SMED30008609

Overview
NameSMED30008609
Smed IDSMED30008609
Length (bp)1061
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30008609 (SMED30008609) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30008609 (SMED30008609) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30008609 (SMED30008609) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30008609 (SMED30008609) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008609

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008609SMESG000059918.1 SMESG000052306.1 SmedASXL_002259SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008609SMESG000059918.1 SMESG000052306.1 dd_Smed_v4_12223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008609SMESG000059918.1 SMESG000052306.1 dd_Smed_v4_12223_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30008609SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008609SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30008609SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008609SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30008609SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30008609SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30008609SMESG000059918.1 SMESG000052306.1 SMESG000022407.1 dd_Smed_v6_474_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008609SMESG000059918.1 SMESG000052306.1 dd_Smed_v4_12223_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30008609SMESG000059918.1 SMESG000052306.1 dd_Smed_v4_12223_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30008609 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005522:19979..23157 +2905
v31.028371:4636..5618 -2809
v31.005522:6409..8025 +2364
Homology
BLAST of SMED30008609 vs. Planmine SMEST
Match: SMESG000052306.1 (SMESG000052306.1)

HSP 1 Score: 486.493 bits (1251), Expect = 2.468e-156
Identity = 322/338 (95.27%), Postives = 324/338 (95.86%), Query Frame = 1
Query:   46 MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQISKKRSS+SSHSSSKSS SNKGLRKIKGKSLKKTTKKGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLD NTPEIDFDGNAKKSKDK K  K    +NVE P ASIDIQGKK KGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct:    1 MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQISKKRSSVSSHSSSKSSGSNKGLRKIKGKSLKKTTKKGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDTNTPEIDFDGNAKKSKDKLKKGKLD--INVEEPYASIDIQGKKLKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 336          

HSP 2 Score: 131.339 bits (329), Expect = 3.886e-33
Identity = 96/106 (90.57%), Postives = 99/106 (93.40%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAK SKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID+DGKKKNIGLDINLP
Sbjct: 1042 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKISKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDIDGKKKNIGLDINLP 1147          

HSP 3 Score: 129.028 bits (323), Expect = 2.124e-32
Identity = 104/147 (70.75%), Postives = 112/147 (76.19%), Query Frame = 1
Query:  634 LTITAGLEFQ-----IKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            L    GL+F+      K  V   V     D + D K    ++ H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 4438 LPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISEKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4584          

HSP 4 Score: 126.331 bits (316), Expect = 1.804e-31
Identity = 96/106 (90.57%), Postives = 98/106 (92.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 2163 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 2268          

HSP 5 Score: 125.176 bits (313), Expect = 4.251e-31
Identity = 95/106 (89.62%), Postives = 98/106 (92.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 5188 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 5293          

HSP 6 Score: 100.908 bits (250), Expect = 6.421e-23
Identity = 60/106 (56.60%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNK K                                  +DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 3778 KKHGIDINLPNWKFPKFSNKRK----------------------------------IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 3849          

HSP 7 Score: 96.6709 bits (239), Expect = 1.586e-21
Identity = 87/127 (68.50%), Postives = 92/127 (72.44%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSI----------------------PEVDIDVDGKKKNIGLDINL 1056
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHL+                       PEVDID+ GKK     D+NL
Sbjct: 1595 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 1721          

HSP 8 Score: 96.6709 bits (239), Expect = 1.586e-21
Identity = 87/127 (68.50%), Postives = 92/127 (72.44%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSI----------------------PEVDIDVDGKKKNIGLDINL 1056
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHL+                       PEVDID+ GKK     D+NL
Sbjct: 3165 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 3291          

HSP 9 Score: 92.4337 bits (228), Expect = 3.946e-20
Identity = 47/50 (94.00%), Postives = 48/50 (96.00%), Query Frame = 1
Query:  910 LDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            +DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 4197 IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4246          

HSP 10 Score: 76.2554 bits (186), Expect = 1.023e-14
Identity = 55/142 (38.73%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPNV  ++N  K D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P VD+           D DGKKK  GLDINLP
Sbjct: 5560 KPNVDIDIN--KPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNVDVDNNKPDIYIDLDADGKKKKHGLDINLP 5670          

HSP 11 Score: 76.2554 bits (186), Expect = 1.100e-14
Identity = 54/142 (38.03%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  GLDINLP
Sbjct:  770 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 880          

HSP 12 Score: 75.0998 bits (183), Expect = 2.267e-14
Identity = 54/142 (38.03%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  GLDINLP
Sbjct:  382 KPNVDIDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 492          

HSP 13 Score: 72.4034 bits (176), Expect = 1.522e-13
Identity = 53/142 (37.32%), Postives = 68/142 (47.89%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  +V+ NK D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 5638 KPNV--DVDNNKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 5748          

HSP 14 Score: 71.633 bits (174), Expect = 2.782e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 3434 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPPFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 3544          

HSP 15 Score: 71.633 bits (174), Expect = 2.884e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  ++N  K D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 4864 KPNVDIDIN--KPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 4974          

HSP 16 Score: 71.633 bits (174), Expect = 3.421e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4708 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4818          

HSP 17 Score: 70.4774 bits (171), Expect = 6.959e-13
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D+           DGKKK  G  INLP
Sbjct: 2548 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDADGKKKKHGFGINLP 2658          

HSP 18 Score: 70.4774 bits (171), Expect = 7.681e-13
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV   +N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 1723 KPNVDVYINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 1833          

HSP 19 Score: 70.0922 bits (170), Expect = 9.789e-13
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D       K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2392 KPNI--DVDNNKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2502          

HSP 20 Score: 69.707 bits (169), Expect = 1.130e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2626 KPNIDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVYINKPDIDIDLDVDGKKKKHGFGINLP 2736          

