIFSGDDFYLISSGLAAVETTVGNNNVSLWKYIKAKGA--VLEWIRNIVSNRLAKDGEEWTKVFELYNSGTYNNQWMVVNY---KKFITGEPLQDGLLWVLEQIPGYIHSEDVTNILRKQNYWPSYNVPYFQDIFNLSGGQINVEKYGDWFTYDKTPRALIFKRDEVNVHDIPSMIKLMRYNDYTNDPLSRCNCTPPYSAENAISARCDLNPANGTYPIAALGHRPHGATDMKLTTSSLYQKLQFVAFGGPTYDPLPPFQWSKTDFGKTMPHEGHPDLWKFEPIV 541          
BLAST of Phospholipase B-like vs. TrEMBL
Match: A0A4Q8K256 (Phospholipase B-like OS=Liphistius thaleban OX=1905330 PE=3 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 3.438e-148
Identity = 239/519 (46.05%), Postives = 323/519 (62.24%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESI---IVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLR-TSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDW-RNNKDPSVKHNMHPIKWNFKPII 1811
            +  ATF  +I  TGW++L + T+  YPD +QAY +G++EG++T  LIK + +N    YC   +++C+ LK +   N++ I   I KSR    YW  + L L Q+ GL+D Y N   +    I+          V  + LL   GDL  L +IL      +R   R  +G GSCSA IK +    D+Y A  TWS YN MLR  K YN       +   SP++PG+ ++FSS P +I S DDFY+ S+GL + ETT+GN N SLWK +K K A  VLE++R   +NRL+K G EWT  F L+NSGTYNNQWMVVNY   K    G P+ +G+L+V EQIPG I  +D+T+ LR  +YW SYN+P+F++++ +SG     +KYGD+FT DK PRALIFKRD   V +  S++KLMRYND+ NDPL+RCNCTPPYS EN IS+R DLN  NG YP  AL +R HG TD+K T+S L + ++FV    PTYD  P F W + +   ++ H  HP  W F+PI+
Sbjct:   45 VAYATFTDEIFLTGWSYLEVSTNEKYPDSVQAYAAGLVEGVLTADLIKKNWNNQGKMYCKGETSYCQRLKNFLQINLDFINFNIAKSRKYVPYWHQVALVLEQLSGLEDGYKNISGSPRTQID----------VMDLMLLNIFGDLEDLEAIL------NRTVTRHPLGSGSCSALIKVLPNNKDLYVAQDTWSSYNTMLRTLKKYNISVHTGMQ-RGSPVVPGRAVAFSSQPGLIFSGDDFYLISSGLAAVETTVGNNNVSLWKYIKAKGA--VLEWIRNIVSNRLAKDGEEWTKVFELYNSGTYNNQWMVVNY---KKFITGEPLQDGLLWVLEQIPGYIHSEDVTNILRKQNYWPSYNVPYFQDIFNLSGGQINVEKYGDWFTYDKTPRALIFKRDEVNVHDIPSMIKLMRYNDYTNDPLSRCNCTPPYSAENAISARCDLNPANGTYPIAALGHRPHGATDMKLTTSSLYQKLQFVAFGGPTYDPLPPFQWSKTDFGKTMPHEGHPDLWKFEPIV 541          
BLAST of Phospholipase B-like vs. TrEMBL
Match: A0A4Q8K1W6 (Phospholipase B-like OS=Liphistius sp. SGP-2016 OX=1905180 PE=3 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 3.445e-148
Identity = 239/519 (46.05%), Postives = 323/519 (62.24%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESI---IVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLR-TSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDW-RNNKDPSVKHNMHPIKWNFKPII 1811
            +  ATF  +I  TGW++L + T+  YPD +QAY +G++EG++T  LIK + +N    YC   +++C+ LK +   N++ I   I KSR    YW  + L L Q+ GL+D Y N   +    I+          V  + LL   GDL  L +IL      +R   R  +G GSCSA IK +    D+Y A  TWS YN MLR  K YN       +   SP++PG+ ++FSS P +I S DDFY+ S+GL + ETT+GN N SLWK +K K A  VLE++R   +NRL+K G EWT  F L+NSGTYNNQWMVVNY   K    G P+ +G+L+V EQIPG I  +D+T+ LR  +YW SYN+P+F++++ +SG     +KYGD+FT DK PRALIFKRD   V +  S++KLMRYND+ NDPL+RCNCTPPYS EN IS+R DLN  NG YP  AL +R HG TD+K T+S L + ++FV    PTYD  P F W + +   ++ H  HP  W F+PI+
Sbjct:   51 VAYATFTDEIFLTGWSYLEVSTNEKYPDSVQAYAAGLVEGVLTADLIKKNWNNQGKMYCKGETSYCQRLKNFLQINLDFINFNIAKSRKYVPYWHQVALVLEQLSGLEDGYKNISGSPRTQID----------VMDLMLLNIFGDLEDLEAIL------NRTVTRHPLGSGSCSALIKVLPNNKDLYVAQDTWSSYNTMLRTLKKYNISVHTGMQ-RGSPVVPGRAVAFSSQPGLIFSGDDFYLISSGLAAVETTVGNNNVSLWKYIKAKGA--VLEWIRNIVSNRLAKDGEEWTKVFELYNSGTYNNQWMVVNY---KKFITGEPLQDGLLWVLEQIPGYIHSEDVTNILRKQNYWPSYNVPYFQDIFNLSGGQINVEKYGDWFTYDKTPRALIFKRDEVNVHDIPSMIKLMRYNDYTNDPLSRCNCTPPYSAENAISARCDLNPANGTYPIAALGHRPHGATDMKLTTSSLYQKLQFVAFGGPTYDPLPPFQWSKTDFGKTMPHEGHPDLWKFEPIV 547          
BLAST of Phospholipase B-like vs. TrEMBL
Match: A0A4Q8K3A3 (Phospholipase B-like OS=Liphistius sp. SGP-2016 OX=1905180 PE=3 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 3.595e-148
Identity = 239/519 (46.05%), Postives = 323/519 (62.24%), Query Frame = 3
Query:  279 ITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESI---IVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLR-TSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDW-RNNKDPSVKHNMHPIKWNFKPII 1811
            +  ATF  +I  TGW++L + T+  YPD +QAY +G++EG++T  LIK + +N    YC   +++C+ LK +   N++ I   I KSR    YW  + L L Q+ GL+D Y N   +    I+          V  + LL   GDL  L +IL      +R   R  +G GSCSA IK +    D+Y A  TWS YN MLR  K YN       +   SP++PG+ ++FSS P +I S DDFY+ S+GL + ETT+GN N SLWK +K K A  VLE++R   +NRL+K G EWT  F L+NSGTYNNQWMVVNY   K    G P+ +G+L+V EQIPG I  +D+T+ LR  +YW SYN+P+F++++ +SG     +KYGD+FT DK PRALIFKRD   V +  S++KLMRYND+ NDPL+RCNCTPPYS EN IS+R DLN  NG YP  AL +R HG TD+K T+S L + ++FV    PTYD  P F W + +   ++ H  HP  W F+PI+
Sbjct:   51 VAYATFTDEIFLTGWSYLEVSTNEKYPDSVQAYAAGLVEGVLTADLIKKNWNNQGKMYCKGETSYCQRLKNFLQINLDFINFNIAKSRKYVPYWHQVALVLEQLSGLEDGYKNISGSPRTQID----------VMDLMLLNIFGDLEDLEAIL------NRTVTRHPLGSGSCSALIKVLPNNKDLYVAQDTWSSYNTMLRTLKKYNISVHTGMQ-RGSPVVPGRAVAFSSQPGLIFSGDDFYLISSGLAAVETTVGNNNVSLWKYIKAKGA--VLEWIRNIVSNRLAKDGEEWTKVFELYNSGTYNNQWMVVNY---KKFITGEPLQDGLLWVLEQIPGYIHSEDVTNILRKQNYWPSYNVPYFQDIFNLSGGQINVEKYGDWFTYDKTPRALIFKRDEVNVHDIPSMIKLMRYNDYTNDPLSRCNCTPPYSAENAISARCDLNPANGTYPIAALGHRPHGATDMKLTTSSLYQKLQFVAFGGPTYDPLPPFQWSKTDFGKTMPHEGHPDLWKFEPIV 547          
BLAST of Phospholipase B-like vs. Ensembl Cavefish
Match: zgc:158619 (phospholipase B domain containing 2 [Source:NCBI gene;Acc:103026586])

