Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A

Overview
NamePhosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A
Smed IDSMED30008617
Length (bp)2068
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30008617) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30008617) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30008617) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A (SMED30008617) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008617

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30008617SMESG000022530.1 Contig35820newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008617SMESG000022530.1 Contig35820uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 182.57 bits (462), Expect = 2.347e-50
Identity = 107/340 (31.47%), Postives = 184/340 (54.12%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLS---KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
            IW NL+ ++ P  +       +L YN +++  Q   G  +  PG+G T S+E L+  K+S  +YF  ++  ++ +  Y + + +R APYD+R++P  N  +      ++EE +       VV++AHS+G +  L+FL +  + WK  Y+ AFV+  AP GG  K L+   SG +  +P    +  RE +RS  ST++LLP    ++  ++ VQT   NYT  DY   F+DI +  G+ M   T+    V   +    Q+ C++G  VPT     Y+S FP+ +P+I +G+GDGTVN+ S   C+ W+S     V   ++    H  +L + + ++++K++
Sbjct:   75 IWLNLE-LLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWG-YTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGP-VVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGL--VEATMPPGVQLHCLYGTGVPTPDSFYYES-FPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRV 408          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: LCAT (lecithin-cholesterol acyltransferase [Source:HGNC Symbol;Acc:HGNC:6522])

HSP 1 Score: 164.081 bits (414), Expect = 1.609e-43
Identity = 102/339 (30.09%), Postives = 181/339 (53.39%), Query Frame = 2
Query:  185 ETKETNLIWFNLKYMMFPSYLSKEFKLD-----YNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*NTK-FMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMP-RNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEP-EIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILF 1162
            +T++   IW +L  M  P  L  +  +D     YN S+ L+ +  G +I  PG+G T SVE L+   +SK A +   + + L  + YV+++T+RAAPYD+R  P   + + +  A LVEE  +    + V +I HSLG L  L+FL +  + WK  ++  F++  AP GGS+K +    SG + G+P  +SI  +E +R  +++ ++ P  + +    + + T   NYT  D+   F D+++  G+ M+ +++   +   A  G+ +++C++G+ +PT +   YD  FP  +P  + Y +GD TV   S   C  W+      V  + +  + H N++F
Sbjct:   77 KTEDFFTIWLDLN-MFLP--LGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLD---SSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHA-AYGKPVFLIGHSLGCLHLLYFLLRQPQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPA-PGV-EVYCLYGVGLPTPRTYIYDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVF 406          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: LCAT (lecithin-cholesterol acyltransferase [Source:HGNC Symbol;Acc:HGNC:6522])

HSP 1 Score: 125.561 bits (314), Expect = 1.033e-31
Identity = 79/257 (30.74%), Postives = 140/257 (54.47%), Query Frame = 2
Query:  185 ETKETNLIWFNLKYMMFPSYLSKEFKLD-----YNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*NTK-FMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMP-RNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFS 934
            +T++   IW +L  M  P  L  +  +D     YN S+ L+ +  G +I  PG+G T SVE L+   +SK A +   + + L  + YV+++T+RAAPYD+R  P   + + +  A LVEE  +    + V +I HSLG L  L+FL +  + WK  ++  F++  AP GGS+K +    SG + G+P  +SI  +E +R  +++ ++ P  + +    + + T   NYT  D+   F D+++  G+ M+ +++   +
Sbjct:    5 KTEDFFTIWLDLN-MFLP--LGVDCWIDNTRVVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLD---SSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHA-AYGKPVFLIGHSLGCLHLLYFLLRQPQAWKDRFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWPEDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLA 254          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 118.242 bits (295), Expect = 1.304e-28
Identity = 66/202 (32.67%), Postives = 109/202 (53.96%), Query Frame = 2
Query:  608 QMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
            +  + WK  Y+ AFV+  AP GG  K L+   SG +  +P    +  RE +RS  ST++LLP    ++  ++ VQT   NYT  DY   F+DI +  G+ M   T+    V   +    Q+ C++G  VPT     Y+S FP+ +P+I +G+GDGTVN+ S   C+ W+S     V   ++    H  +L + + ++++K++
Sbjct:  116 RQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGL--VEATMPPGVQLHCLYGTGVPTPDSFYYES-FPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRV 314          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Match: PLA2G15 (phospholipase A2 group XV [Source:HGNC Symbol;Acc:HGNC:17163])

HSP 1 Score: 101.293 bits (251), Expect = 6.619e-23
Identity = 69/221 (31.22%), Postives = 113/221 (51.13%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLS---KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*NTKFMK--------------------YFASLVE--ETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSIL-YREIERSFSSTAYLLP 790
            IW NL+ ++ P  +       +L YN +++  Q   G  +  PG+G T S+E L+  K+S  +YF  ++  ++ +  Y + + +R APYD+R++P  T++ +                    YF +L E  E         VV++AHS+G +  L+FL +  + WK  Y+ AFV+  AP GG  K L+   SG +  +P    L  RE +RS  ST++LLP
Sbjct:   75 IWLNLE-LLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWG-YTRGEDVRGAPYDWRRAP--TQWFRLQDPSHLTPAWLWPADENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLP 291          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Celegans
Match: M05B5.4 (pep chromosome:WBcel235:I:7188465:7190581:1 gene:WBGene00010872.1 transcript:M05B5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M05B5.4)

HSP 1 Score: 184.111 bits (466), Expect = 2.287e-51
Identity = 111/345 (32.17%), Postives = 191/345 (55.36%), Query Frame = 2
Query:  206 IWFNLKYM--MFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*N-TKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQ-MDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFG-----MPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSK-FPNVEPEIFYGEGDGTVNINSLRNCRFWKS------VSYMQIKKVNHNNILFDPSYISFIKK 1192
            +W NL+    +     +   +L +N++T L +++ G  I   G+G T SVE L+  K S+  YF ++++ M+ +  Y + K +  AP+D+RKSP     ++    SL+E T+   +NQ++V++ HS+G  + L+FL   +D+ WK  Y+ +FV+ +AP  GS++ ++   SG +       +P +S+  R ++RSFSS+A+L P P+ +   +IL  T  +NYT  +    F+DINYM G+E + K  +  + N +  G+  + CI+G  VPT +   +    FP+  P  F G+GDGTVN  S   C  W        V+  ++ + +H  IL  P+ I  ++K
Sbjct:   72 LWLNLQLFTPLVIDCWADNMQLVFNTTTGLSENMPGVDIRVAGFGATESVEWLDKSKASQGRYFFDIVDSMVSWG-YRRGKNVIGAPFDWRKSPNELNDYLIQLKSLIETTYRWNDNQKIVLVGHSMGNPLSLYFLNNYVDQAWKDKYISSFVSLAAPWAGSMQIVRLFASGYNMNYYRVILPPSSL--RAMQRSFSSSAFLFPSPVAWKPHEILATTADKNYTVGNIKEFFQDINYMVGWEQY-KQAARLNGNLSSPGVP-VHCIYGTGVPTPEKFSWAPGYFPDYPPTEFMGDGDGTVNKKSATVCTNWIGNNNGYKVTVHEVFQADHMAILKHPNAIELVRK 411          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG31683 (gene:FBgn0051683 transcript:FBtr0330662)

HSP 1 Score: 179.489 bits (454), Expect = 1.823e-49
Identity = 106/344 (30.81%), Postives = 182/344 (52.91%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLS--KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGS---SFGMPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRY-DSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKITQ 1201
            +W +L+ ++ P         KL Y+  T+   +  G +   PGWG+   VE ++  K S  AYF+++ NE+++   Y++ + +  APYDFRK+P  N +F      LVE+++   N   V  I+HS+G+L+ L FL +    WK  Y+   ++ +    GS KA++    G    SF +    +   +I  +  STA+LLP P+ +  T++L  T  RNYT       F+D++YM G+EM   T  Y + N     + ++ C++G  + T + L+Y  S      P++  G GDGTVN  SLR C++W       ++ + ++ V+H +IL +P  + +I+ + Q
Sbjct:   81 LWLDLEQLVIPIVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLG-YIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQI--THPSTAWLLPSPLFWKPTEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRY-NRNFDPPNV-ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQ 419          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG31683 (gene:FBgn0051683 transcript:FBtr0081365)