HSP 21 Score: 69.707 bits (169), Expect = 1.130e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 3356 KPNIDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 3466          

HSP 22 Score: 69.707 bits (169), Expect = 1.171e-12
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+D DGKKK  G  INLP
Sbjct: 2314 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDNNKPDIDIDLDADGKKKKHGFGINLP 2424          

HSP 23 Score: 69.707 bits (169), Expect = 1.193e-12
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+L  P VDID+           DGKKK  GLDINLP
Sbjct: 4786 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 4896          

HSP 24 Score: 69.707 bits (169), Expect = 1.193e-12
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+L  P VDID+           DGKKK  GLDINLP
Sbjct: 5482 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 5592          

HSP 25 Score: 69.707 bits (169), Expect = 1.247e-12
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 2841 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 2951          

HSP 26 Score: 69.707 bits (169), Expect = 1.281e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G      H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct:  614 KPNIDVDINKPDIDIDLDVDGKKIK--HGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 724          

HSP 27 Score: 69.707 bits (169), Expect = 1.293e-12
Identity = 52/142 (36.62%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 2470 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2580          

HSP 28 Score: 69.3218 bits (168), Expect = 1.738e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4630 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 4740          

HSP 29 Score: 69.3218 bits (168), Expect = 1.901e-12
Identity = 51/142 (35.92%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct:  692 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 802          

HSP 30 Score: 69.3218 bits (168), Expect = 1.901e-12
Identity = 51/142 (35.92%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 1801 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 1911          

HSP 31 Score: 68.9366 bits (167), Expect = 2.117e-12
Identity = 64/172 (37.21%), Postives = 81/172 (47.09%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDL------------DINTPEIDFXXXXXXXXX------------------XXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV   +N+   D + D  G    K H    +  +WKLP F  K KK KG++D+            DIN P+ID D +    K                   K K  KG++D++VE P+  IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 2704 KPNVDVYINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2873          

HSP 32 Score: 68.9366 bits (167), Expect = 2.136e-12
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H +D +  +WKLPKF  K KK KG                               D++VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct:  460 KPNIDVDINKPDIDIDLDVDGKK--KKHGLDINLPDWKLPKFEGKLKKPKG-------------------------------DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 568          

HSP 33 Score: 68.5514 bits (166), Expect = 2.845e-12
Identity = 51/147 (34.69%), Postives = 67/147 (45.58%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVD----------------IDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDI V+L  P++D                +D+DGKKK  GLD NLP
Sbjct: 3957 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIVVNLKKPDIDNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4072          

HSP 34 Score: 68.5514 bits (166), Expect = 2.897e-12
Identity = 53/142 (37.32%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +DID           +D KKK  GLDINLP
Sbjct: 1271 KPNVDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDIDNNKPDIDIDLDIDSKKKKHGLDINLP 1381          

HSP 35 Score: 68.1662 bits (165), Expect = 3.824e-12
Identity = 55/159 (34.59%), Postives = 81/159 (50.94%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEV--PDASIDI-----------------------QGKKHKGDIDVHLSIPEVDIDVDGKKKNI----GLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D D +  ++K        K D+ +++  PD  I+I                       +GKK K ++D+ +  P +DID+DGKK  I    G+DINLP
Sbjct: 4332 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISEKHGIDINLP 4488          

HSP 36 Score: 68.1662 bits (165), Expect = 4.373e-12
Identity = 51/141 (36.17%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKK   G  INLP
Sbjct:  537 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKIKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKIKHGFGINLP 646          

HSP 37 Score: 67.781 bits (164), Expect = 5.618e-12
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D           +D KKK  GLDINLP
Sbjct: 1879 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDNNKPDIDIDLDIDSKKKKHGLDINLP 1989          

HSP 38 Score: 67.3958 bits (163), Expect = 7.348e-12
Identity = 51/142 (35.92%), Postives = 64/142 (45.07%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D       K H    +  NWKLP F  K KK  G++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+D+           DGKKK  G  INLP
Sbjct: 1193 KPNI--DVDNNKPDIDIDLDVDGKKKKHGFGINLPNWKLPTFEGKVKKPNGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDADGKKKKHGFGINLP 1303          

HSP 39 Score: 66.6254 bits (161), Expect = 1.128e-11
Identity = 45/117 (38.46%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4575 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4662          

HSP 40 Score: 66.6254 bits (161), Expect = 1.128e-11
Identity = 45/117 (38.46%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 5284 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5371          

HSP 41 Score: 66.2402 bits (160), Expect = 1.502e-11
Identity = 59/178 (33.15%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEI-----------DFXXXXXXXXXXXXXXXXXLDVNVEV-------------------------PDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+           DFD N KK        K  +D++++V                         P+  IDI  KK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 5339 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKRIDIDVEGPEVDIDIHWKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5514          

HSP 42 Score: 65.4698 bits (158), Expect = 3.094e-11
Identity = 50/137 (36.50%), Postives = 79/137 (57.66%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKK------HKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H +D +  +WKLPKF  K KK KG  DLD+  P+ID D + KK K +        +V+++     IDI+ K       +K D+++ ++ P++DI++DGKKK  G++I LP
Sbjct:  848 KPNIDVDINKPDIDIDLDVDGKK--KKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIESKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 980          

HSP 43 Score: 65.0846 bits (157), Expect = 3.866e-11
Identity = 44/117 (37.61%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2259 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2346          

HSP 44 Score: 65.0846 bits (157), Expect = 3.900e-11
Identity = 52/150 (34.67%), Postives = 74/150 (49.33%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI-----------------QGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE  ID  G   K       KK  +D+++  PD  ID+                 Q K+   DID H    ++++D+DGKKK  GLD NLP
Sbjct: 3512 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDAMARKRNMETERRNRSQCKEPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 3659          