HSP 1 Score: 400.208 bits (1027), Expect = 5.064e-132
Identity = 233/565 (41.24%), Postives = 318/565 (56.28%), Query Frame = 3
Query:  147 KLAICDDIYFVNPTDGAQEMSIEAVKNGTGYSFRLVKGHGSKSLITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIESI--IVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMP-IPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            ++ +C    F+     AQ  S  AV N       L  G      +  A F   I +TGW++L + TS  Y D LQAY +G +E  +T  LI  H  NT   YC        +C  LK+Y + N+E +   ++      YW  + L L Q++GL+D Y+    +  +         L     G  L Q  GDL  L + L  S      +    +G GSCSA IK + G  +++ +H TW+ Y  MLRI K Y F +  +    +  +IPG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N   WK +  + A  V+E+LR   ANRL+++G+EW   F  HNSGTYNNQWM+V+Y   K    G P I  G+  V EQIPGLI   D T  L +TSYWASYNIP+F+ V+  SG  D+ KKYG +F+ ++ PRA IF R+   VT+  S+++LMRYN+F+NDPL+ C  C PP++GEN IS+RSDLN  NG YPFGAL  R HGGTD+K TS  L +    + +S PT+DQ P F W  +   ++ H  HP +W+F  +
Sbjct:   28 RVYVCFLFTFLISASAAQVRS--AVFNQQTGKLDLKDGF-QPDFVAFANFTDDIRNTGWSYLEVVTSGKYNDTLQAYGAGAVEASVTSELIYKHWINTLMGYCGPFKYDPGYCSRLKEYITDNLEWVNQEIEKNPDSPYWHQVHLSLLQLQGLEDGYNGQVTSPGR---------LSFNPLGFLLFQMGGDLEDLEAALNKS------SLTHTVGSGSCSALIKLLPGNKELFVSHDTWNTYQSMLRIMKKYTFSFSKS--QRDKTLIPGDTQAFSSYPGSIFSGDDFYILSSGLVTLETTIGNSNPDRWKFVMPQGA--VMEWLRNIVANRLAQTGIEWAEIFGQHNSGTYNNQWMIVDY---KNFVPGKPDIKQGLFTVLEQIPGLIQIADKTQELYKTSYWASYNIPYFEKVFNASGGQDLVKKYGPWFSYNENPRAQIFSRNQTLVTDMESMVRLMRYNNFKNDPLSECEGCDPPHNGENSISARSDLNPANGTYPFGALKQRPHGGTDMKVTSYALFRQYELLAVSGPTWDQVPVFQWSTSPYQNLTHIGHPDRWDFPTV 567          
BLAST of Phospholipase B-like vs. Ensembl Cavefish
Match: zgc:158619 (phospholipase B domain containing 2 [Source:NCBI gene;Acc:103026586])

HSP 1 Score: 390.193 bits (1001), Expect = 4.004e-129
Identity = 218/507 (43.00%), Postives = 297/507 (58.58%), Query Frame = 3
Query:  321 WAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIESI--IVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMP-IPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            W++L + TS  Y D LQAY +G +E  +T  LI  H  NT   YC        +C  LK+Y + N+E +   ++      YW  + L L Q++GL+D Y+    +  +         L     G  L Q  GDL  L + L  S      +    +G GSCSA IK + G  +++ +H TW+ Y  MLRI K Y F +  +    +  +IPG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N   WK +  + A  V+E+LR   ANRL+++G+EW   F  HNSGTYNNQWM+V+Y   K    G P I  G+  V EQIPGLI   D T  L +TSYWASYNIP+F+ V+  SG  D+ KKYG +F+ ++ PRA IF R+   VT+  S+++LMRYN+F+NDPL+ C  C PP++GEN IS+RSDLN  NG YPFGAL  R HGGTD+K TS  L +    + +S PT+DQ P F W  +   ++ H  HP +W+F  +
Sbjct:    7 WSYLEVVTSGKYNDTLQAYGAGAVEASVTSELIYKHWINTLMGYCGPFKYDPGYCSRLKEYITDNLEWVNQEIEKNPDSPYWHQVHLSLLQLQGLEDGYNGQVTSPGR---------LSFNPLGFLLFQMGGDLEDLEAALNKS------SLTHTVGSGSCSALIKLLPGNKELFVSHDTWNTYQSMLRIMKKYTFSFSKS--QRDKTLIPGDTQAFSSYPGSIFSGDDFYILSSGLVTLETTIGNSNPDRWKFVMPQGA--VMEWLRNIVANRLAQTGIEWAEIFGQHNSGTYNNQWMIVDY---KNFVPGKPDIKQGLFTVLEQIPGLIQIADKTQELYKTSYWASYNIPYFEKVFNASGGQDLVKKYGPWFSYNENPRAQIFSRNQTLVTDMESMVRLMRYNNFKNDPLSECEGCDPPHNGENSISARSDLNPANGTYPFGALKQRPHGGTDMKVTSYALFRQYELLAVSGPTWDQVPVFQWSTSPYQNLTHIGHPDRWDFPTV 491          
BLAST of Phospholipase B-like vs. Ensembl Cavefish
Match: zgc:158619 (phospholipase B domain containing 2 [Source:NCBI gene;Acc:103026586])

HSP 1 Score: 356.295 bits (913), Expect = 2.453e-115
Identity = 215/564 (38.12%), Postives = 297/564 (52.66%), Query Frame = 3
Query:  147 KLAICDDIYFVNPTDGAQEMSIEAVKNGTGYSFRLVKGHGSKSLITKATFIQQINSTGWAHLSL-TSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIESI--IVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            ++ +C    F+     AQ  S  AV N       L  G      +  A F   I +TGW++L + TS  Y D LQAY +G +E  +T  LI  H  NT   YC        +C  LK+Y + N+E +   ++      YW  + L L Q++GL+D Y+    +  +         L     G  L Q  GDL  L + L  S      +    +G GSCSA IK + G  +++ +H TW+ Y  MLRI K Y F +  +    +  +IPG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N   WK +  + A  V+E+LR   ANRL+++G+EW   F  HNSGT                                  GLI   D T  L +TSYWASYNIP+F+ V+  SG  D+ KKYG +F+ ++ PRA IF R+   VT+  S+++LMRYN+F+NDPL+ C  C PP++GEN IS+RSDLN  NG YPFGAL  R HGGTD+K TS  L +    + +S PT+DQ P F W  +   ++ H  HP +W+F  +
Sbjct:   28 RVYVCFLFTFLISASAAQVRS--AVFNQQTGKLDLKDGF-QPDFVAFANFTDDIRNTGWSYLEVVTSGKYNDTLQAYGAGAVEASVTSELIYKHWINTLMGYCGPFKYDPGYCSRLKEYITDNLEWVNQEIEKNPDSPYWHQVHLSLLQLQGLEDGYNGQVTSPGR---------LSFNPLGFLLFQMGGDLEDLEAALNKS------SLTHTVGSGSCSALIKLLPGNKELFVSHDTWNTYQSMLRIMKKYTFSFSKS--QRDKTLIPGDTQAFSSYPGSIFSGDDFYILSSGLVTLETTIGNSNPDRWKFVMPQGA--VMEWLRNIVANRLAQTGIEWAEIFGQHNSGT----------------------------------GLIQIADKTQELYKTSYWASYNIPYFEKVFNASGGQDLVKKYGPWFSYNENPRAQIFSRNQTLVTDMESMVRLMRYNNFKNDPLSECEGCDPPHNGENSISARSDLNPANGTYPFGALKQRPHGGTDMKVTSYALFRQYELLAVSGPTWDQVPVFQWSTSPYQNLTHIGHPDRWDFPTV 535          
BLAST of Phospholipase B-like vs. Ensembl Cavefish
Match: si:ch73-139e5.2 (phospholipase B-like 1 [Source:NCBI gene;Acc:103032149])