HSP 1 Score: 179.489 bits (454), Expect = 1.823e-49
Identity = 106/344 (30.81%), Postives = 182/344 (52.91%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLS--KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGS---SFGMPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRY-DSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKITQ 1201
            +W +L+ ++ P         KL Y+  T+   +  G +   PGWG+   VE ++  K S  AYF+++ NE+++   Y++ + +  APYDFRK+P  N +F      LVE+++   N   V  I+HS+G+L+ L FL +    WK  Y+   ++ +    GS KA++    G    SF +    +   +I  +  STA+LLP P+ +  T++L  T  RNYT       F+D++YM G+EM   T  Y + N     + ++ C++G  + T + L+Y  S      P++  G GDGTVN  SLR C++W       ++ + ++ V+H +IL +P  + +I+ + Q
Sbjct:   81 LWLDLEQLVIPIVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLG-YIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQI--THPSTAWLLPSPLFWKPTEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRY-NRNFDPPNV-ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQ 419          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG18858 (gene:FBgn0042175 transcript:FBtr0332971)

HSP 1 Score: 178.333 bits (451), Expect = 3.903e-49
Identity = 105/344 (30.52%), Postives = 182/344 (52.91%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLS--KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGS---SFGMPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRY-DSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKITQ 1201
            +W +L+ ++ P         KL Y+  T+   +  G +   PGWG+   VE ++  K S  AYF+++ NE+++   Y++ + +  APYDFRK+P  N +F      LVE+++   N   V  I+HS+G+L+ L FL +    WK  Y+   ++ +    GS KA++    G    SF +    +   +I  +  STA+LLP P+ +  +++L  T  RNYT       F+D++YM G+EM   T  Y + N     + ++ C++G  + T + L+Y  S      P++  G GDGTVN  SLR C++W       ++ + ++ V+H +IL +P  + +I+ + Q
Sbjct:   81 LWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLG-YIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQI--THPSTAWLLPSPLFWKPSEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRY-NRNFDPPNV-ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQ 419          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Match: CG18858 (gene:FBgn0042175 transcript:FBtr0081364)

HSP 1 Score: 178.333 bits (451), Expect = 3.903e-49
Identity = 105/344 (30.52%), Postives = 182/344 (52.91%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLS--KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGS---SFGMPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRY-DSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKITQ 1201
            +W +L+ ++ P         KL Y+  T+   +  G +   PGWG+   VE ++  K S  AYF+++ NE+++   Y++ + +  APYDFRK+P  N +F      LVE+++   N   V  I+HS+G+L+ L FL +    WK  Y+   ++ +    GS KA++    G    SF +    +   +I  +  STA+LLP P+ +  +++L  T  RNYT       F+D++YM G+EM   T  Y + N     + ++ C++G  + T + L+Y  S      P++  G GDGTVN  SLR C++W       ++ + ++ V+H +IL +P  + +I+ + Q
Sbjct:   81 LWLDLEQLVIPMVYCWIDNVKLYYDKVTRTTHNTPGVETRIPGWGNPEVVEWIDPTKNSAGAYFKDIANELVKLG-YIRKQNIHGAPYDFRKAPNENQQFFIDLKQLVEDSYEANNQSAVTFISHSMGSLMTLVFLQEQTLQWKAKYVKRMISLAGVWAGSFKAVKVFAMGDDLDSFALSAKILKAEQI--THPSTAWLLPSPLFWKPSEVLAMTPSRNYTMAQLEEFFKDLDYMTGWEMRKDTIRY-NRNFDPPNV-ELHCLYGEGIDTVERLQYKKSDISGETPKLIMGLGDGTVNQRSLRACKYWAGYSKAPINTLALQNVDHLHILSNPDVLKYIRTVMQ 419          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Zebrafish
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 176.022 bits (445), Expect = 1.047e-47
Identity = 108/348 (31.03%), Postives = 183/348 (52.59%), Query Frame = 2
Query:  185 ETKETNLIWFNLKYMMFPSYLS---KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*NTKFMKYFASLVE--ETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSIL-YREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWK-----SVSYMQIKKVNHNNILFDPSYISFIKKI 1195
            +T++   +W NL+ ++ P  +       +L YN +  L +   G  I  PG+G+T S+E L+  K S   YF  ++  ++++  Y +N  +R APYD+RK+P   K  +YF  L +  E  ++     VV+IAHS+G +  L+FL    + WK  Y+ A+V+   P  G  K L+   +G +  +P  S L  R  +R+  ST +LLP    +    +LV T    YT  DY   F+DI+Y  G+ M   T+   S  +   G+  + C++G  +PT +   Y + FP+ +P +  G+GDGTVN+ S   C+ WK     +V ++++    H  +L + + + +IKK+
Sbjct:  125 KTEDYFTLWLNLE-LLVPVAIDCWIDNMRLLYNRTNHLSEPPPGVDIRVPGFGETYSLEYLDPSKRSVGMYFFTIVQSLVDWG-YTRNDDVRGAPYDWRKAPNENK--EYFLRLQQMIEEMAHKAGGPVVLIAHSMGNMYTLYFLNHQPQAWKDRYIKAYVSLGPPWAGVAKTLRVMATGDNNRIPVISPLKIRTQQRTAVSTTWLLPYAHTWPKDMVLVYTPNTTYTVQDYQRFFKDIDYEDGWAMRQDTEPLVSALQP-PGVP-VHCLYGTGIPTPQGYNY-TNFPDTDPAVINGDGDGTVNLISAIQCKRWKGQQKQAVEWLELPGNEHVAMLLNSTTVDYIKKV 465          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Zebrafish
Match: lcat (lecithin-cholesterol acyltransferase [Source:ZFIN;Acc:ZDB-GENE-010716-3])

HSP 1 Score: 169.088 bits (427), Expect = 1.496e-45
Identity = 94/322 (29.19%), Postives = 178/322 (55.28%), Query Frame = 2
Query:  260 KLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMP-RNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEP-EIFYGEGDGTVNINSLRNCRFW-----KSVSYMQIKKVNHNNILFDPSYISFIKKITQ 1201
            ++ YN +T+   +  G  +  PG+G T+ +E L+      T YF  ++  ++    YV+N+T+R APYD+R +P    ++     +LVEE   +   Q V ++ HS+G+   L+FL Q  + WK  Y+  F++  AP GG+VK L+   SG + G+P  ++I  RE +R  ++  +++P    +      + T   NYT+ DY   F+DIN+  G+ M+  T++  +      G+ +++C++G+ +PT     YD +FPN +P +I Y +GD TV+  S+  C+ W     ++V   + + + H +++F+   ++ +++I +
Sbjct:  105 RIVYNRTTRKTSNAPGVDVRVPGFGQTHPIEFLD--LNKLTGYFHTMVQHLVSIG-YVRNETVRGAPYDWRIAPNEQEEYFSRLKNLVEE-MHDEYKQPVYLLGHSMGSNYILYFLNQQTQDWKDHYIKGFISLGAPWGGAVKPLRVLASGENDGIPFVSNIKIREEQRMTTTNPWMIPSEETWPKDHTFISTPFFNYTNQDYMQFFKDINFEDGWYMWDDTRN-LTAGLPAPGV-EVYCLYGVGLPTPVTYIYDEQFPNADPIDILYDDGDDTVDSRSMSLCKRWIGKQEQAVHVTEFRGMPHLDMVFNHKSLTTVQRILE 420          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Xenopus
Match: fam53c (family with sequence similarity 53 member C [Source:Xenbase;Acc:XB-GENE-988933])

HSP 1 Score: 186.037 bits (471), Expect = 1.583e-51
Identity = 119/346 (34.39%), Postives = 186/346 (53.76%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLS---KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*NTK-FMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNS-ILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEAL--KGIKQIFCIHGIKVPTAKLLRYDSKFPNVEP--EIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKITQ 1201
            IW NL  M  P  +       ++ YN +T++  +  G  +  PG+G T SVE L+  K+    YF  L+  ++  + YV+++T+RAAPYD+R +P   K + +   SL+EE  SN  N+ V II HSLG L  L+FL    + WK  Y+  F++  AP GG+VK L   +SG + G+P  S I  RE +R  ++  ++LP  + +  + + + T  RNYT  +Y  LF DI +  G+ M+  TK      E L   G+ +++CI+G  +PT +   Y   FPN EP  +I Y +GD TV+  S+  C+ W S     V   ++  + H N++F    ++ I  I Q
Sbjct:   86 IWLNLN-MFLPLGIDCWIDNIRVVYNKTTRMASNAPGVDVHVPGFGKTYSVEYLD--KSKLAGYFHTLVQNLVN-NGYVRDQTVRAAPYDWRIAPNGQKEYFEKLKSLIEE-MSNKYNESVFIIGHSLGNLYLLYFLNHQPQEWKDKYVKGFISLGAPWGGAVKPLLVLMSGDNHGIPMVSNIKIREEQRMTTTNPWMLPTNLGWPESHVFISTPSRNYTYKNYRKLFHDIGFEDGWYMWEDTKGLL---EGLPPPGV-EVYCIYGTGIPTPETYIYGEGFPN-EPAIDIKYSDGDDTVHTRSMELCKRWISQQKQKVHIHELPGIQHLNMVFSNETLTLINDILQ 421          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Xenopus
Match: PLA2G15 (phospholipase A2 group XV [Source:NCBI gene;Acc:100124780])