HSP 45 Score: 64.6994 bits (156), Expect = 5.141e-11
Identity = 50/133 (37.59%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVD----------------LDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D                LDIN P+        K K    +      ++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKK  GLD NLP
Sbjct: 4237 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEVQKYRQQEKKHGLDINLPDWKLPKFEGKLKKPKGA------LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4363          

HSP 46 Score: 64.3142 bits (155), Expect = 6.254e-11
Identity = 46/117 (39.32%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D   PE+D                             IDI GKK KGD DV+L  P VDI           DVDGKKK  G  INLP
Sbjct:  327 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDFEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDVDGKKKKHGFGINLP 414          

HSP 47 Score: 63.929 bits (154), Expect = 1.048e-10
Identity = 45/117 (38.46%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KN  +D +  +WKLPKF  K KK KG++D+D+  PE D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 1138 KNIGLDINLPDWKLPKFEGKIKKPKGEIDIDVEGPEFD-----------------------------IDIHGKKPKGDFDVNLKKPNIDVDNNKPDIDIDLDVDGKKKKHGFGINLP 1225          

HSP 48 Score: 63.5438 bits (153), Expect = 1.219e-10
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  +++ NK D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 1349 KPNI--DIDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 1457          

HSP 49 Score: 63.5438 bits (153), Expect = 1.274e-10
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 2919 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 3027          

HSP 50 Score: 63.5438 bits (153), Expect = 1.274e-10
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 4942 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 5050          

HSP 51 Score: 63.1586 bits (152), Expect = 1.522e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 1426 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 1533          

HSP 52 Score: 63.1586 bits (152), Expect = 1.522e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 2996 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3103          

HSP 53 Score: 63.1586 bits (152), Expect = 1.522e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 3628 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3735          

HSP 54 Score: 63.1586 bits (152), Expect = 1.522e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 5019 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 5126          

HSP 55 Score: 62.003 bits (149), Expect = 3.508e-10
Identity = 54/149 (36.24%), Postives = 82/149 (55.03%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXX---------XLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D    +  K H +D +  +WKLPKF  K KK KG   LD+  P+ID D + KK K +               K D+++E P+  +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 1957 KPNI--DVDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 2101          

HSP 56 Score: 57.7658 bits (138), Expect = 9.171e-9
Identity = 51/155 (32.90%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASI--DIQGKKHK-----------------------GDIDVHLSIPEVDIDVDGKKKNIGLDINL 1056
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D +    ++D  G   K +     K   +D++   PD  I  DI GKK+K                       G+ID+++  PEVDID+ GKK   G D+N 
Sbjct: 5716 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDFEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDMDIEVDIDGKKNKHGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVDIDIHGKKPKGGFDVNF 5868          

HSP 57 Score: 56.6102 bits (135), Expect = 2.137e-8
Identity = 53/150 (35.33%), Postives = 67/150 (44.67%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI----QGKKH---------------------------KGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE  ID  G   K       KK  +DV++  PD  ID+    + KKH                           KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 3840 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKKSTLTFMGKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 3989          

HSP 58 Score: 55.0694 bits (131), Expect = 6.820e-8
Identity = 55/146 (37.67%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI------------QGKKHKGDIDVHLSIP----EVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D               KG +DV    PD  IDI             GKKH+   D+ +  P    ++DIDV  KKK  G+DINLP
Sbjct: 4041 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-------DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLP 4177          

HSP 59 Score: 52.7582 bits (125), Expect = 3.056e-7
Identity = 38/116 (32.76%), Postives = 51/116 (43.97%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1017
            PNV  + ++   D E D  G      H +D +  +WKLPKF    KK KG++DL +  PE+D                             IDI GKK KG  DV+   P +DID+
Sbjct: 5793 PNVDIDFHKPDMDIEVDIDGKKNK--HGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVD-----------------------------IDIHGKKPKGGFDVNFKKPNIDIDI 5877          
BLAST of SMED30008609 vs. Planmine SMEST
Match: SMESG000052306.1 (SMESG000052306.1)

HSP 1 Score: 486.493 bits (1251), Expect = 2.469e-156
Identity = 322/338 (95.27%), Postives = 324/338 (95.86%), Query Frame = 1
Query:   46 MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQISKKRSS+SSHSSSKSS SNKGLRKIKGKSLKKTTKKGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLD NTPEIDFDGNAKKSKDK K  K    +NVE P ASIDIQGKK KGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct:    1 MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQISKKRSSVSSHSSSKSSGSNKGLRKIKGKSLKKTTKKGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDTNTPEIDFDGNAKKSKDKLKKGKLD--INVEEPYASIDIQGKKLKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 336          

HSP 2 Score: 131.339 bits (329), Expect = 3.850e-33
Identity = 96/106 (90.57%), Postives = 99/106 (93.40%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAK SKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID+DGKKKNIGLDINLP
Sbjct: 1042 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKISKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDIDGKKKNIGLDINLP 1147          

HSP 3 Score: 129.028 bits (323), Expect = 2.104e-32
Identity = 104/147 (70.75%), Postives = 112/147 (76.19%), Query Frame = 1
Query:  634 LTITAGLEFQ-----IKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            L    GL+F+      K  V   V     D + D K    ++ H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 4449 LPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISEKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4595          

HSP 4 Score: 126.331 bits (316), Expect = 1.788e-31
Identity = 96/106 (90.57%), Postives = 98/106 (92.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 2163 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 2268          

HSP 5 Score: 125.176 bits (313), Expect = 4.212e-31
Identity = 95/106 (89.62%), Postives = 98/106 (92.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 5199 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 5304          