HSP 1 Score: 237.269 bits (604), Expect = 5.728e-70
Identity = 178/547 (32.54%), Postives = 273/547 (49.91%), Query Frame = 3
Query:  192 GAQEMSIEAVKNGTGYSFRLVKGHGSKSLITKATFIQQINSTGWAHLSLTS----MNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESIIVKSRYQGG---YWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSP-TYDQQPAFDW-RNNKDPSVKHNMHPIKWNF 1799
            GAQ+  + +V         L++    +  +    +   +  TGW  L L +      + D++  + +G LEG +T P + +H  N +  +  K       LK++ S        + R        W+ + L L Q+ GL     +  +++ K       R L   VF +  L A GDL  L  +L  S       + ++ G G CSA IK + G  ++  AH +W  Y   +RI K+++F      + +NS    G+ +SFSSYP ++SS+DDFY+   GL+ T+TT   +N SL+  +  +A   +L + RV+ AN L+ +G EW   FS +NSGTYNNQ+MVV+ N +     G  I +G L V EQIPGL+VY D T  LR  YW+SYNIPF  ++Y +SGY  M + + + F+ D  PRA IF+RD   VT+  SL  +MRYND++ND         PYS  +   +    ND   + PF        G  D K T   +++ +    ++ P T +  P F W R N+     H+  P+ +NF
Sbjct:   19 GAQQQVVASVSWEPVQQSVLLEEVLREDSVVYGFYNHSLEHTGWGVLELRAGYGQTEHSDDITYFLAGYLEGYLTAPQMASHYLNMH-SHLIKDKKVLNPLKKFLSDQDSWAREQVRLNENNDPLWQQVGLTLAQLDGLHAGAAHWARSRHK-------RPLS--VFAVQFLNAIGDLLDLIPVLR-SRSSFFLDSFRMPGMGHCSALIKMLPGYENLLFAHSSWYTYAASMRIYKHWDF------KQSNSHTGTGK-VSFSSYPGLLSSLDDFYLLGNGLLITQTTNSVFNTSLYALVTPEA---LLAWQRVRLANSLAHTGEEWAQVFSRYNSGTYNNQYMVVDLNRV---LLGREIKDGALTVVEQIPGLVVYSDQTQALRHGYWSSYNIPFHSDIYTLSGYGVMWEIHWEDFSYDLCPRAKIFRRDQAKVTDLASLKYIMRYNDYKND---------PYSKRHPCKTICCRNDLRLRRPFPG------GCFDTKVTDYHMARKLVAEAVNGPTTQNGLPPFTWSRFNQ---TAHHGLPLIYNF 523          
BLAST of Phospholipase B-like vs. Ensembl Cavefish
Match: plbd1 (phospholipase B domain containing 1 [Source:NCBI gene;Acc:103045113])

HSP 1 Score: 225.713 bits (574), Expect = 9.723e-66
Identity = 164/494 (33.20%), Postives = 242/494 (48.99%), Query Frame = 3
Query:  309 NSTGWAHLSLTS----MNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFC--KNLKQYFSTNIESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSIL-GGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLN----DPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFV--GISSPTYDQQ-PAFDW 1742
            +STGW  L + +       PDE+  + +G LEG +T   +  H +N YP   ++P      KN            +  ++     W      L Q+ GLQ    +  K   K             +F +  L A GDL  L  +L  G++ + +      +G   CSA IK + G  ++  AH +W  Y   +RI K+++F  R++      P      +SFSSYP  + S+DDFY+  +GL+ T+TT   +N+SL+  +    +S +  + RV+ A+ L+ +G EW  TF+  NSGTYNNQ+MV++ + +     G  I NG L + EQIPGL+ Y D T  LR  YW SYN+PF K +Y +SGY  M  ++GD F+ D  PRA IF+RD   VT+  SL  +MRYND++NDP ++ +          I  R+DL      P G Y             D K T      A RFV   ++ PT +   P F W
Sbjct:   57 SSTGWGVLEIRAGYGETPEPDEVTYFLAGYLEGFLTARQMYDHYTNMYPQLITEPEVLVAVKNFMAKQDAWSREQVKLNKSSDPLWSHTGFILSQLDGLQAGVADWAKRMGKK---------PLSLFQVQFLNAVGDLLDLIPVLVPGAKANMKLYKEPPMG--HCSALIKMLPGYENLLFAHSSWYTYAATMRIFKHWDF--RVS-----EPHTATGKLSFSSYPGFLVSLDDFYLLGSGLMMTQTTNIVFNSSLFSVI---TSSSLFSWQRVRLAHALAHTGQEWAQTFAKFNSGTYNNQYMVLDTSKIS---LGSSIDNGALVIVEQIPGLVEYSDQTQTLRRGYWPSYNVPFHKKIYSLSGYEQMWMEHGDDFSYDLCPRAKIFRRDQGGVTDLVSLKHIMRYNDYKNDPYSKGDPC------KSICCRNDLQKHRASPGGCY-------------DTKVTD--FHMAQRFVSEALNGPTTEGGLPPFSW 505          
BLAST of Phospholipase B-like vs. Ensembl Sea Lamprey
Match: zgc:158619 (phospholipase B domain containing 2 [Source:HGNC Symbol;Acc:HGNC:27283])

HSP 1 Score: 342.043 bits (876), Expect = 2.600e-111
Identity = 192/481 (39.92%), Postives = 262/481 (54.47%), Query Frame = 3
Query:  414 IKAHISNTYPDYCSK---PSTFCKNLKQYFSTNIE--SIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAA-----RKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGM---PIPNGVLYVAEQIPGLIVYKDLTDYL-RTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKP 1805
            IK    NT   YC+K    S +C  L+ +   N++  +  +++  +   W  +RL L Q KG++D    +    +  I+ +        +FG +L Q   DL  L  +L  +      A+     R  +G G CSA I+ +    D+  +HVTW  Y  MLRI K Y              +IPG   +FSSYP +  SIDDFY+ S+GLV  ETTI N N  LW  ++ K    +LE+LR   ANRL+ SG  W  TF  HNSGTYNN+WMVV+Y      RF        +G+L V EQ+PGL+V  DLTD L +  YWASYNIP+F+ ++ +S    +  K+GD+F  D+ PRA IF+RD HTVT+  S++ LMRYN+F NDPL+ C  C P  + E  I++R DLN  NG YP   L  R HG TD+K TS  +   +  V  S PT+DQQP F W  +   S+ H   P  W+F P
Sbjct:    1 IKLQWQNTMEGYCAKGSQESAYCGRLEGFLKDNLDWMNAQIEAEPENPLWHQVRLALLQFKGIEDGMSGNIALPTGRIDIS--------LFGFYLGQIATDLGDLEQVLNKTAATQNPASGMEYGRGPVGKGHCSALIRLLPNGQDLLTSHVTWGAYQSMLRIVKNYQ----------RQQVIPGHEQAFSSYPGVTFSIDDFYILSSGLVVLETTIENNNPELWHLVQPKGQ--LLEWLRNVVANRLATSGQHWAETFRQHNSGTYNNEWMVVDYK-----RFATGSSKSSSGILTVLEQMPGLVVSSDLTDVLYKEQYWASYNIPYFQKIWNVSDQQALVDKFGDWFDHDRCPRAQIFRRDVHTVTDLPSMVHLMRYNNFMNDPLSACKGCVPGQNAEFAIAARCDLNPANGTYPCDMLQQRSHGATDMKITSKAMVPRLEMVAQSGPTWDQQPPFQWSKSPFSSLSHVGQPDLWSFLP 456          
BLAST of Phospholipase B-like vs. Ensembl Sea Lamprey
Match: PLBD1 (phospholipase B domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26215])