HSP 1 Score: 184.496 bits (467), Expect = 7.700e-51
Identity = 113/319 (35.42%), Postives = 178/319 (55.80%), Query Frame = 2
Query:  260 KLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
            +L YN ++K     +G  I  PG+G T S+E L+  K S  +YF  L+  ++++  Y +++ +R APYD+RK+P  N+ +      LVE  F +  +  VV++AHS+G L  L+FL Q  + WK  Y+H+FVA  AP GG  K L    SG +  +P  +S+  R+ +RS  ST +LLP    +   ++ V+T  +NYT  DY   + DI +  G+EM  +T+   S      G+ ++ C++G  V T     YDS FP+ +P   YG GDGTVN+ S   C  W++     VS +++    H  +L + S IS++KK+
Sbjct:  116 RLVYNKTSKTTAPPEGVDIRVPGFGQTYSLEFLDPSKRSVGSYFYTLVQSLVDWG-YTRDENVRGAPYDWRKAPNENSDYFVALRKLVESMFESYQSP-VVLVAHSMGNLYTLYFLNQQTQDWKDKYIHSFVALGAPWGGVSKTLHVLASGDNNRIPVISSLRIRDQQRSAVSTNWLLPYNNTWPQEKVFVRTPNKNYTIKDYRVFYEDIGFQDGWEMRQETEGLISSLNP-PGV-EVHCLYGTGVDTPDSFLYDS-FPDKDPTTVYGGGDGTVNLESALQCGKWRNQQRQKVSLVELPGNEHIAMLSNISTISYVKKV 429          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Match: Pla2g15 (phospholipase A2, group XV [Source:MGI Symbol;Acc:MGI:2178076])

HSP 1 Score: 179.874 bits (455), Expect = 1.562e-49
Identity = 104/321 (32.40%), Postives = 182/321 (56.70%), Query Frame = 2
Query:  260 KLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEAL--KGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
            +L YN +++  Q   G  +  PG+G+T S+E L+  K +  +YF  ++  ++ +  Y + + +R APYD+R++P  N  +      ++EE +       VV++AHS+G +  L+FL +  ++WK  Y+HAFV+  AP GG  K L+   SG +  +P    +  RE +RS  ST++LLP    ++  ++ V T   NYT  DY   FRDI +  G+ M   T+    + EA+   G+ ++ C++G  VPT     Y+S FP+ +P+I +G+GDGTVN+ S+  C+ W+S     VS  ++    H  +L + + ++++K++
Sbjct:   95 RLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWG-YTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGP-VVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTE---GLVEAMTPPGV-ELHCLYGTGVPTPNSFYYES-FPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRV 408          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Match: Lcat (lecithin cholesterol acyltransferase [Source:MGI Symbol;Acc:MGI:96755])

HSP 1 Score: 170.244 bits (430), Expect = 8.420e-46
Identity = 100/320 (31.25%), Postives = 174/320 (54.37%), Query Frame = 2
Query:  260 KLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*NT-KFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMP-RNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEP-EIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
            ++ YN S+  + +  G +I  PG+G T SVE ++D K +   Y   L+  ++  + YV+++T+RAAPYD+R +P    ++ K  A LVEE ++    + V +I HSLG L  LHFL +  + WK  ++  F++  AP GGS+KA++   SG + G+P  ++I  +E +R  +++ ++LP P V+    + + T   NYT  D+   F D+++  G+ MF +++       A  G+ +++C++G+  PT     YD  FP  +P    Y +GD TV   S   C  W+      V  + + + +H N++F    +  I  I
Sbjct:  104 RIVYNHSSGRVSNAPGVQIRVPGFGKTESVEYVDDNKLA--GYLHTLVQNLVN-NGYVRDETVRAAPYDWRLAPHQQDEYYKKLAGLVEEMYA-AYGKPVFLIGHSLGCLHVLHFLLRQPQSWKDHFIDGFISLGAPWGGSIKAMRILASGDNQGIPILSNIKLKEEQRITTTSPWMLPAPHVWPEDHVFISTPNFNYTVQDFERFFTDLHFEEGWHMFLQSRDLLERLPA-PGV-EVYCLYGVGRPTPHTYIYDHNFPYKDPVAALYEDGDDTVATRSTELCGQWQGRQSQPVHLLPMNETDHLNMVFSNKTLEHINAI 417          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Match: Pla2g15 (phospholipase A2, group XV [Source:MGI Symbol;Acc:MGI:2178076])