HSP 6 Score: 100.908 bits (250), Expect = 6.422e-23
Identity = 60/106 (56.60%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNK K                                  +DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 3778 KKHGIDINLPNWKFPKFSNKRK----------------------------------IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 3849          

HSP 7 Score: 96.6709 bits (239), Expect = 1.572e-21
Identity = 87/127 (68.50%), Postives = 92/127 (72.44%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSI----------------------PEVDIDVDGKKKNIGLDINL 1056
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHL+                       PEVDID+ GKK     D+NL
Sbjct: 1595 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 1721          

HSP 8 Score: 96.6709 bits (239), Expect = 1.572e-21
Identity = 87/127 (68.50%), Postives = 92/127 (72.44%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSI----------------------PEVDIDVDGKKKNIGLDINL 1056
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHL+                       PEVDID+ GKK     D+NL
Sbjct: 3165 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 3291          

HSP 9 Score: 92.4337 bits (228), Expect = 3.946e-20
Identity = 47/50 (94.00%), Postives = 48/50 (96.00%), Query Frame = 1
Query:  910 LDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            +DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 4208 IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4257          

HSP 10 Score: 76.2554 bits (186), Expect = 1.023e-14
Identity = 55/142 (38.73%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPNV  ++N  K D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P VD+           D DGKKK  GLDINLP
Sbjct: 5571 KPNVDIDIN--KPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNVDVDNNKPDIYIDLDADGKKKKHGLDINLP 5681          

HSP 11 Score: 76.2554 bits (186), Expect = 1.090e-14
Identity = 54/142 (38.03%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  GLDINLP
Sbjct:  770 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 880          

HSP 12 Score: 75.0998 bits (183), Expect = 2.247e-14
Identity = 54/142 (38.03%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  GLDINLP
Sbjct:  382 KPNVDIDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 492          

HSP 13 Score: 72.4034 bits (176), Expect = 1.522e-13
Identity = 53/142 (37.32%), Postives = 68/142 (47.89%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  +V+ NK D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 5649 KPNV--DVDNNKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 5759          

HSP 14 Score: 71.633 bits (174), Expect = 2.732e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 3434 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPPFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 3544          

HSP 15 Score: 71.633 bits (174), Expect = 2.884e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  ++N  K D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 4875 KPNVDIDIN--KPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 4985          

HSP 16 Score: 71.633 bits (174), Expect = 3.360e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4719 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4829          

HSP 17 Score: 70.4774 bits (171), Expect = 6.835e-13
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D+           DGKKK  G  INLP
Sbjct: 2548 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDADGKKKKHGFGINLP 2658          

HSP 18 Score: 70.4774 bits (171), Expect = 7.545e-13
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV   +N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 1723 KPNVDVYINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 1833          

HSP 19 Score: 70.0922 bits (170), Expect = 9.615e-13
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D       K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2392 KPNI--DVDNNKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2502          

HSP 20 Score: 70.0922 bits (170), Expect = 1.110e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2626 KPNIDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVYINKPDIDIDLDVDGKKKKHGFGINLP 2736          

HSP 21 Score: 70.0922 bits (170), Expect = 1.110e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 3356 KPNIDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 3466          

HSP 22 Score: 69.707 bits (169), Expect = 1.151e-12
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+D DGKKK  G  INLP
Sbjct: 2314 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDNNKPDIDIDLDADGKKKKHGFGINLP 2424          

HSP 23 Score: 69.707 bits (169), Expect = 1.182e-12
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+L  P VDID+           DGKKK  GLDINLP
Sbjct: 4797 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 4907          

HSP 24 Score: 69.707 bits (169), Expect = 1.182e-12
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+L  P VDID+           DGKKK  GLDINLP
Sbjct: 5493 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 5603          

HSP 25 Score: 69.707 bits (169), Expect = 1.236e-12
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 2841 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 2951          

HSP 26 Score: 69.707 bits (169), Expect = 1.259e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G      H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct:  614 KPNIDVDINKPDIDIDLDVDGKKIK--HGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 724          

HSP 27 Score: 69.707 bits (169), Expect = 1.270e-12
Identity = 52/142 (36.62%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 2470 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2580          

HSP 28 Score: 69.3218 bits (168), Expect = 1.707e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4641 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 4751          

HSP 29 Score: 69.3218 bits (168), Expect = 1.867e-12
Identity = 51/142 (35.92%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct:  692 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 802          

HSP 30 Score: 69.3218 bits (168), Expect = 1.867e-12
Identity = 51/142 (35.92%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 1801 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 1911          

HSP 31 Score: 68.9366 bits (167), Expect = 2.080e-12
Identity = 64/172 (37.21%), Postives = 81/172 (47.09%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDL------------DINTPEIDFXXXXXXXXX------------------XXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV   +N+   D + D  G    K H    +  +WKLP F  K KK KG++D+            DIN P+ID D +    K                   K K  KG++D++VE P+  IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 2704 KPNVDVYINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2873          

HSP 32 Score: 68.9366 bits (167), Expect = 2.136e-12
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H +D +  +WKLPKF  K KK KG                               D++VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct:  460 KPNIDVDINKPDIDIDLDVDGKK--KKHGLDINLPDWKLPKFEGKLKKPKG-------------------------------DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 568          

HSP 33 Score: 68.5514 bits (166), Expect = 2.871e-12
Identity = 53/142 (37.32%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +DID           +D KKK  GLDINLP
Sbjct: 1271 KPNVDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDIDNNKPDIDIDLDIDSKKKKHGLDINLP 1381          