HSP 1 Score: 213.001 bits (541), Expect = 8.542e-62
Identity = 168/530 (31.70%), Postives = 257/530 (48.49%), Query Frame = 3
Query:  288 ATFIQQINSTGWAHLSLTSMNYP----DELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESII--VKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAA-------RKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFS-LHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQ-PAFDWRNNKDPSVKHNMHPIKWNFKPIITPFP 1823
            A +   +  TGW  L + +   P    D    Y +G LEG +T   I  H  N  P + +  +   + L  +F+   + ++  +K+      W+ +     Q++GLQ    + W        EN ++ L    F    L   GD+  L + L   +    F A       R  + +G CSA IK   G  ++   H +W  Y+   RI K+++F  R   EVA +        SFSSYP  +SS+DD+Y+ S+GLV  +TTI NYN +L+  +  +A   +L + RV+TAN L++ G +W    S L  SGTYNNQ+M++N N ++    G+ I +G LYV EQ+P L+   D TD LR  YWASYNIPF++++Y++ GY  +    G+ ++     RA IF+RD   + N  SL  ++RYN ++ D     N C       N I  R DL  PN   P G          D K     ++K      ++ PT + + PAF W  +   ++KH   P  + F P +T  P
Sbjct:   33 ALYNDTLPQTGWDVLEVRAGYGPQKRGDRETLYMAGFLEGYLTANRIYPHYRNLAPFFITD-NRIGQELNTFFNEQDDWVVGQIKANRGDPVWRHVDALHGQMQGLQRGV-HKWAL------ENNVKPLPK--FAFHYLNGIGDIIDLVNKLSPQQARG-FGAMTSGDIRRYTLRNGHCSAIIKVTPGFENVLFGHSSWFTYSATSRIFKHWDFNLR---EVAAA----APKSSFSSYPGFLSSLDDYYLLSSGLVMLQTTIVNYNQNLFNDITPQA---LLSWQRVRTANVLARDGKQWGFLLSWLSASGTYNNQYMILNLNKIE---LGVGIHDGALYVVEQMPTLVHSADQTDILRNGYWASYNIPFYRSIYELGGYQRLNDYMGNEYSHQLSSRAKIFRRDQSKIRNVESLKAVLRYNGYKTDRYTSGNPC-------NTICCRDDLQ-PNTGSPVGCY--------DTKVADMRMAKKFMTSAVNGPTVEGKLPAFSW--SPFDNIKHEGLPNTYKF-PFVTMQP 519          
BLAST of Phospholipase B-like vs. Ensembl Sea Lamprey
Match: PLBD1 (phospholipase B domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26215])

HSP 1 Score: 211.46 bits (537), Expect = 3.616e-61
Identity = 164/533 (30.77%), Postives = 252/533 (47.28%), Query Frame = 3
Query:  288 ATFIQQINSTGWAHLSLTSMNYP------DELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESIIVKSR--YQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLK-DQVFGIFLLQADGDLSALSSILGGSE------YHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLAR---CNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYD-QQPAFDWRNNKDPSVKHNMHPIKWNFKPIITPFP 1823
             T    + STGWA L + S          D   A+ +G +EG +T   I  H  N YP +     T    L+ +         V+SR  +   +W+ +   L Q+ G+           +     N    +K D  F    L A GD+  L + L  S            A R V   G CSA IK + G  +I+ +H +W  Y   +RI K+++    +N   A++     + +SFSSYP  + S+DD+Y+ S+GLV  +TT   +N SL+  +   +   +L + RV+ AN +++ G +W   F+ HNSGTYNNQ+MV++   +K       I +  L+V EQIP L+V +D TD LR  YW SYN+PF+++VY +SGY +    +G  F+ +  PRA IF+RD  +V +  S+  +MR N+++ DP +    C+C         I  R DLN P    P G          D K T    ++      ++ PT     P F W  +K     H   P  ++F P +T +P
Sbjct:   31 GTLNDSLLSTGWAELEVRSGYGGGRGAIGDSDVAFLAGYVEGYLTARHINNHFKNLYPTFIKDNKTHAI-LEDFLRKQDSWARVQSRENHNDPFWRNVDYVLSQLDGMI----------AGATRRNAEHGIKTDLSFPALYLNAVGDVIDLVNALVPSRRPPWLSLSKAEAKRLVQKSGHCSALIKILPGYENIFMSHSSWFTYAATMRIFKHWD----LNILDASTA---SRQMSFSSYPGFLESLDDYYLLSSGLVLLQTTNNVFNDSLYAAITPLS---LLAWQRVRVANMMARGGRQWGQVFARHNSGTYNNQYMVLD---LKKVELKKNIADEALFVVEQIPTLVVSEDQTDILRKGYWPSYNVPFYESVYNLSGYPEFVATHGSDFSYELAPRAKIFRRDHGSVVDLASMKGIMRSNNYKYDPYSEGDPCDC---------ICCRGDLN-PTKPAPDGCY--------DTKVTDYFNARNFTSFVVNGPTVQPDTPPFSW--SKFNGTSHVGLPPMYDF-PFVTVWP 518          
BLAST of Phospholipase B-like vs. Ensembl Nematostella
Match: EDO39917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8R6])

HSP 1 Score: 279.641 bits (714), Expect = 9.586e-87
Identity = 186/514 (36.19%), Postives = 259/514 (50.39%), Query Frame = 3
Query:  288 ATFIQQINSTGWAHLSLTS-MNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTN--IESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYV--KGDIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTS-YWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGAL-AYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            A F  +IN TGW++L + S  +Y D LQA  +G+ EG IT  LI     N Y DYC     FCK L +Y   N    + ++KS     YW  ++L   Q++G++  Y N             L ++ D  F  F  QA GDL  L   L            +++G GSCSA +K +    DI+ +HVTW  Y  MLRI K Y+FP+             G+               D  V  A  VS ETTIGN N  LWK +  +    +LE++RV  ANRL+++  EWT  FS HNSGTYNNQWMV++Y L      G PI  G L V EQIPG+    D++ YL+ + YWASYN+P+F  +Y +SG     + YG +F     PRA IFKRD   V +  ++MKLMR+ +     + +C+  PP    +       L        F AL ++  H     + TS  L +  + + +S PT+DQQPAF W  ++    K   HP K++F+P+
Sbjct:   46 ARFRDEINQTGWSYLEVFSNESYSDVLQATAAGMAEGFITADLIHMDYMNKYADYCKNDENFCKKLTEYLRGNEAWRAKMIKSHLNESYWYQVQLIDAQVEGIKKGYHN---------KSLALPEIPDLAF--FFFQASGDLEDLEVALKKEN------PSRILGSGSCSALVKVLPEHKDIFISHVTWDTYLGMLRIFKMYDFPFTRK----------GRK--------------DLRVI-AKRVSIETTIGNTNEDLWKYVTPQGT--LLEWVRVMIANRLARTSDEWTFLFSKHNSGTYNNQWMVLDYKLFTP---GQPIQPGTLSVLEQIPGMTETADMSVYLQENGYWASYNLPYFPTIYNMSGQEASREAYGSWFDYHLNPRAQIFKRDQSKVVDLETMMKLMRWVNCNRTLVKKCHSPPPPLTFDSTKEDDFL---GCALVFAALPSHCFHP----QITSFELFQKFQCIAVSGPTHDQQPAFQWSTSE--WEKPLGHPDKFDFEPV 503          
BLAST of Phospholipase B-like vs. Ensembl Nematostella
Match: EDO46152 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQR6])