HSP 1 Score: 50.8322 bits (120), Expect = 1.544e-6
Identity = 23/75 (30.67%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  257 FKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP 481
             +L YN +++  Q   G  +  PG+G+T S+E L+  K +  +YF  ++  ++ +  Y + + +R APYD+R++P
Sbjct:   94 IRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWG-YTRGEDVRGAPYDWRRAP 167          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q8NCC3|PAG15_HUMAN (Phospholipase A2 group XV OS=Homo sapiens OX=9606 GN=PLA2G15 PE=1 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 1.127e-49
Identity = 107/340 (31.47%), Postives = 184/340 (54.12%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLS---KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
            IW NL+ ++ P  +       +L YN +++  Q   G  +  PG+G T S+E L+  K+S  +YF  ++  ++ +  Y + + +R APYD+R++P  N  +      ++EE +       VV++AHS+G +  L+FL +  + WK  Y+ AFV+  AP GG  K L+   SG +  +P    +  RE +RS  ST++LLP    ++  ++ VQT   NYT  DY   F+DI +  G+ M   T+    V   +    Q+ C++G  VPT     Y+S FP+ +P+I +G+GDGTVN+ S   C+ W+S     V   ++    H  +L + + ++++K++
Sbjct:   75 IWLNLE-LLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWG-YTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGP-VVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGL--VEATMPPGVQLHCLYGTGVPTPDSFYYES-FPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRV 408          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q6XPZ3|PAG15_CANLF (Phospholipase A2 group XV OS=Canis lupus familiaris OX=9615 GN=PLA2G15 PE=1 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 7.523e-49
Identity = 102/320 (31.87%), Postives = 174/320 (54.37%), Query Frame = 2
Query:  257 FKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
             +L YN +++  Q   G  +  PG+G T S+E L+  K+S  +YF  ++  ++++  Y++ + +R APYD+R++P  N  +      ++EE +       VV++AHS+G +  L+FL +  + WK  Y+ AFVA  AP GG  K L+   SG +  +P    +  RE +RS  ST++LLP    ++  +I V T   NYT  DY   F+DI +  G+ M   T+    V   +     + C++G  VPT     Y+S FP+ +P+I +G+GDGTVN+ S   C+ W+      VS   +    H  +L + + ++++K++
Sbjct:   90 IRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWG-YIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGP-VVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGL--VEAMVPPGVPLHCLYGTGVPTPDSFYYES-FPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRV 404          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q8VEB4|PAG15_MOUSE (Phospholipase A2 group XV OS=Mus musculus OX=10090 GN=Pla2g15 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.092e-48
Identity = 104/321 (32.40%), Postives = 182/321 (56.70%), Query Frame = 2
Query:  260 KLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEAL--KGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
            +L YN +++  Q   G  +  PG+G+T S+E L+  K +  +YF  ++  ++ +  Y + + +R APYD+R++P  N  +      ++EE +       VV++AHS+G +  L+FL +  ++WK  Y+HAFV+  AP GG  K L+   SG +  +P    +  RE +RS  ST++LLP    ++  ++ V T   NYT  DY   FRDI +  G+ M   T+    + EA+   G+ ++ C++G  VPT     Y+S FP+ +P+I +G+GDGTVN+ S+  C+ W+S     VS  ++    H  +L + + ++++K++
Sbjct:   95 RLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWG-YTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGP-VVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTE---GLVEAMTPPGV-ELHCLYGTGVPTPNSFYYES-FPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRV 408          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q8WMP9|PAG15_BOVIN (Phospholipase A2 group XV OS=Bos taurus OX=9913 GN=PLA2G15 PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 9.494e-48
Identity = 103/319 (32.29%), Postives = 172/319 (53.92%), Query Frame = 2
Query:  260 KLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
            +L YN ++   Q  +G  +  PG+GDT S+E L+  K+S  +Y   ++  ++ +  Y + K +R APYD+R++P  N  +      ++EE +       VV++AHS+G +  L+FL    + WK  Y+ AFVA   P GG  K L+   SG +  +P   S+  R  +RS  ST +LLP    ++  ++ V+T K NYT  DY   F+DI +  G+ M   T+    V   +    ++ C++G  VPT +   Y+S FP+ +P+I YG GDGTVN+ S  +C  W+      VS   +    H  +L + + ++++K++
Sbjct:   90 RLIYNQTSHTTQFPEGVDVRVPGFGDTFSMEFLDPSKSSVGSYLHTMVESLVSWG-YERGKDVRGAPYDWRRAPNENGPYFLALRKMIEEMYQLYGGP-VVLVAHSMGNMYMLYFLQHQPQDWKDKYIRAFVALGPPWGGVPKTLRVLASGDNNRIPVIRSLKIRAQQRSAVSTTWLLPYSYTWSPQKVFVRTPKANYTLQDYRQFFQDIGFKDGWSMRQDTEGL--VEATVPPGVRLHCLYGTGVPTPESFDYES-FPDRDPKIHYGTGDGTVNLQSALHCHTWRGLQKQEVSLQALPGNEHIAMLANTTTLAYLKRV 403          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Match: sp|Q675A5|PAG15_RAT (Phospholipase A2 group XV OS=Rattus norvegicus OX=10116 GN=Pla2g15 PE=1 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.665e-46
Identity = 102/321 (31.78%), Postives = 180/321 (56.07%), Query Frame = 2
Query:  260 KLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEAL--KGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
            +L YN +++  Q   G  +  PG+G+T S+E L+  K +  +YF  ++  ++ +  Y + + +R APYD+R++P  N  +      ++EE +       VV++AHS+G +  L+FL +  + WK  Y+ AFV+  AP GG  K L+   SG +  +P    +  RE +RS  ST++LLP    ++  ++ V T   NYT  DY   F+DI +  G+ M   T+    + EAL   G+ ++ C++G  VPT     Y++ FP+ +P+I +G+GDGTVN+ S+  C+ W+S     VS  ++    H  +L + + ++++K++
Sbjct:   95 RLVYNRTSRTTQFPDGVDVRVPGFGETFSLEFLDPSKRNVGSYFYTMVESLVGWG-YTRGEDVRGAPYDWRRAPNENGPYFLALQEMIEEMYQMYGGP-VVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQDIGFEDGWFMRQDTQ---GLVEALVPPGV-ELHCLYGTGVPTPNSFYYEN-FPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRV 408          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A0R3TLN4 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8166 PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.023e-86
Identity = 146/337 (43.32%), Postives = 216/337 (64.09%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSIL-YREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFY-GEGDGTVNINSLRNCRFWKS---VSYMQIKKVNHNNILFDPSYISFIKKIT 1198
            IW +L+Y++ P   S  FKL YN+ T+  +D +   I FPGWG+T  V+NL+    S T YF+++  + ++  +YVKN T+R AP+DFRK+P  N  F+    +LVEETF NG NQ+VV++AHS+G+L  LHFL +  + WK  Y+ AF++ SAPLGGS+KAL+ E SG +FG+  +S L YRE++RS  S A+LLP P +++ +++++ T  +NYT +DY   F DI +  GY+MF  TK+  +      G+ +I+CI+   V T   + YDS FP+ +P I Y  +GDGTVN  SL  C+ W     V  + I  VNH +I+ DP +I  +K+I 
Sbjct:   72 IWVDLRYLVSPRTFSDYFKLIYNNKTRKTEDNEKAIITFPGWGETWPVDNLDSRPHSVTKYFEDVTADFIQNPYYVKNFTIRGAPFDFRKAPNENVDFVPKMKALVEETFINGQNQKVVLLAHSMGSLYCLHFLNRQTDAWKRKYIKAFISASAPLGGSIKALKIEASGDNFGIYLDSPLWYREVQRSMPSLAFLLPNPQLWSPSEVVISTPTKNYTVHDYKEFFSDIGFPEGYQMFQDTKATVNPFVPPSGLDEIYCIYSSAVQTPGSMVYDSTFPDAQPTINYEPDGDGTVNARSLAVCQSWSGGVKVKTLVIPGVNHLSIVLDPRFIKAVKEIA 408          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A564Y6A1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3097 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 1.775e-86
Identity = 146/337 (43.32%), Postives = 213/337 (63.20%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSIL-YREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFY-GEGDGTVNINSLRNCRFWKSVSYMQ---IKKVNHNNILFDPSYISFIKKIT 1198
            IW +L+Y++ P      FKL YN+ T+  +D     I FPGWG+T SV+NL+    S T YF+++    ++  +YVKN T+R AP+DFRK+P  N  F+    +LVEETF+NG NQ+VV++AHS+G+L GLHFL      WK  Y+ AF+  SAPLGGS+KAL+ E SG +FG+  +S L YRE++RS  S A+LLP P +++S+++++ T  +NYT  DY   F DI +  GY+M+  TK+     +   G+ +I+CI+   V T   + Y S FP+ +P I Y  +GDGTVN  SL  C+ W  V  ++   I  VNH +I+ DP +I  +K+I 
Sbjct:   72 IWVDLRYLVSPRTFGDYFKLIYNNKTRTTEDNDKAIITFPGWGETWSVDNLDSRPHSVTKYFEDVTAAFIQNPYYVKNFTIRGAPFDFRKAPNENVDFVPKMKALVEETFTNGQNQKVVLLAHSMGSLYGLHFLNNQTVAWKRKYIKAFIVASAPLGGSIKALKIEASGDNFGIYLDSPLWYRELQRSMPSLAFLLPDPRIWSSSEVVIATPTKNYTVYDYKEFFDDIGFPEGYQMYEDTKAIVDPFKPPSGVDEIYCIYSSAVQTPASMLYTSAFPDAQPTINYESDGDGTVNARSLAVCQSWTDVVKVKTQIIPGVNHLSIVLDPRFIKAVKEIA 408          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A4E0RVZ0 (Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A OS=Fasciola hepatica OX=6192 GN=D915_003557 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 2.024e-86
Identity = 149/400 (37.25%), Postives = 236/400 (59.00%), Query Frame = 2
Query:   29 MKKLPCILILFVLLSTNSVVYLRSPLEKKNRINLXXXXXXXXXXXRAYSENLETKETNLIWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP-*NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMP-RNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRY----DSK--FPNVEPEIFYGEGDGTVNINSLRNCRFWKSVSYMQIKKVNHNNILFDPSYISFIKKITQV 1204
            M  + C+  +  L +   + + + P E+   I LP +    +     Y     + ++ LIW NL Y+MF   ++K+ +L ++  T    D+   KI+FPGWG T ++EN++ WK + T YF+ L++ + +  FYV  +TLR APYDFRK P  N  F+    +LVEET+ N   +R+V++ HSLG L GLHFL  + + WK  Y++ F++ S PLGGSVKA+ +E  G++FG+P R+ + +R I RS ++TA+LLP   ++ ++  L+ T  RNY+S+DY + FRD+NY  GY+M+   K+ F   +A  G+ +I+C+HG +V T   + Y    DS+  FP+  P +  G+GDGTV++ SL+ C  W  V  +     +H  IL D   I  I ++  V
Sbjct:    1 MNTIICLSFILCLCAIQGIQHAKLPAEQLPMIFLPGVGGSQAY---CYLREGNSTQSALIWVNLWYLMFQLTVAKQLELRFDPVTGTTSDIGPCKIVFPGWGQTWTIENMDTWKHTATVYFEYLVSAVRKDPFYVSGRTLRGAPYDFRKDPYENEIFVTKMKNLVEETYRNAGGRRIVLLGHSLGALYGLHFLRYVSDEWKKKYINTFLSVSGPLGGSVKAMLSESFGNNFGIPLRSPLDFRPIARSMTTTAFLLPDERIWPASVPLMITPSRNYSSSDYEHFFRDMNYTVGYQMYLDIKNRFDGFKAPTGVDEIYCVHGTQVDTPYQIIYLPPTDSRPPFPDQTPHLLMGDGDGTVDLKSLQICHKWPGVKTVTFPGASHRRILGDSRMIHLIYQVAGV 397          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A0X3PWI3 (Group XV phospholipase A2 OS=Schistocephalus solidus OX=70667 GN=PAG15 PE=4 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 2.992e-86
Identity = 165/407 (40.54%), Postives = 242/407 (59.46%), Query Frame = 2
Query:   20 PKVMKKLPCILILFVLLSTNSVVYLRSPLEKKNRINLXXXXXXXXXXXRAYSENLETKETNL-IWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEY-SFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMP-RNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYD------SKFPNVEPEIFYGEGDGTVNINSLRNCRFWKSVSYMQIKKVNHNNILFDPSYISFIKKITQVFV 1210
            PK++  +   LIL  + S NSVV +  P ++  R N P+I+IPG GG +A++E      +   IW +L+Y++ P   SK FKL ++ +T    D +  K+ FPGWG+T SV+NL+      T YF E+   ++   SFY  N TLR  P+DFRK+P  N  F      L+EET++NG N RVVI+AHS+GTL GLHFL      WK  Y+ AFVAT+ PLGG+VKAL+ E SG +FG+   +S+ +RE++RS  S A+LLP P ++ S + L+ T  +NYT++DY   F DI +  G++M+  ++    V     G+ +++C+HG+ V TA  + Y       S FP+  P + + +GDGTVN  SL  C  WK V Y  + + +H  I+ DP ++  I  IT   V
Sbjct:   46 PKILYAIQLYLIL--VQSVNSVVVMNKPKQEDIRPN-PVIMIPGDGGCQAFAELTNAPSSAFPIWVDLRYLITPGSFSKYFKLRFDPATGRTYDNENVKVTFPGWGETWSVDNLDSRPHDATEYFGEITRTLVSNNSFYQPNVTLRGTPFDFRKAPNENEDFGPQLRRLIEETYTNGGNTRVVIVAHSMGTLYGLHFLKSQSIAWKKRYVKAFVATAGPLGGAVKALKIEASGDNFGIYFASSLWFRELQRSMPSLAFLLPDPRLWPSDETLIFTPTKNYTAHDYEEFFNDIGFPEGFQMYMNSRDLVDVTSGPTGVDEVYCVHGLNVSTAGAMVYAPPSTFVSPFPDQSPTLIFEDGDGTVNERSLAVCSRWKDVRYSVLPRADHLGIIRDPRFLQQILDITSARV 449          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Match: A0A504YE90 (Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A OS=Fasciola gigantica OX=46835 GN=FGIG_00721 PE=4 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 3.825e-86
Identity = 149/400 (37.25%), Postives = 235/400 (58.75%), Query Frame = 2
Query:   29 MKKLPCILILFVLLSTNSVVYLRSPLEKKNRINLXXXXXXXXXXXRAYSENLETKETNLIWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP-*NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMP-RNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRY----DSK--FPNVEPEIFYGEGDGTVNINSLRNCRFWKSVSYMQIKKVNHNNILFDPSYISFIKKITQV 1204
            M  + C+  +  L +   + + + P E+   I LP +    +     Y       ++ LIW NL Y+MF   ++K+ +L ++ +T    D+   KI+FPGWG T ++EN++  K + T YF+ L++ + +  FYV  +TLR APYDFRK P  N  F+    +LVEET+ N   +R+V++ HSLG L GLHFL  + + WK  Y++ F++ S PLGGSVKA+ +E  G++FG+P R+ + +R I RS ++TA+LLP   ++ ++  L+ T  RNY+SNDY + FRD+NY  GY+M+   K+ F   +A  G+ +I+C+HG +V T   + Y    DS+  FP+  P +  G+GDGTV++ SL+ C  W  V  +     +H  IL D   I  I ++  V
Sbjct:    1 MNTIICLSFILCLCAIQGIQHAKLPAEQLPMIFLPGVGGSQAY---CYLREGNRTQSALIWVNLWYLMFQLTVAKQLELRFDPATGTTSDIGPCKIVFPGWGQTWTIENMDTCKHTATVYFEYLVSAVRKDPFYVSGRTLRGAPYDFRKDPYENETFVSKMKNLVEETYRNAGGRRIVLLGHSLGALYGLHFLRGVSDEWKKKYINTFLSVSGPLGGSVKAMLSESFGNNFGIPLRSPLDFRPIARSMTTTAFLLPDERIWPASVPLMITPTRNYSSNDYEHFFRDMNYTIGYQMYLDIKNRFDGFKAPTGVDEIYCVHGTQVDTPHQIIYLPPTDSRPPFPDQTPHLLMGDGDGTVDLKSLQICHKWPGVKTVTFPGASHRRILGDSRMIHLIYQVAGV 397          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Cavefish
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 189.119 bits (479), Expect = 4.770e-53
Identity = 120/349 (34.38%), Postives = 188/349 (53.87%), Query Frame = 2
Query:  185 ETKETNLIWFNLKYMMFPSYLS---KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*NTKFMKYFASLVE--ETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSIL-YREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEP-EIFYGEGDGTVNINSLRNCRFWKS-----VSYMQIKKVNHNNILFDPSYISFIKKI 1195
            +T E   +W NL+ ++ P  +       +L YNS+T L +   G  +  PG+G T  +E L+  K S   YF  ++  M+++  Y +++ +R APYD+RK+P   K  +YF  L +  E  +      VV+IAHS+G +  L+FL    + WK  Y+ AFV+   P  G  K L+   SG +  +P  S L  R  +R+  STA+L P    + S  +LV T K NYT +DY   F+D+NY  G+ M   T+   S  EA  G+  + C++G  +PTA+   Y + FP+ EP ++  GEGDGTVN+ S   C+ WKS     V  +++    H  +L + + +S+IK +
Sbjct:   73 KTDEYFTLWLNLE-LLVPVAIDCWIDNMRLIYNSTTHLTEAPPGVDVQVPGFGQTFGLEYLDPSKRSVGIYFFTIVQAMVDWG-YTRDEDVRGAPYDWRKAPNENK--QYFLKLQQMIEEMAEKYGGPVVLIAHSMGNMYTLYFLNHQPQAWKDKYIKAFVSLGPPWAGVAKTLRVMASGDNNRIPVISPLKIRTQQRTAVSTAWLFPYAHTWPSDMVLVSTPKANYTVSDYQRFFKDLNYKDGWSMREDTEPLVSALEA-PGVA-VHCLYGTGIPTAQSYIYGT-FPDAEPTKVVNGEGDGTVNVLSAVQCKRWKSQQKQPVQLLELPGNEHVAMLLNITTVSYIKSV 414          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Cavefish
Match: lcat (lecithin-cholesterol acyltransferase [Source:NCBI gene;Acc:103041308])