HSP 34 Score: 68.5514 bits (166), Expect = 3.112e-12
Identity = 51/131 (38.93%), Postives = 72/131 (54.96%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D D + KK+K        K D  ++ P   ID+  K    DID H    ++++D+DGKKK  GLD NLP
Sbjct: 3957 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIVVNLKKPD--IDKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4083          

HSP 35 Score: 68.1662 bits (165), Expect = 3.824e-12
Identity = 55/159 (34.59%), Postives = 81/159 (50.94%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEV--PDASIDI-----------------------QGKKHKGDIDVHLSIPEVDIDVDGKKKNI----GLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D D +  ++K        K D+ +++  PD  I+I                       +GKK K ++D+ +  P +DID+DGKK  I    G+DINLP
Sbjct: 4343 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISEKHGIDINLP 4499          

HSP 36 Score: 68.1662 bits (165), Expect = 4.335e-12
Identity = 51/141 (36.17%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKK   G  INLP
Sbjct:  537 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKIKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKIKHGFGINLP 646          

HSP 37 Score: 67.781 bits (164), Expect = 5.569e-12
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D           +D KKK  GLDINLP
Sbjct: 1879 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDNNKPDIDIDLDIDSKKKKHGLDINLP 1989          

HSP 38 Score: 67.3958 bits (163), Expect = 7.218e-12
Identity = 51/142 (35.92%), Postives = 64/142 (45.07%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D       K H    +  NWKLP F  K KK  G++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+D+           DGKKK  G  INLP
Sbjct: 1193 KPNI--DVDNNKPDIDIDLDVDGKKKKHGFGINLPNWKLPTFEGKVKKPNGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDADGKKKKHGFGINLP 1303          

HSP 39 Score: 66.6254 bits (161), Expect = 1.118e-11
Identity = 45/117 (38.46%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4586 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4673          

HSP 40 Score: 66.6254 bits (161), Expect = 1.118e-11
Identity = 45/117 (38.46%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 5295 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5382          

HSP 41 Score: 66.2402 bits (160), Expect = 1.475e-11
Identity = 59/178 (33.15%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEI-----------DFXXXXXXXXXXXXXXXXXLDVNVEV-------------------------PDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+           DFD N KK        K  +D++++V                         P+  IDI  KK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 5350 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKRIDIDVEGPEVDIDIHWKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5525          

HSP 42 Score: 65.4698 bits (158), Expect = 3.094e-11
Identity = 50/137 (36.50%), Postives = 79/137 (57.66%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKK------HKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H +D +  +WKLPKF  K KK KG  DLD+  P+ID D + KK K +        +V+++     IDI+ K       +K D+++ ++ P++DI++DGKKK  G++I LP
Sbjct:  848 KPNIDVDINKPDIDIDLDVDGKK--KKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIESKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 980          

HSP 43 Score: 65.0846 bits (157), Expect = 3.832e-11
Identity = 44/117 (37.61%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2259 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2346          

HSP 44 Score: 65.0846 bits (157), Expect = 3.866e-11
Identity = 52/150 (34.67%), Postives = 74/150 (49.33%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI-----------------QGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE  ID  G   K       KK  +D+++  PD  ID+                 Q K+   DID H    ++++D+DGKKK  GLD NLP
Sbjct: 3512 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDAMARKRNMETERRNRSQCKEPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 3659          

HSP 45 Score: 64.6994 bits (156), Expect = 5.142e-11
Identity = 50/133 (37.59%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVD----------------LDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D                LDIN P+        K K    +      ++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKK  GLD NLP
Sbjct: 4248 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEVQKYRQQEKKHGLDINLPDWKLPKFEGKLKKPKGA------LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4374          

HSP 46 Score: 64.3142 bits (155), Expect = 6.199e-11
Identity = 46/117 (39.32%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D   PE+D                             IDI GKK KGD DV+L  P VDI           DVDGKKK  G  INLP
Sbjct:  327 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDFEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDVDGKKKKHGFGINLP 414          

HSP 47 Score: 63.929 bits (154), Expect = 1.039e-10
Identity = 45/117 (38.46%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KN  +D +  +WKLPKF  K KK KG++D+D+  PE D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 1138 KNIGLDINLPDWKLPKFEGKIKKPKGEIDIDVEGPEFD-----------------------------IDIHGKKPKGDFDVNLKKPNIDVDNNKPDIDIDLDVDGKKKKHGFGINLP 1225          

HSP 48 Score: 63.5438 bits (153), Expect = 1.208e-10
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  +++ NK D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 1349 KPNI--DIDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 1457          

HSP 49 Score: 63.5438 bits (153), Expect = 1.263e-10
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 2919 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 3027          

HSP 50 Score: 63.5438 bits (153), Expect = 1.263e-10
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 4953 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 5061          

HSP 51 Score: 63.1586 bits (152), Expect = 1.522e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 1426 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 1533          

HSP 52 Score: 63.1586 bits (152), Expect = 1.522e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 2996 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3103          

HSP 53 Score: 63.1586 bits (152), Expect = 1.522e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 3628 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3735          

HSP 54 Score: 63.1586 bits (152), Expect = 1.522e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 5030 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 5137          

HSP 55 Score: 62.003 bits (149), Expect = 3.477e-10
Identity = 54/149 (36.24%), Postives = 82/149 (55.03%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXX---------XLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D    +  K H +D +  +WKLPKF  K KK KG   LD+  P+ID D + KK K +               K D+++E P+  +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 1957 KPNI--DVDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 2101          

HSP 56 Score: 57.7658 bits (138), Expect = 9.091e-9
Identity = 51/155 (32.90%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASI--DIQGKKHK-----------------------GDIDVHLSIPEVDIDVDGKKKNIGLDINL 1056
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D +    ++D  G   K +     K   +D++   PD  I  DI GKK+K                       G+ID+++  PEVDID+ GKK   G D+N 
Sbjct: 5727 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDFEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDMDIEVDIDGKKNKHGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVDIDIHGKKPKGGFDVNF 5879          