HSP 1 Score: 242.662 bits (618), Expect = 2.481e-72
Identity = 173/564 (30.67%), Postives = 272/564 (48.23%), Query Frame = 3
Query:  168 IYFVNPTDGAQEMSIEAVKNGTGYSFRLVKGHGSKSL-ITKATFIQQINSTGWAHLSLTSMN----YPDELQAYYSGILEGIITKPLIKAHISNTYPDYC-SKPSTFCKNLKQYFSTN---IESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIF---LLQADGDLSALSSILGGSEYH------SRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNF 1799
            I FV    G+Q+ +      G GYS +   G   K + +   TF   +N+TGW  L++ S      Y D++  + +G LEG +T   I  + +N Y  +  S+       ++++F      +  +I        +W+ +   + Q  GL + Y     T              D+  G+F   +L   GDL  L+  L             +    KV  DG CSA IK +    +++A+HV+W  Y+ MLR+ K+Y+   +             Q +SFSSYP  + S+DDFY+  + LV  +TT   +N SL++ +  ++   +  + RV+ AN ++ SG +W      +NSGTYNNQ+MV++  L++       I +  L+V EQIP L+   D T  LR  YW SYN+PF++ VY +SGY D   ++G  F+ +  PRA IF+RD   V +  S+  +MRYNDFQ+DP ++ N        N I SR DL          A   R  G  D K T   +++++    I+ PT++QQ  F W   +  + KH   P  +NF
Sbjct:   17 ILFVFGCHGSQKSATVYYNRGQGYSLKF--GVVDKLMGVAYGTFEDSLNTTGWYELNIVSGTGIEPYNDDVIMHAAGYLEGALTASQINDNYANLYGVFFKSEDDPMVAKVEKFFIEQDIWMRKMIALKSSNSSFWRQMGNIIAQFDGLVEGYQKYPAT--------------DKALGVFAFQMLNGVGDLLDLTKALMPERMADWDHMTEKEILEKVAMDGHCSALIKVLPAYENVFASHVSWFTYSAMLRVYKHYHLNLK-------DETTAAQRMSFSSYPGFLESLDDFYIMDSKLVMLQTTNNVFNKSLYEQVVPES---LFSWQRVRLANLVASSGRQWADIVGQYNSGTYNNQYMVLDLKLIQ---LNNTIQDNALWVVEQIPTLVASGDQTAILRAGYWPSYNVPFYELVYNLSGYPDFVARHGVQFSHELAPRAKIFRRDQSMVHDLDSMKHIMRYNDFQHDPYSQGNPM------NAICSRGDLI---------ADGPRASGCYDGKVTDFTMAQSLISHAINGPTHEQQVPFHWSQYQFKN-KHEGQPDLFNF 535          
BLAST of Phospholipase B-like vs. Ensembl Nematostella
Match: EDO42515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S118])

HSP 1 Score: 130.568 bits (327), Expect = 7.443e-35
Identity = 81/215 (37.67%), Postives = 114/215 (53.02%), Query Frame = 3
Query: 1167 SGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPII 1811
            SGTYNNQ+MV++   +K  +    I +  L+V EQIP L+   D T  LR  YW SYNIPF++ VY +SGY   AKK+G  F+    PRA IF+RD   V +  S+  LM  ND+Q+DP ++       S  N I +R DL +P  K           G  D K +   ++ A+    +S PT+ +Q  F W +N   S KH   P  +NF  ++
Sbjct:    1 SGTYNNQYMVLD---LKRIQLNKTIEDNALWVVEQIPSLVASGDQTPILRAGYWPSYNIPFYELVYNMSGYPAFAKKHGQKFSYQLAPRAKIFRRDQSKVQDLSSMKHLMLSNDYQHDPYSQG------SPWNAICARGDLIEPKPK---------PKGCYDAKVSDLSMALALTSHALSGPTHQEQKPFRWSDNNFKS-KHFGQPDLFNFDFVV 196          
BLAST of Phospholipase B-like vs. Ensembl Medaka
Match: zgc:158619 (phospholipase B domain containing 2 [Source:NCBI gene;Acc:101173067])

HSP 1 Score: 407.527 bits (1046), Expect = 6.098e-135
Identity = 226/551 (41.02%), Postives = 321/551 (58.26%), Query Frame = 3
Query:  192 GAQEMSIEAVKNGTGYSFRLVKGHGSKSLITKATFIQQINSTGWAHLSLT-SMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCS---KPSTFCKNLKQYFSTNIESII--VKSRYQGGYWKMIRLQLWQIKGLQDAYDN--SWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLT-DYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            G  E+    +  G+G    +V+G+  +  +  A F   I ++GW+ L +T S  Y D +QAY +G++E  +T  LI  H  NT   YC      S++C+ LK +   N+E +   ++ +    YW    L L Q+KGL+D Y++  S+ T    IN            G  L Q  GD+  L S L  S      +  + +G GSCSA IK +    D++ +H TW+ Y  MLRI K Y F ++ +   +N P+ PG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N++LWK ++      V+E+LR   ANRL+ +  EW   F  +NSGTYNNQWM+VNYN     +    I   +  V EQIPGL+VY D T + LR  YWAS+NIP+++ ++  SG  ++ +K+G +F++D+ PRA IF+R+   VT+  S+++LMRYN+F+ DPL+ C  C PP +GEN IS+RSDLN  NG YPFGAL  R HGGTD+K TS  + K    + +S PT+DQ P F W  +    + H  HP  WNFKPI
Sbjct:   30 GRAEIRSAVIDKGSG-KLTVVEGY-HEGFVAWANFTNDIETSGWSFLEITTSSQYNDRIQAYAAGVVEAAVTSELIYKHWMNTLMGYCGPFVSDSSYCERLKAFIKANLEWMQEQIEKQPTSPYWYQAHLVLLQLKGLEDGYNDQLSFPTGHFSINP----------MGFILFQMGGDIEDLESALNKS------SQTRPLGSGSCSALIKLLPNNKDLFVSHDTWNTYQAMLRIMKKYRFAFKASSSGSNDPL-PGGTQAFSSYPGAIFSGDDFYILSSGLVTLETTIGNSNSTLWKFVQPTGT--VMEWLRNIVANRLATTAKEWAEIFRKYNSGTYNNQWMIVNYNHFTPGK--TDIKEDLFVVLEQIPGLVVYSDKTQELLRNGYWASFNIPYYEEIFNASGCNELVEKFGPWFSLDQNPRAQIFRRNQTQVTDLDSMIRLMRYNNFKEDPLSMCEGCNPPQNGENAISARSDLNPANGTYPFGALKQRSHGGTDMKMTSFGMFKEYGMIAVSGPTWDQLPPFQWSTSPYKDLVHMGHPDVWNFKPI 557          
BLAST of Phospholipase B-like vs. Ensembl Medaka
Match: zgc:158619 (phospholipase B domain containing 2 [Source:NCBI gene;Acc:101173067])