HSP 1 Score: 166.777 bits (421), Expect = 1.014e-44
Identity = 98/324 (30.25%), Postives = 182/324 (56.17%), Query Frame = 2
Query:  257 FKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*NTKFMKYFASL--VEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNS-ILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEP-EIFYGEGDGTVNINSLRNCRFW-----KSVSYMQIKKVNHNNILFDPSYISFIKKITQ 1201
             ++ YN +T+   +  G ++  PG+G T +VE L++ K +   YF  ++  ++    YV+N+T+RAAPYD+R +P   +  +YF+ L  + E   +   Q V ++ HS+G+   L+FL Q  + WK  ++ +F++  AP GG+VK L+   SG + G+P  S I  RE +R  ++  +++P    +    + + T   NYT+ DY   F DI++  G+ M+  T++  +      G+ +++C +G+ +PT     YD +FPN +P +  Y +GD TV+  S+R C+ W     + V   + K + H +I+F+ + ++ I++I +
Sbjct:  101 MRIVYNRTTRKTSNAPGVEVRAPGFGQTYTVEFLDNNKLA--GYFHTMLQHLVNMG-YVRNETVRAAPYDWRIAP--NEQDEYFSQLKRLVEEMHDEYKQPVHLLGHSMGSNYILYFLNQQSQAWKDRFIKSFISLGAPWGGAVKPLRVLASGDNDGIPLVSNIKIREEQRMTTTNPWMIPSEEAWYKEHVFISTPFFNYTNQDYQRFFTDIHFEDGWHMWEDTRN-LTAGLPTPGV-EVYCFYGVGLPTPVTYIYDEEFPNSDPIDFVYDDGDDTVDSRSMRMCQRWIGKQEQPVYVTEFKGLPHLDIVFNHNVLTTIQEILE 417          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Sea Lamprey
Match: pla2g15 (phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GENE-030131-6948])