HSP 57 Score: 56.6102 bits (135), Expect = 2.118e-8
Identity = 53/150 (35.33%), Postives = 67/150 (44.67%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI----QGKKH---------------------------KGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE  ID  G   K       KK  +DV++  PD  ID+    + KKH                           KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 3840 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKKSTLTFMGKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 3989          

HSP 58 Score: 55.0694 bits (131), Expect = 6.820e-8
Identity = 55/146 (37.67%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI------------QGKKHKGDIDVHLSIP----EVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D               KG +DV    PD  IDI             GKKH+   D+ +  P    ++DIDV  KKK  G+DINLP
Sbjct: 4052 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-------DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLP 4188          

HSP 59 Score: 52.7582 bits (125), Expect = 3.029e-7
Identity = 38/116 (32.76%), Postives = 51/116 (43.97%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1017
            PNV  + ++   D E D  G      H +D +  +WKLPKF    KK KG++DL +  PE+D                             IDI GKK KG  DV+   P +DID+
Sbjct: 5804 PNVDIDFHKPDMDIEVDIDGKKNK--HGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVD-----------------------------IDIHGKKPKGGFDVNFKKPNIDIDI 5888          
BLAST of SMED30008609 vs. Planmine SMEST
Match: SMESG000052306.1 (SMESG000052306.1)

HSP 1 Score: 486.108 bits (1250), Expect = 2.881e-156
Identity = 322/338 (95.27%), Postives = 324/338 (95.86%), Query Frame = 1
Query:   46 MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQISKKRSS+SSHSSSKSS SNKGLRKIKGKSLKKTTKKGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLD NTPEIDFDGNAKKSKDK K  K    +NVE P ASIDIQGKK KGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct:    1 MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQISKKRSSVSSHSSSKSSGSNKGLRKIKGKSLKKTTKKGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDTNTPEIDFDGNAKKSKDKLKKGKLD--INVEEPYASIDIQGKKLKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 336          

HSP 2 Score: 130.954 bits (328), Expect = 4.035e-33
Identity = 96/106 (90.57%), Postives = 99/106 (93.40%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAK SKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID+DGKKKNIGLDINLP
Sbjct: 1042 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKISKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDIDGKKKNIGLDINLP 1147          

HSP 3 Score: 129.028 bits (323), Expect = 2.226e-32
Identity = 104/147 (70.75%), Postives = 112/147 (76.19%), Query Frame = 1
Query:  634 LTITAGLEFQ-----IKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            L    GL+F+      K  V   V     D + D K    ++ H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 4434 LPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISEKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4580          

HSP 4 Score: 126.331 bits (316), Expect = 1.909e-31
Identity = 96/106 (90.57%), Postives = 98/106 (92.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 2163 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 2268          

HSP 5 Score: 125.176 bits (313), Expect = 4.498e-31
Identity = 95/106 (89.62%), Postives = 98/106 (92.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 5184 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 5289          

HSP 6 Score: 100.908 bits (250), Expect = 6.788e-23
Identity = 60/106 (56.60%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNK K                                  +DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 3761 KKHGIDINLPNWKFPKFSNKRK----------------------------------IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 3832          

HSP 7 Score: 96.6709 bits (239), Expect = 1.646e-21
Identity = 87/127 (68.50%), Postives = 92/127 (72.44%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSI----------------------PEVDIDVDGKKKNIGLDINL 1056
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHL+                       PEVDID+ GKK     D+NL
Sbjct: 1595 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 1721          

HSP 8 Score: 96.6709 bits (239), Expect = 1.646e-21
Identity = 87/127 (68.50%), Postives = 92/127 (72.44%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSI----------------------PEVDIDVDGKKKNIGLDINL 1056
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHL+                       PEVDID+ GKK     D+NL
Sbjct: 3165 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 3291          

HSP 9 Score: 92.4337 bits (228), Expect = 4.208e-20
Identity = 47/50 (94.00%), Postives = 48/50 (96.00%), Query Frame = 1
Query:  910 LDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            +DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 4193 IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4242          

HSP 10 Score: 76.2554 bits (186), Expect = 1.014e-14
Identity = 55/142 (38.73%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPNV  ++N  K D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P VD+           D DGKKK  GLDINLP
Sbjct: 5547 KPNVDIDIN--KPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNVDVDNNKPDIYIDLDADGKKKKHGLDINLP 5657          

HSP 11 Score: 76.2554 bits (186), Expect = 1.100e-14
Identity = 54/142 (38.03%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  GLDINLP
Sbjct:  770 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 880          

HSP 12 Score: 75.0998 bits (183), Expect = 2.267e-14
Identity = 54/142 (38.03%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  GLDINLP
Sbjct:  382 KPNVDIDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 492          

HSP 13 Score: 72.4034 bits (176), Expect = 1.508e-13
Identity = 53/142 (37.32%), Postives = 68/142 (47.89%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  +V+ NK D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 5625 KPNV--DVDNNKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 5735          

HSP 14 Score: 72.0182 bits (175), Expect = 2.635e-13
Identity = 49/133 (36.84%), Postives = 72/133 (54.14%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE  ID  G   K       KK  +D+++  PD  ID+     K ++D H    ++++D+DGKKK  GLD NLP
Sbjct: 3512 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDAMARKRNMDFHKPDIDIEVDIDGKKKKHGLDFNLP 3642          

HSP 15 Score: 71.633 bits (174), Expect = 2.781e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 3434 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPPFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 3544          