HSP 1 Score: 403.675 bits (1036), Expect = 1.206e-133
Identity = 226/551 (41.02%), Postives = 320/551 (58.08%), Query Frame = 3
Query:  192 GAQEMSIEAVKNGTGYSFRLVKGHGSKSLITKATFIQQINSTGWAHLSLT-SMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCS---KPSTFCKNLKQYFSTNIESII--VKSRYQGGYWKMIRLQLWQIKGLQDAYDN--SWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLT-DYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            G  E+    +  G+G    +V+G+  +  +  A F   I ++GW+ L +T S  Y D +QAY +G++E  +T  LI  H  NT   YC      S++C+ LK +   N+E +   ++ +    YW    L L Q+KGL+D Y++  S+ T    IN            G  L Q  GD+  L S L  S      +  + +G GSCSA IK +    D++ +H TW+ Y  MLRI K Y F ++ +    N P+ PG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N++LWK ++      V+E+LR   ANRL+ +  EW   F  +NSGTYNNQWM+VNYN     +    I   +  V EQIPGL+VY D T + LR  YWAS+NIP+++ ++  SG  ++ +K+G +F++D+ PRA IF+R+   VT+  S+++LMRYN+F+ DPL+ C  C PP +GEN IS+RSDLN  NG YPFGAL  R HGGTD+K TS  + K    + +S PT+DQ P F W  +    + H  HP  WNFKPI
Sbjct:   15 GRAEIRSAVIDKGSG-KLTVVEGY-HEGFVAWANFTNDIETSGWSFLEITTSSQYNDRIQAYAAGVVEAAVTSELIYKHWMNTLMGYCGPFVSDSSYCERLKAFIKANLEWMQEQIEKQPTSPYWYQAHLVLLQLKGLEDGYNDQLSFPTGHFSINP----------MGFILFQMGGDIEDLESALNKS------SQTRPLGSGSCSALIKLLPNNKDLFVSHDTWNTYQAMLRIMKKYRFAFKAS-SSGNDPL-PGGTQAFSSYPGAIFSGDDFYILSSGLVTLETTIGNSNSTLWKFVQPTGT--VMEWLRNIVANRLATTAKEWAEIFRKYNSGTYNNQWMIVNYNHFTPGK--TDIKEDLFVVLEQIPGLVVYSDKTQELLRNGYWASFNIPYYEEIFNASGCNELVEKFGPWFSLDQNPRAQIFRRNQTQVTDLDSMIRLMRYNNFKEDPLSMCEGCNPPQNGENAISARSDLNPANGTYPFGALKQRSHGGTDMKMTSFGMFKEYGMIAVSGPTWDQLPPFQWSTSPYKDLVHMGHPDVWNFKPI 541          
BLAST of Phospholipase B-like vs. Ensembl Medaka
Match: zgc:158619 (phospholipase B domain containing 2 [Source:NCBI gene;Acc:101173067])

HSP 1 Score: 376.711 bits (966), Expect = 1.847e-123
Identity = 218/550 (39.64%), Postives = 306/550 (55.64%), Query Frame = 3
Query:  192 GAQEMSIEAVKNGTGYSFRLVKGHGSKSLITKATFIQQINSTGWAHLSLTSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCS---KPSTFCKNLKQYFSTNIESII--VKSRYQGGYWKMIRLQLWQIKGLQDAYDN--SWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLT-DYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCN-CTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPI 1808
            G  E+    +  G+G    +V+G+  +  +  A F   I ++GW+ L                      IT  LI  H  NT   YC      S++C+ LK +   N+E +   ++ +    YW    L L Q+KGL+D Y++  S+ T    IN            G  L Q  GD+  L S L  S      +  + +G GSCSA IK +    D++ +H TW+ Y  MLRI K Y F ++ +    N P+ PG   +FSSYP  I S DDFY+ S+GLV+ ETTIGN N++LWK ++      V+E+LR   ANRL+ +  EW   F  +NSGTYNNQWM+VNYN     +    I   +  V EQIPGL+VY D T + LR  YWAS+NIP+++ ++  SG  ++ +K+G +F++D+ PRA IF+R+   VT+  S+++LMRYN+F+ DPL+ C  C PP +GEN IS+RSDLN  NG YPFGAL  R HGGTD+K TS  + K    + +S PT+DQ P F W  +    + H  HP  WNFKPI
Sbjct:   18 GRAEIRSAVIDKGSG-KLTVVEGY-HEGFVAWANFTNDIETSGWSFLE---------------------ITTKLIYKHWMNTLMGYCGPFVSDSSYCERLKAFIKANLEWMQEQIEKQPTSPYWYQAHLVLLQLKGLEDGYNDQLSFPTGHFSINP----------MGFILFQMGGDIEDLESALNKS------SQTRPLGSGSCSALIKLLPNNKDLFVSHDTWNTYQAMLRIMKKYRFAFKAS-SSGNDPL-PGGTQAFSSYPGAIFSGDDFYILSSGLVTLETTIGNSNSTLWKFVQPTGT--VMEWLRNIVANRLATTAKEWAEIFRKYNSGTYNNQWMIVNYNHFTPGK--TDIKEDLFVVLEQIPGLVVYSDKTQELLRNGYWASFNIPYYEEIFNASGCNELVEKFGPWFSLDQNPRAQIFRRNQTQVTDLDSMIRLMRYNNFKEDPLSMCEGCNPPQNGENAISARSDLNPANGTYPFGALKQRSHGGTDMKMTSFGMFKEYGMIAVSGPTWDQLPPFQWSTSPYKDLVHMGHPDVWNFKPI 522          
BLAST of Phospholipase B-like vs. Ensembl Medaka
Match: plbd1 (phospholipase B domain containing 1 [Source:NCBI gene;Acc:101172083])

HSP 1 Score: 232.646 bits (592), Expect = 2.279e-68
Identity = 166/516 (32.17%), Postives = 257/516 (49.81%), Query Frame = 3
Query:  306 INSTGWAHLSLTS----MNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTF--CKNLKQYFSTNIESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSP-TYDQQPAFDWRNNKDPSVKHNMHPIKWNF-----KPII 1811
            ++++GW+ L + +        DE+  + +G LEG +T   +  H +N YP     P      K   +   + +   +  ++     WK     + QI GLQ       K Q K       + L   +F I  L A GDL  L   L   +        K+ G G CSA IK + G  ++  AH +W  Y   +RI K+++F         + P      +SFSSYP  + S+DDFY+  +GL+ T+TT   +N+SL+  +  K+   +L + RV+ A+ L+++G EW  TFS +NSGTYNNQ+MV++ + +K    G  + +G L V EQIP L+ Y D T  LR  YW SYNIPF +++Y +SGY +M K+YG+ F+ D  PRA IF+RD   V +  SL  +MR+ND++ DP ++ +        N +  +S  + P+G Y             D K T   ++       ++ P T D  P F W  +K  S+ H   P  +NF     KP++
Sbjct:   56 LSTSGWSILEIRAGYGKTPEDDEITFFLAGYLEGFLTAQQMMDHYTNMYPQLVKDPKVLDPVKTFMENQDSWVRQQVKLNQSSDPLWKHAGFIMAQIDGLQAGAAAWAKKQGK-------KPL--SLFDIQFLNAVGDLLDLIPALV-PDSKPLLRDFKLPGMGHCSALIKMLPGFENLLFAHSSWYTYAATMRIYKHWDFH-------ISEPHTATGKLSFSSYPGFLVSLDDFYLLGSGLMMTQTTNNVFNSSLFDTVTPKS---LLAWQRVRLAHSLARTGEEWAKTFSKYNSGTYNNQYMVLDRSKVK---LGHSLDDGALTVVEQIPSLVEYSDQTQALRRGYWPSYNIPFHRSIYTLSGYVEMWKEYGEDFSYDLCPRAKIFRRDQAAVKDLDSLKHIMRFNDYKKDPYSKGDPCKSICCRNDL--KSGKSSPDGCY-------------DSKVTDFFMAGDFTAEAVNGPTTQDGLPPFYW--DKFSSISHQGLPRFYNFTFVTMKPLM 531          
BLAST of Phospholipase B-like vs. Ensembl Medaka
Match: si:ch73-139e5.2 (phospholipase B-like 1 [Source:NCBI gene;Acc:101162874])