HSP 1 Score: 178.333 bits (451), Expect = 1.310e-49
Identity = 115/354 (32.49%), Postives = 189/354 (53.39%), Query Frame = 2
Query:  182 LETKETN---LIWFNLKYMMFPSYLS---KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSF--GMPRNSIL-YREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEP-EIFYGEGDGTVNINSLRNCRFW-----KSVSYMQIKKVNHNNILFDPSYISFIKKI 1195
            L TK+T+    +W NL+ ++ P  +       +L+YN +T+      G ++  P +G T  VE L+    S  +YF  L+ E +E   Y +N+ +R APYD+RK+P  N +++    +++EE ++   +  VV++AHS+G     +FL Q  + WK  ++H+FVA   P GG+ K L+   SG+    G+P  S L  R  +R+  ST++LLP    +   ++LV T KRNYT+ DY + + DI Y  G+ M   T+SY    + L G+  + C++G  V T     YD  FP+ +P  +   +GDGTV++ S   CR W     + V   ++    H ++L     I +IK +
Sbjct:   76 LCTKKTDYYFTLWLNLE-LLVPLVIDCWIDNMRLEYNLTTRATSSPNGVQVRVPDFGKTFPVEFLDPSNVSVGSYFHTLV-EAMEGWGYKRNQDIRGAPYDWRKAPNENGEYLTNLKNMIEEMYATYWSP-VVLVAHSMGNPYMRYFLGQQSQAWKDKFIHSFVALGPPWGGAAKTLRVLTSGTGDNNGIPVISTLKIRAQQRTAVSTSWLLPYNTSWPPDKVLVSTPKRNYTNRDYRDFYNDIGYPEGWLMRQDTESYL-YGQPLPGVP-VHCLYGTGVATPDSFVYDKSFPDHDPTRVITADGDGTVSLASALLCREWAGRQPQPVLLRELPGAEHVSMLSRADLIQYIKGV 424          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Nematostella
Match: EDO33966 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQQ2])

HSP 1 Score: 181.03 bits (458), Expect = 1.475e-50
Identity = 112/340 (32.94%), Postives = 175/340 (51.47%), Query Frame = 2
Query:  206 IWFNLKYM--MFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*N-TKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYD-SKFPNVEPEIFYGEGDGTVNINSLRNCRFWK-----SVSYMQIKKVNHNNILFDPSYISFIKKI 1195
            +W    ++  MF        +L Y+ +TK + +  G +   PG+GDTN++E L+  K +  AYF  L+  M+ +  Y + K LRAAPYDFR +P +   +      L+E+T++    ++V +++HSLG    L FL Q    WK  Y+  +VA S   GG+ + ++   SG +FG+P  N +  R  +R+ SS  ++LP   ++ S ++LV T  R YT  D+ + FRD+ Y  G  +    ++  +          + C+HG  V T +   Y   +FP+ +P I  G+GDGTVN  SLR C  W       V       VNHN IL D    ++IK I
Sbjct:   71 LWLQESFLLPMFIDCWVDNMRLVYDPATKTVHNSPGVETRVPGFGDTNTIEYLD--KRNLIAYFAPLVKAMVSWG-YERGKNLRAAPYDFRYAPDSQADYYIRLRQLIEDTYTQNGEKQVTLLSHSLGCPYTLVFLNQQSTAWKDKYIKQWVALSGVWGGTTQLVRLFASGDAFGIPLVNPLTVRVEQRTCSSNNFMLPSRELWRSDEVLVTTPDRKYTVRDFEDYFRDVGYPDGIPVRRNLENLTAPLLQHAPNVTLHCLHGSGVDTEESYTYGKGEFPDEQPTIRNGDGDGTVNARSLRACATWVNRQGYDVVVKDYAGVNHNGILSDAKAQAYIKSI 407          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Nematostella
Match: EDO47377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN6])

HSP 1 Score: 163.696 bits (413), Expect = 2.201e-44
Identity = 104/345 (30.14%), Postives = 176/345 (51.01%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYL---SKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*NT-KFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR---NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRY-DSKFPNVEPEIFYGEGDGTVNINSLRNCRFW-----KSVSYMQIKKVNHNNILFDPSYISFIKKITQ 1201
            IW +L+ ++ P  +   S + +L Y+   K +    G +I  P +G T+SV  L+        YF  LI+ ++    Y K+K LRAAP+DFR +P +  +F  YF +LVE+ F  G  + V++++HSLG     +FL ++ + WK  YLHA+V      GG+ K  +   SG++ G P    N +  R   R++ ST +LLP    +   + ++ T K+NY+ +++     D+N+  G  +       +S +        ++C++G  VPT +   + + +FP+  P+  +G+GDGTVN  SL  C  +     + V   Q  K  H  I+ D     FIK + +
Sbjct:   63 IWLSLEELL-PEVIDCWSDDMRLVYDEKHKRMTSPPGVQIRVPDFGKTSSVAYLDPTIDHPGEYFAPLIDALVSIG-YTKDKNLRAAPFDFRYAPDSAGEFYAYFQALVEQMFMEGGGEPVLVVSHSLGVPYTKYFLDRIHQEWKDKYLHAWVTIGGAWGGAAKLFRIISSGTNLGFPDFILNPLKMRVGLRTYESTTFLLPSEKFWDVKEPVIFTPKKNYSLSNFEEFLDDLNFPLGKTIKGLVPPVWSDHPP---NVTLYCLYGTGVPTPRTFEFKEGQFPDTYPKTNFGDGDGTVNRKSLEGCFQYEKTQKRPVVTRQFPKAEHMAIIGDKRVTDFIKGLVE 402          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Medaka
Match: pla2g15 (phospholipase A2 group XV [Source:NCBI gene;Acc:101172239])

HSP 1 Score: 176.022 bits (445), Expect = 3.311e-48
Identity = 108/341 (31.67%), Postives = 183/341 (53.67%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLS---KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*NTKFMKYFASLVE--ETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSIL-YREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFW-----KSVSYMQIKKVNHNNILFDPSYISFIKKI 1195
            +W NL+ ++ P  +       +L YN +T+  +   G  +  PG+G T S+E L+  K S   YF  ++  M+E+  Y ++  +R APYD+RK+P   K  +YF  L +  E  +      VV+IAHS+G +  L+FL Q  + WK  Y+ AF+    P  G  K L+   SG +  +P  S L  R  +R+  ST +LLP    ++  Q+L++T   NYT  DY  L++DI +  G+ M   T+    V++ L    ++ C++G  + T++   Y + FP+ EP +  G+GDGTVN+ S   C+ W     + V   +++   H ++L + + +++IKK+
Sbjct:   81 LWLNLE-LLVPFAIDCWIDNIRLIYNRTTRTSEAPPGVFVRVPGFGKTFSLEYLDPSKQSVGMYFFSIVQSMVEWG-YTRDDDVRGAPYDWRKAPNENK--EYFLKLQQMIEEMAEKAGGPVVLIAHSMGNMYTLYFLNQQPQAWKDKYIKAFICLGPPWAGVAKTLRVIASGDNNRIPVISPLKIRTQQRTAVSTNWLLPYAHSWSKDQVLIRTPSVNYTVQDYRRLYKDIGFDDGWLMRQDTEPL--VSDLLPPNVEVHCLYGSGINTSEAFHYSNNFPDEEPTVVNGDGDGTVNLRSAIQCKRWVGQQKQPVFLKELRGNEHVDMLTNYTTVAYIKKV 415          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Medaka
Match: lcat (lecithin-cholesterol acyltransferase [Source:NCBI gene;Acc:101172491])