HSP 16 Score: 71.633 bits (174), Expect = 2.832e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  ++N  K D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 4860 KPNVDIDIN--KPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 4970          

HSP 17 Score: 71.633 bits (174), Expect = 3.241e-13
Identity = 61/169 (36.09%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXX---------------------------XXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D D + KK K                              K K G++D++VE P+  IDI  KK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 5335 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGRIDIDVEGPEVDIDIHWKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5501          

HSP 18 Score: 71.633 bits (174), Expect = 3.421e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4704 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4814          

HSP 19 Score: 70.4774 bits (171), Expect = 6.896e-13
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D+           DGKKK  G  INLP
Sbjct: 2548 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDADGKKKKHGFGINLP 2658          

HSP 20 Score: 70.4774 bits (171), Expect = 7.681e-13
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV   +N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 1723 KPNVDVYINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 1833          

HSP 21 Score: 70.0922 bits (170), Expect = 9.700e-13
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D       K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2392 KPNI--DVDNNKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2502          

HSP 22 Score: 69.707 bits (169), Expect = 1.120e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2626 KPNIDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVYINKPDIDIDLDVDGKKKKHGFGINLP 2736          

HSP 23 Score: 69.707 bits (169), Expect = 1.120e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 3356 KPNIDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 3466          

HSP 24 Score: 69.707 bits (169), Expect = 1.161e-12
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+D DGKKK  G  INLP
Sbjct: 2314 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDNNKPDIDIDLDADGKKKKHGFGINLP 2424          

HSP 25 Score: 69.707 bits (169), Expect = 1.182e-12
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+L  P VDID+           DGKKK  GLDINLP
Sbjct: 4782 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 4892          

HSP 26 Score: 69.707 bits (169), Expect = 1.182e-12
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+L  P VDID+           DGKKK  GLDINLP
Sbjct: 5469 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 5579          

HSP 27 Score: 69.707 bits (169), Expect = 1.236e-12
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 2841 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 2951          

HSP 28 Score: 69.707 bits (169), Expect = 1.270e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G      H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct:  614 KPNIDVDINKPDIDIDLDVDGKKIK--HGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 724          

HSP 29 Score: 69.707 bits (169), Expect = 1.293e-12
Identity = 52/142 (36.62%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 2470 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2580          

HSP 30 Score: 69.3218 bits (168), Expect = 1.722e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4626 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 4736          

HSP 31 Score: 69.3218 bits (168), Expect = 1.884e-12
Identity = 51/142 (35.92%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct:  692 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 802          

HSP 32 Score: 69.3218 bits (168), Expect = 1.884e-12
Identity = 51/142 (35.92%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 1801 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 1911          

HSP 33 Score: 68.9366 bits (167), Expect = 2.098e-12
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H +D +  +WKLPKF  K KK KG                               D++VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct:  460 KPNIDVDINKPDIDIDLDVDGKK--KKHGLDINLPDWKLPKFEGKLKKPKG-------------------------------DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 568          

HSP 34 Score: 68.9366 bits (167), Expect = 2.136e-12
Identity = 64/172 (37.21%), Postives = 81/172 (47.09%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDL------------DINTPEIDFXXXXXXXXX------------------XXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV   +N+   D + D  G    K H    +  +WKLP F  K KK KG++D+            DIN P+ID D +    K                   K K  KG++D++VE P+  IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 2704 KPNVDVYINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2873          

HSP 35 Score: 68.5514 bits (166), Expect = 2.897e-12
Identity = 53/142 (37.32%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +DID           +D KKK  GLDINLP
Sbjct: 1271 KPNVDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDIDNNKPDIDIDLDIDSKKKKHGLDINLP 1381          

HSP 36 Score: 68.5514 bits (166), Expect = 3.084e-12
Identity = 51/131 (38.93%), Postives = 72/131 (54.96%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D D + KK+K        K D  ++ P   ID+  K    DID H    ++++D+DGKKK  GLD NLP
Sbjct: 3942 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIVVNLKKPD--IDKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4068          

HSP 37 Score: 68.1662 bits (165), Expect = 3.722e-12
Identity = 55/159 (34.59%), Postives = 81/159 (50.94%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEV--PDASIDI-----------------------QGKKHKGDIDVHLSIPEVDIDVDGKKKNI----GLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D D +  ++K        K D+ +++  PD  I+I                       +GKK K ++D+ +  P +DID+DGKK  I    G+DINLP
Sbjct: 4328 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISEKHGIDINLP 4484          

HSP 38 Score: 68.1662 bits (165), Expect = 4.373e-12
Identity = 51/141 (36.17%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKK   G  INLP
Sbjct:  537 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKIKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKIKHGFGINLP 646          

HSP 39 Score: 67.781 bits (164), Expect = 5.618e-12
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D           +D KKK  GLDINLP
Sbjct: 1879 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDNNKPDIDIDLDIDSKKKKHGLDINLP 1989          

HSP 40 Score: 67.3958 bits (163), Expect = 7.282e-12
Identity = 51/142 (35.92%), Postives = 64/142 (45.07%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D       K H    +  NWKLP F  K KK  G++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+D+           DGKKK  G  INLP
Sbjct: 1193 KPNI--DVDNNKPDIDIDLDVDGKKKKHGFGINLPNWKLPTFEGKVKKPNGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDADGKKKKHGFGINLP 1303          

HSP 41 Score: 66.6254 bits (161), Expect = 1.128e-11
Identity = 45/117 (38.46%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4571 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4658          

HSP 42 Score: 66.6254 bits (161), Expect = 1.128e-11
Identity = 45/117 (38.46%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 5280 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5367          