HSP 1 Score: 221.861 bits (564), Expect = 2.962e-64
Identity = 146/425 (34.35%), Postives = 215/425 (50.59%), Query Frame = 3
Query:  357 DELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTN---IESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAAR--KVIGDGSCSAFIKYVKG--DIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKY 1610
            DE   + +G LEG +T   + +H +N YP            LK + S         +   R     W+ + L L Q+ GL        K++ ++             F +  L   GDL  L   L    +++  AA   ++ G G C+A IK + G  ++   H +W  Y   +RI K+++F         + P      +SFSSYP  + S+DDFY+  +GL+ T+T+IG +NASL+  L   +   +L + RV+ AN L+K G EW   FS HNSGTYN+Q+MVV+ + +   R    I NG L V EQIPG +VY D T  LR  YW SYNIPF   +Y +SGY  M  +YGD F+ D  PRA I +RD   V++ +SL  +MRYN+++ DP ++ +        N +  R   + P G Y
Sbjct:   93 DETTFFLAGYLEGYLTAGQMISHYANMYPQLIKDERVLIP-LKTFLSKQDDWAREQVKLRRNSDPLWRHLGLILAQLDGLHAGAAQWAKSKHRE---------PLSPFAVQFLNGIGDLLDLVPALT-PRFNASVAAGAFRMPGMGHCTALIKVLPGFENLLLGHSSWYTYAATMRIYKHWDF-------RVSDPNAATGKMSFSSYPGFLMSLDDFYLLGSGLLMTQTSIGVFNASLFSGLNPHS---LLAWQRVRLANSLAKGGEEWAEVFSKHNSGTYNSQYMVVDLSKVSLRR---SIRNGALTVVEQIPGRVVYSDQTRTLRRGYWPSYNIPFNAEIYNLSGYGVMWDRYGDDFSYDLCPRAKILRRDQAKVSDLNSLKYMMRYNNYKRDPYSKGHPCKTICCRNDLRPRR--SRPGGCY 491          
BLAST of Phospholipase B-like vs. Planmine SMEST
Match: SMESG000022762.1 (SMESG000022762.1)

HSP 1 Score: 1161.75 bits (3004), Expect = 0.000e+0
Identity = 558/559 (99.82%), Postives = 558/559 (99.82%), Query Frame = 3
Query:  147 KLAICDDIYFVNPTDGAQEMSIEAVKNGTGYSFRLVKGHGSKSLITKATFIQQINSTGWAHLSLTSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKGDIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPIITPFP 1823
            KLAICDDIYFVNPTDGAQEMSIEAVKNGTGYSFRLVKGHGSKSLI KATFIQQINSTGWAHLSLTSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKGDIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPIITPFP
Sbjct:   13 KLAICDDIYFVNPTDGAQEMSIEAVKNGTGYSFRLVKGHGSKSLIAKATFIQQINSTGWAHLSLTSMNYPDELQAYYSGILEGIITKPLIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESIIVKSRYQGGYWKMIRLQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSALSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKGDIYAAHVTWSPYNLMLRITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLVSTETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSLHNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDYLRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAHTVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKYPFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDPSVKHNMHPIKWNFKPIITPFP 571          
The following BLAST results are available for this feature:
BLAST of Phospholipase B-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PLBD22.494e-12341.07phospholipase B domain containing 2 [Source:HGNC S... [more]
PLBD28.335e-10737.69phospholipase B domain containing 2 [Source:HGNC S... [more]
PLBD13.396e-6133.01phospholipase B domain containing 1 [Source:HGNC S... [more]
back to top
BLAST of Phospholipase B-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y37D8A.22.066e-11740.30Putative phospholipase B-like 1 [Source:UniProtKB... [more]
F09B12.32.191e-10536.91Putative phospholipase B-like 2 [Source:UniProtKB... [more]
Y54F10AM.81.266e-10035.63Putative phospholipase B-like 3 [Source:UniProtKB... [more]
back to top
BLAST of Phospholipase B-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lama5.454e-3025.16gene:FBgn0016031 transcript:FBtr0077159[more]
lama5.454e-3025.16gene:FBgn0016031 transcript:FBtr0333595[more]
lama5.454e-3025.16gene:FBgn0016031 transcript:FBtr0077160[more]
lama5.454e-3025.16gene:FBgn0016031 transcript:FBtr0077161[more]
back to top
BLAST of Phospholipase B-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLBD22.655e-13442.75zgc:158619 [Source:ZFIN;Acc:ZDB-GENE-070209-116][more]
plbd13.886e-7434.77phospholipase B domain containing 1 [Source:ZFIN;A... [more]
si:ch73-139e5.26.715e-6533.70si:ch73-139e5.2 [Source:ZFIN;Acc:ZDB-GENE-130531-4... [more]
CR354584.11.463e-6331.95si:ch73-139e5.2 [Source:NCBI gene;Acc:792904][more]
CR354584.11.478e-6331.95si:ch73-139e5.2 [Source:NCBI gene;Acc:792904][more]
back to top
BLAST of Phospholipase B-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnl22.594e-13441.76cyclin L2 [Source:Xenbase;Acc:XB-GENE-956522][more]
ccnl22.003e-13145.19cyclin L2 [Source:Xenbase;Acc:XB-GENE-956522][more]
ccnl21.247e-13045.17cyclin L2 [Source:Xenbase;Acc:XB-GENE-956522][more]
ccnl28.648e-13045.13cyclin L2 [Source:Xenbase;Acc:XB-GENE-956522][more]
ccnl26.588e-12945.61cyclin L2 [Source:Xenbase;Acc:XB-GENE-956522][more]
back to top
BLAST of Phospholipase B-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Plbd22.875e-12440.94phospholipase B domain containing 2 [Source:MGI Sy... [more]
Plbd18.895e-6933.08phospholipase B domain containing 1 [Source:MGI Sy... [more]
back to top
BLAST of Phospholipase B-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4QQW8|PLBL2_RAT3.817e-12441.13Putative phospholipase B-like 2 OS=Rattus norvegic... [more]
sp|Q3TCN2|PLBL2_MOUSE2.011e-12340.94Putative phospholipase B-like 2 OS=Mus musculus OX... [more]
sp|Q8NHP8|PLBL2_HUMAN1.198e-12241.07Putative phospholipase B-like 2 OS=Homo sapiens OX... [more]
sp|Q2KIY5|PLBL2_BOVIN4.475e-11942.21Putative phospholipase B-like 2 OS=Bos taurus OX=9... [more]
sp|Q9XWV2|PLBL1_CAEEL2.628e-11640.30Putative phospholipase B-like 1 OS=Caenorhabditis ... [more]
back to top
BLAST of Phospholipase B-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Q8K2633.027e-14846.05Phospholipase B-like OS=Liphistius thaleban OX=190... [more]
A0A4Q8K1X13.027e-14846.05Phospholipase B-like OS=Liphistius sp. SGP-2016 OX... [more]
A0A4Q8K2563.438e-14846.05Phospholipase B-like OS=Liphistius thaleban OX=190... [more]
A0A4Q8K1W63.445e-14846.05Phospholipase B-like OS=Liphistius sp. SGP-2016 OX... [more]
A0A4Q8K3A33.595e-14846.05Phospholipase B-like OS=Liphistius sp. SGP-2016 OX... [more]
back to top
BLAST of Phospholipase B-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1586195.064e-13241.24phospholipase B domain containing 2 [Source:NCBI g... [more]
zgc:1586194.004e-12943.00phospholipase B domain containing 2 [Source:NCBI g... [more]
zgc:1586192.453e-11538.12phospholipase B domain containing 2 [Source:NCBI g... [more]
si:ch73-139e5.25.728e-7032.54phospholipase B-like 1 [Source:NCBI gene;Acc:10303... [more]
plbd19.723e-6633.20phospholipase B domain containing 1 [Source:NCBI g... [more]
back to top
BLAST of Phospholipase B-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1586192.600e-11139.92phospholipase B domain containing 2 [Source:HGNC S... [more]
PLBD18.542e-6231.70phospholipase B domain containing 1 [Source:HGNC S... [more]
PLBD13.616e-6130.77phospholipase B domain containing 1 [Source:HGNC S... [more]
back to top
BLAST of Phospholipase B-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phospholipase B-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO399179.586e-8736.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461522.481e-7230.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425157.443e-3537.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipase B-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1586196.098e-13541.02phospholipase B domain containing 2 [Source:NCBI g... [more]
zgc:1586191.206e-13341.02phospholipase B domain containing 2 [Source:NCBI g... [more]
zgc:1586191.847e-12339.64phospholipase B domain containing 2 [Source:NCBI g... [more]
plbd12.279e-6832.17phospholipase B domain containing 1 [Source:NCBI g... [more]
si:ch73-139e5.22.962e-6434.35phospholipase B-like 1 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Phospholipase B-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022762.10.000e+099.82SMESG000022762.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008623 ID=SMED30008623|Name=Phospholipase B-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1912bp
AAATCATCAAAGTTCGTTACAAAGTTCAAAAGTTATAAATTTGTAATATT
ATTCAATTGATAAAACTTCTTAAATAAAATAGAAAATAGTTTCTTGCCTA
GAATTTTGACATGATTTTGATTGTCTCACTTTTACTTTCGGTATTGAAAC
TTGCTATTTGCGATGATATTTATTTCGTCAATCCGACTGATGGGGCTCAA
GAAATGTCAATAGAAGCTGTTAAAAACGGAACTGGCTATTCATTTCGTTT
AGTAAAAGGACATGGATCTAAATCGCTCATTACCAAAGCAACCTTCATTC
AGCAAATTAATTCGACTGGATGGGCTCATTTGTCTCTAACGTCCATGAAT
TATCCTGACGAATTGCAAGCTTACTATTCCGGAATCCTTGAAGGTATCAT
TACAAAACCGCTTATTAAAGCACATATTTCAAATACCTATCCAGATTATT
GTTCAAAACCTTCAACATTTTGTAAAAATCTTAAACAATACTTTTCTACA
AATATTGAGTCAATTATTGTAAAATCTAGATATCAAGGTGGATACTGGAA
AATGATTCGATTGCAATTGTGGCAAATCAAAGGATTACAGGATGCTTATG
ACAACAGTTGGAAGACTCAATCAAAAGATATTAATGAAAATTATTTGAGA
CAGTTGAAAGATCAAGTCTTCGGAATATTCCTTCTTCAAGCTGATGGTGA
TTTGTCTGCCTTGAGTAGCATACTTGGAGGCTCAGAATATCATTCAAGGT
TTGCAGCTCGCAAAGTTATTGGTGACGGAAGCTGTTCTGCATTCATTAAA
TATGTAAAAGGCGATATTTACGCAGCCCATGTTACCTGGAGCCCATATAA
TTTGATGCTAAGGATAACAAAGTATTACAATTTCCCATATCGAATTAACT
TCGAAGTCGCAAATAGTCCAATTATCCCCGGACAGAATATTAGTTTCTCT
TCCTATCCCGCTATAATATCTTCCATTGATGATTTCTACGTGACATCAGC
TGGATTGGTCAGCACTGAGACAACGATTGGAAATTATAATGCCTCCCTTT
GGAAACCTTTGAAAACTAAAGCAGCTTCAATTGTCTTGGAATATTTGAGA
GTCCAAACTGCAAATCGTCTATCGAAATCAGGATTGGAATGGACCACTAC
TTTCTCCCTGCATAATAGCGGCACATACAATAATCAGTGGATGGTCGTCA
ATTACAACCTTATGAAGGGTCACAGGTTCGGTATGCCAATTCCTAATGGA
GTTCTTTATGTTGCTGAGCAAATACCTGGCCTTATTGTTTACAAGGACCT
CACTGATTATCTTCGAACTTCCTATTGGGCCAGTTATAATATTCCATTTT
TCAAGAATGTCTATCAAATCAGTGGCTATGCGGACATGGCAAAAAAATAC
GGTGATTTCTTCACCATTGATAAAGGGCCCCGAGCCTTGATTTTCAAAAG
AGATGCCCACACAGTGACAAATTTCCATTCATTAATGAAATTAATGAGAT
ATAATGATTTTCAAAATGATCCATTGGCACGGTGCAATTGTACCCCGCCT
TACAGTGGAGAAAACGGTATATCATCGAGATCGGATTTAAATGACCCAAA
TGGGAAATATCCCTTTGGAGCTCTCGCTTATCGACTACATGGAGGCACAG
ACTTGAAATTTACAAGTTCAGTGTTATCAAAAGCGATGCGTTTTGTTGGA
ATAAGTAGTCCGACATATGATCAGCAGCCTGCGTTTGATTGGAGGAATAA
TAAAGATCCGTCGGTCAAGCATAACATGCACCCGATTAAATGGAATTTCA
AACCAATAATTACACCTTTTCCTTGAAATTTGAAACAAGAATGATTTTGA
TTAATGTTTTAAATTAATTTTTCTTTCTTTGATGAATTTTAAATTTTAAT
AAATTCGAATCA
back to top