HSP 1 Score: 171.4 bits (433), Expect = 1.728e-46
Identity = 103/343 (30.03%), Postives = 184/343 (53.64%), Query Frame = 2
Query:  206 IWFNLKYMMFPSYLS---KEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPR-NSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEP-EIFYGEGDGTVNINSLRNCRFW-----KSVSYMQIKKVNHNNILFDPSYISFIKKITQ 1201
            IW +L  M  P  +       +L YN +T+   +  G ++  PG+G+T ++E L+    +   YF  ++  ++    YV+N+T+R APYD+R +P  N+++      LVEE + N   + V ++ HS+G    L+FL    + WK TY+  F++  AP GG+VK L+   SG++ G+P  ++I  RE +R  ++  ++LP    +    + + T   NYT+ DY  LF DI++  G+ M+  TK+         G+ +++C++G+ +PT     YD  FPN +P +  Y +GD TV+  S+  C+ W     K V   + + + H +++F    +  I++I +
Sbjct:   82 IWIDLN-MFMPIGVDCWIDNIRLVYNKTTRRSSNSPGVQVRVPGFGETYTIEFLD--YNNLAGYFHSMVEHLVNVG-YVRNETVRGAPYDWRLAPNENSEYFIRLQELVEEMY-NQYQKPVYLLGHSMGGHYVLYFLNNQPQAWKDTYIRGFISLGAPWGGAVKVLRVMTSGNNDGIPMLSNIKLREEQRMMTTNPWMLPSEDAWPKDHVFISTPSVNYTNQDYKRLFTDIDFENGWHMWEDTKNLTGALHP-PGV-EVWCMYGVGLPTPVTHIYDEDFPNADPVDYVYADGDDTVDSFSMSLCKRWEGQQEKPVHVTEYRGLAHLDMVFHEKVLHQIQQILE 417          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000022530.1 (SMESG000022530.1)

HSP 1 Score: 495.352 bits (1274), Expect = 1.323e-173
Identity = 238/238 (100.00%), Postives = 238/238 (100.00%), Query Frame = 2
Query:  497 MKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKSVSYMQIKKVNHNNILFDPSYISFIKKITQVFV 1210
            MKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKSVSYMQIKKVNHNNILFDPSYISFIKKITQVFV
Sbjct:    1 MKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKSVSYMQIKKVNHNNILFDPSYISFIKKITQVFV 238          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037748.1 (SMESG000037748.1)

HSP 1 Score: 297.36 bits (760), Expect = 8.714e-94
Identity = 143/332 (43.07%), Postives = 216/332 (65.06%), Query Frame = 2
Query:  203 LIWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKSVSYMQIKKVNHNNILFDPSYISFIKKI 1195
            L+W N +YM+FPS L   FKL+YN++     ++KG  + FPGWGDT ++E L++    +T YF  L++ ++   +YV+NKT+R APYDFRK+P  N K +     L+E+T+    N+RVVI+ HSLG+L  L+F  QM   WK  Y+ AF++ S PLGG+VKA+  E SG S G PR+ I +RE++RSF ST++LLP+P +F     ++  T RNY+S DY +LF+D++   G  M++ TK+     E  +GI +++CIH   +PT K L + + FP+ +P+   G+GD TVNI SL+ C  WK+V+Y  IK  +H  I+  P ++  +K+I
Sbjct:   61 LVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVILGHSLGSLYSLYFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFIITPT-RNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKA-FPDGQPQFTTGDGDYTVNIQSLKICEKWKNVNYFTIKGADHMQIVSTPEFMLKLKQI 390          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037740.1 (SMESG000037740.1)

HSP 1 Score: 292.738 bits (748), Expect = 1.628e-92
Identity = 141/336 (41.96%), Postives = 216/336 (64.29%), Query Frame = 2
Query:  191 KETNLIWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKSVSYMQIKKVNHNNILFDPSYISFIKKI 1195
            K  +L+W N  YM+FP   +   KL Y+  T    +     IL PGWG T  +E L+ W+   T YF   +N +++  FYV+NKT+R APYDFR++P  NT+F      L+EET+    N+RVV++ HSLG+L  L+FL  M   WK  YL AF++ S+PLGGS+KA++ + SG+S G PR SI++R+++RSF ++A+L+ RP +F +  I++ T KRNY+++DY   F D++Y  G+ M+  TK+  +  E  +G+ +I+CI+   +PT + ++ +S FPN EP + YG+GDGTVNI SL+ C+ WK+V +  I+ V H  I+    +I  +K I
Sbjct:   49 KFNDLVWVNYVYMLFPCLFTSRMKLQYDPKTHKTSNWNNNTILVPGWGSTEMIEELDQWRHPSTTYFYNFVNSLVKDKFYVRNKTVRGAPYDFRRAPNENTEFFVNLEELIEETYKLSGNRRVVLLGHSLGSLYSLYFLKLMTNSWKKKYLRAFISASSPLGGSMKAVKLQTSGTSLGSPRKSIMFRKMQRSFPTSAFLMIRPEIFGNEPIVI-TPKRNYSASDYEAFFADMSYPDGFMMYEDTKNLVNGFETPEGVDEIYCIYSNGLPTIRQIKLES-FPNGEPSLIYGDGDGTVNIKSLQICKNWKNVHHSTIENVAHMEIVGTQEFIDLVKTI 382          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000022523.1 (SMESG000022523.1)

HSP 1 Score: 279.256 bits (713), Expect = 2.370e-90
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 2
Query:   29 MKKLPCILILFVLLSTNSVVYLRSPLEKKNRINLXXXXXXXXXXXRAYSENLETKETNLIWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP 481
            MKKLPCILILFVLLSTNSVVYLRSPLEKKNRINLPIIIIPGSGGSRAYSENLETKETNLIWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP
Sbjct:    1 MKKLPCILILFVLLSTNSVVYLRSPLEKKNRINLPIIIIPGSGGSRAYSENLETKETNLIWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP 151          
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Match: SMESG000037748.1 (SMESG000037748.1)