protein sequence of SMED30008623-orf-1

>SMED30008623-orf-1 ID=SMED30008623-orf-1|Name=SMED30008623-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=572bp
MILIVSLLLSVLKLAICDDIYFVNPTDGAQEMSIEAVKNGTGYSFRLVKG
HGSKSLITKATFIQQINSTGWAHLSLTSMNYPDELQAYYSGILEGIITKP
LIKAHISNTYPDYCSKPSTFCKNLKQYFSTNIESIIVKSRYQGGYWKMIR
LQLWQIKGLQDAYDNSWKTQSKDINENYLRQLKDQVFGIFLLQADGDLSA
LSSILGGSEYHSRFAARKVIGDGSCSAFIKYVKGDIYAAHVTWSPYNLML
RITKYYNFPYRINFEVANSPIIPGQNISFSSYPAIISSIDDFYVTSAGLV
STETTIGNYNASLWKPLKTKAASIVLEYLRVQTANRLSKSGLEWTTTFSL
HNSGTYNNQWMVVNYNLMKGHRFGMPIPNGVLYVAEQIPGLIVYKDLTDY
LRTSYWASYNIPFFKNVYQISGYADMAKKYGDFFTIDKGPRALIFKRDAH
TVTNFHSLMKLMRYNDFQNDPLARCNCTPPYSGENGISSRSDLNDPNGKY
PFGALAYRLHGGTDLKFTSSVLSKAMRFVGISSPTYDQQPAFDWRNNKDP
SVKHNMHPIKWNFKPIITPFP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007000PLipase_B-like
Vocabulary: molecular function
TermDefinition
GO:0004620phospholipase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0009395phospholipid catabolic process
GO:0016042lipid catabolic process
GO:0031161phosphatidylinositol catabolic process
GO:0046338phosphatidylethanolamine catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.60.60.30coord: 33..570
e-value: 1.7E-180
score: 603.1
NoneNo IPR availablePANTHERPTHR12370:SF3PHOSPHOLIPASE B-LIKE 2-RELATEDcoord: 5..566
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.893
IPR007000Phospholipase B-likePFAMPF04916Phospholip_Bcoord: 39..566
e-value: 1.2E-148
score: 496.1
IPR007000Phospholipase B-likePANTHERPTHR12370UNCHARACTERIZEDcoord: 5..566