HSP 1 Score: 272.707 bits (696), Expect = 1.427e-84
Identity = 131/309 (42.39%), Postives = 199/309 (64.40%), Query Frame = 2
Query:  203 LIWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDVKGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLRAAPYDFRKSP*-NTKFMKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHAFVATSAPLGGSVKALQAEISGSSFGMPRNSILYREIERSFSSTAYLLPRPIVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEALKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRNCRFWKSVSYM 1126
            L+W N +YM+FPS L   FKL+YN++     ++KG  + FPGWGDT ++E L++    +T YF  L++ ++   +YV+NKT+R APYDFRK+P  N K +     L+E+T+    N+RVVI+ HSLG+L  L+F  QM   WK  Y+ AF++ S PLGG+VKA+  E SG S G PR+ I +RE++RSF ST++LLP+P +F     ++ T  RNY+S DY +LF+D++   G  M++ TK+     E  +GI +++CIH   +PT K L + + FP+ +P+   G+GD TVNI S  + +   +  +M
Sbjct:   61 LVWVNFEYMVFPSLLRNVFKLEYNTTNHKTSNMKGSDVFFPGWGDTETIEELDEKLHIQTTYFSNLVDNLVIDKYYVRNKTVRGAPYDFRKAPNENQKMLDDLKILIEDTYRKSGNERVVILGHSLGSLYSLYFFKQMTMSWKKQYIRAFLSVSGPLGGAVKAVTLETSGESLGSPRSPIYFREMQRSFPSTSFLLPKPEIFGKEPFII-TPTRNYSSYDYEDLFKDMSMPYGSTMYNDTKNLVDGTETPEGIDELYCIHSYGLPTTKQLTFKA-FPDGQPQFTTGDGDYTVNIQSADHMQIVSTPEFM 367          
The following BLAST results are available for this feature:
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLA2G152.347e-5031.47phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
LCAT1.609e-4330.09lecithin-cholesterol acyltransferase [Source:HGNC ... [more]
LCAT1.033e-3130.74lecithin-cholesterol acyltransferase [Source:HGNC ... [more]
PLA2G151.304e-2832.67phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
PLA2G156.619e-2331.22phospholipase A2 group XV [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
M05B5.42.287e-5132.17pep chromosome:WBcel235:I:7188465:7190581:1 gene:W... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG316831.823e-4930.81gene:FBgn0051683 transcript:FBtr0330662[more]
CG316831.823e-4930.81gene:FBgn0051683 transcript:FBtr0081365[more]
CG188583.903e-4930.52gene:FBgn0042175 transcript:FBtr0332971[more]
CG188583.903e-4930.52gene:FBgn0042175 transcript:FBtr0081364[more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pla2g151.047e-4731.03phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
lcat1.496e-4529.19lecithin-cholesterol acyltransferase [Source:ZFIN;... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam53c1.583e-5134.39family with sequence similarity 53 member C [Sourc... [more]
PLA2G157.700e-5135.42phospholipase A2 group XV [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pla2g151.562e-4932.40phospholipase A2, group XV [Source:MGI Symbol;Acc:... [more]
Lcat8.420e-4631.25lecithin cholesterol acyltransferase [Source:MGI S... [more]
Pla2g151.544e-630.67phospholipase A2, group XV [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NCC3|PAG15_HUMAN1.127e-4931.47Phospholipase A2 group XV OS=Homo sapiens OX=9606 ... [more]
sp|Q6XPZ3|PAG15_CANLF7.523e-4931.88Phospholipase A2 group XV OS=Canis lupus familiari... [more]
sp|Q8VEB4|PAG15_MOUSE1.092e-4832.40Phospholipase A2 group XV OS=Mus musculus OX=10090... [more]
sp|Q8WMP9|PAG15_BOVIN9.494e-4832.29Phospholipase A2 group XV OS=Bos taurus OX=9913 GN... [more]
sp|Q675A5|PAG15_RAT1.665e-4631.78Phospholipase A2 group XV OS=Rattus norvegicus OX=... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TLN41.023e-8643.32Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A564Y6A11.775e-8643.32Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A4E0RVZ02.024e-8637.25Phosphatidylcholine-sterol acyltransferase (Lecith... [more]
A0A0X3PWI32.992e-8640.54Group XV phospholipase A2 OS=Schistocephalus solid... [more]
A0A504YE903.825e-8637.25Phosphatidylcholine-sterol acyltransferase (Lecith... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pla2g154.770e-5334.38phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
lcat1.014e-4430.25lecithin-cholesterol acyltransferase [Source:NCBI ... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pla2g151.310e-4932.49phospholipase A2, group XV [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO339661.475e-5032.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473772.201e-4430.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pla2g153.311e-4831.67phospholipase A2 group XV [Source:NCBI gene;Acc:10... [more]
lcat1.728e-4630.03lecithin-cholesterol acyltransferase [Source:NCBI ... [more]
back to top
BLAST of Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022530.11.323e-173100.00SMESG000022530.1[more]
SMESG000037748.18.714e-9443.07SMESG000037748.1[more]
SMESG000037740.11.628e-9241.96SMESG000037740.1[more]
SMESG000022523.12.370e-90100.00SMESG000022523.1[more]
SMESG000037748.11.427e-8442.39SMESG000037748.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008617 ID=SMED30008617|Name=Phosphatidylcholine-sterol acyltransferase (Lecithin-cholesterol acyltransferase)/ Phospholipase A|organism=Schmidtea mediterranea sexual|type=transcript|length=2068bp
AGACATTTATGGAAATATTCCAAAAGTAATGAAAAAGCTTCCCTGCATTT
TAATTTTATTCGTTTTATTAAGTACAAATAGCGTCGTTTATTTACGGTCG
CCATTGGAAAAGAAAAACCGAATCAACTTACCAATCATCATCATCCCCGG
AAGCGGGGGATCTAGAGCTTATAGTGAAAATTTGGAAACCAAAGAAACAA
ATCTAATATGGTTTAATTTAAAATATATGATGTTCCCATCATATTTGTCC
AAGGAATTCAAGCTGGACTATAATTCTTCAACGAAACTCCTTCAAGATGT
CAAGGGATTTAAAATCCTCTTTCCTGGATGGGGAGACACAAATTCAGTAG
AGAATCTCAACGATTGGAAAACGTCCAAGACTGCTTATTTCCAGGAACTA
ATTAACGAAATGTTAGAGTATTCGTTTTATGTTAAGAATAAAACTCTAAG
AGCAGCGCCATATGATTTCCGAAAATCTCCATAAAATACAAAATTCATGA
AATACTTTGCTTCGCTGGTGGAAGAAACCTTTAGTAATGGCAACAATCAA
CGGGTGGTAATTATAGCTCACAGTTTGGGAACATTGGTCGGATTACATTT
TCTGTACCAAATGGACGAGATATGGAAAATGACATATTTGCATGCATTTG
TAGCTACTTCCGCTCCTTTGGGGGGATCTGTGAAAGCATTGCAGGCAGAA
ATTAGTGGATCTTCGTTTGGTATGCCAAGAAATTCTATTCTCTATCGTGA
AATAGAAAGATCATTTTCAAGTACTGCTTACTTACTACCAAGGCCAATAG
TATTCGCATCAACACAGATCCTAGTTCAAACAACAAAAAGAAATTACACA
TCAAATGATTATTTTAATTTGTTTCGTGATATTAACTATATGAGAGGATA
TGAGATGTTCCACAAAACCAAATCTTATTTCAGTGTCAATGAAGCCTTGA
AAGGAATAAAGCAGATATTCTGCATTCATGGAATCAAGGTTCCAACAGCG
AAACTCTTACGATATGATTCTAAATTTCCCAACGTTGAACCTGAAATCTT
TTATGGGGAAGGAGATGGAACGGTTAATATCAATAGTCTGCGGAATTGCA
GATTCTGGAAGTCAGTTAGTTACATGCAAATCAAAAAGGTCAATCATAAC
AACATATTATTCGACCCTTCATATATTTCATTTATCAAAAAAATAACTCA
AGTGTTTGTTTAAAAAAATAATTCTGAAACAGGTTTCGTCTTCTACCACA
GAGAACGATTTCAGACAATACAACCGAAGAAATCTTCGTGACGAAGTACA
AATTACAATAAGATAATTAGAAGTTAAATGACTAATACTACGATCGTGCC
AACAACTCCCCTAAGAATCCATCATTGATTTCACTGCAGTCCTCAAACTG
ATAAATGTCCAACACCAGCACTTACTGGTATATCTAGTAATTCCATTAGA
CAAAGATTTCTGGAAATGTAAAATCCATCACTGGAACAACTAATTCAAAC
AGAAATGACCTTGGAAATCGCCACGCTAGACTCGAATAAACTACATAATA
TTTCTTCAGTAAGAACCTTTGTCTGAATGTAAATTATGCGGAAAAACTCG
ACACCCTAGAAAAAGATGTCCACCACATGATTCAACTTTCAAGAAATGTA
ATACGCCTGGTCATTGGATGATCATTTGTAGATCTGGGAAATACAAGTCT
GATAACCTAGCCAACATGGAACAAACGCTAAAGCTTTCAATACCGGAACA
TTTTCCCAAAACCGGAAATATGGTATTCACAATTTTCAATACCGGAATCC
CGGTGTTGGCACCGGGATAAATTGAGTGTCGGAAAATAAAAAAACAACTG
AAAATATCAACTAATAAATACATATTTAAGTAGGTAGTAATGTGGTTTAC
AGATAATTGAAAAAGTAAAGGTCCCCCATGAAATTTTCATTTTTTTTCGA
AGACCCCCTTTTTTTGCGATAACCACCATACGTTTTTTTTGCAATACGCC
TCCCCCCACACAGTAATTGGCTCAATAATATCACTAGATGATTATTTGTT
GATGGTGTTTCTGTAATC
back to top

protein sequence of SMED30008617-orf-1

>SMED30008617-orf-1 ID=SMED30008617-orf-1|Name=SMED30008617-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=239bp
MKYFASLVEETFSNGNNQRVVIIAHSLGTLVGLHFLYQMDEIWKMTYLHA
FVATSAPLGGSVKALQAEISGSSFGMPRNSILYREIERSFSSTAYLLPRP
IVFASTQILVQTTKRNYTSNDYFNLFRDINYMRGYEMFHKTKSYFSVNEA
LKGIKQIFCIHGIKVPTAKLLRYDSKFPNVEPEIFYGEGDGTVNINSLRN
CRFWKSVSYMQIKKVNHNNILFDPSYISFIKKITQVFV*
back to top

protein sequence of SMED30008617-orf-2

>SMED30008617-orf-2 ID=SMED30008617-orf-2|Name=SMED30008617-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=161bp
DIYGNIPKVMKKLPCILILFVLLSTNSVVYLRSPLEKKNRINLPIIIIPG
SGGSRAYSENLETKETNLIWFNLKYMMFPSYLSKEFKLDYNSSTKLLQDV
KGFKILFPGWGDTNSVENLNDWKTSKTAYFQELINEMLEYSFYVKNKTLR
AAPYDFRKSP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001878Znf_CCHC
IPR003386LACT/PDAT_acylTrfase
IPR029058AB_hydrolase
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0008374O-acyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process