HSP 43 Score: 65.4698 bits (158), Expect = 3.012e-11
Identity = 50/137 (36.50%), Postives = 79/137 (57.66%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKK------HKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H +D +  +WKLPKF  K KK KG  DLD+  P+ID D + KK K +        +V+++     IDI+ K       +K D+++ ++ P++DI++DGKKK  G++I LP
Sbjct:  848 KPNIDVDINKPDIDIDLDVDGKK--KKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIESKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 980          

HSP 44 Score: 65.0846 bits (157), Expect = 3.866e-11
Identity = 44/117 (37.61%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2259 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2346          

HSP 45 Score: 64.6994 bits (156), Expect = 5.095e-11
Identity = 50/133 (37.59%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVD----------------LDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D                LDIN P+        K K    +      ++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKK  GLD NLP
Sbjct: 4233 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEVQKYRQQEKKHGLDINLPDWKLPKFEGKLKKPKGA------LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4359          

HSP 46 Score: 64.3142 bits (155), Expect = 6.309e-11
Identity = 46/117 (39.32%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D   PE+D                             IDI GKK KGD DV+L  P VDI           DVDGKKK  G  INLP
Sbjct:  327 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDFEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDVDGKKKKHGFGINLP 414          

HSP 47 Score: 63.929 bits (154), Expect = 1.048e-10
Identity = 45/117 (38.46%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KN  +D +  +WKLPKF  K KK KG++D+D+  PE D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 1138 KNIGLDINLPDWKLPKFEGKIKKPKGEIDIDVEGPEFD-----------------------------IDIHGKKPKGDFDVNLKKPNIDVDNNKPDIDIDLDVDGKKKKHGFGINLP 1225          

HSP 48 Score: 63.5438 bits (153), Expect = 1.219e-10
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  +++ NK D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 1349 KPNI--DIDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 1457          

HSP 49 Score: 63.5438 bits (153), Expect = 1.274e-10
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 2919 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 3027          

HSP 50 Score: 63.5438 bits (153), Expect = 1.274e-10
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 4938 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 5046          

HSP 51 Score: 63.1586 bits (152), Expect = 1.495e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 1426 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 1533          

HSP 52 Score: 63.1586 bits (152), Expect = 1.495e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 2996 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3103          

HSP 53 Score: 63.1586 bits (152), Expect = 1.495e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 5015 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 5122          

HSP 54 Score: 62.003 bits (149), Expect = 3.508e-10
Identity = 54/149 (36.24%), Postives = 82/149 (55.03%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXX---------XLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D    +  K H +D +  +WKLPKF  K KK KG   LD+  P+ID D + KK K +               K D+++E P+  +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 1957 KPNI--DVDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 2101          

HSP 55 Score: 60.077 bits (144), Expect = 1.610e-9
Identity = 42/134 (31.34%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  685 NVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            N++ +K D + +       K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 3614 NMDFHKPDIDIEVDIDGKKKKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3718          

HSP 56 Score: 57.7658 bits (138), Expect = 9.090e-9
Identity = 51/155 (32.90%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASI--DIQGKKHK-----------------------GDIDVHLSIPEVDIDVDGKKKNIGLDINL 1056
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D +    ++D  G   K +     K   +D++   PD  I  DI GKK+K                       G+ID+++  PEVDID+ GKK   G D+N 
Sbjct: 5703 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDFEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDMDIEVDIDGKKNKHGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVDIDIHGKKPKGGFDVNF 5855          

HSP 57 Score: 55.8398 bits (133), Expect = 3.752e-8
Identity = 53/152 (34.87%), Postives = 67/152 (44.08%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI----QGKKH-----------------------------KGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE  ID  G   K       KK  +DV++  PD  ID+    + KKH                             KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 3823 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVQKSTLTFMGKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 3974          

HSP 58 Score: 55.0694 bits (131), Expect = 7.125e-8
Identity = 55/146 (37.67%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI------------QGKKHKGDIDVHLSIP----EVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D               KG +DV    PD  IDI             GKKH+   D+ +  P    ++DIDV  KKK  G+DINLP
Sbjct: 4037 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-------DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLP 4173          

HSP 59 Score: 52.7582 bits (125), Expect = 3.002e-7
Identity = 38/116 (32.76%), Postives = 51/116 (43.97%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1017
            PNV  + ++   D E D  G      H +D +  +WKLPKF    KK KG++DL +  PE+D                             IDI GKK KG  DV+   P +DID+
Sbjct: 5780 PNVDIDFHKPDMDIEVDIDGKKNK--HGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVD-----------------------------IDIHGKKPKGGFDVNFKKPNIDIDI 5864          
BLAST of SMED30008609 vs. Planmine SMEST
Match: SMESG000052306.1 (SMESG000052306.1)

HSP 1 Score: 486.108 bits (1250), Expect = 2.937e-156
Identity = 322/338 (95.27%), Postives = 324/338 (95.86%), Query Frame = 1
Query:   46 MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQISKKRSS+SSHSSSKSS SNKGLRKIKGKSLKKTTKKGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLD NTPEIDFDGNAKKSKDK K  K    +NVE P ASIDIQGKK KGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct:    1 MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQISKKRSSVSSHSSSKSSGSNKGLRKIKGKSLKKTTKKGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDTNTPEIDFDGNAKKSKDKLKKGKLD--INVEEPYASIDIQGKKLKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 336          

HSP 2 Score: 130.954 bits (328), Expect = 4.112e-33
Identity = 96/106 (90.57%), Postives = 99/106 (93.40%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAK SKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID+DGKKKNIGLDINLP
Sbjct: 1042 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKISKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDIDGKKKNIGLDINLP 1147          

HSP 3 Score: 126.331 bits (316), Expect = 1.927e-31
Identity = 96/106 (90.57%), Postives = 98/106 (92.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 2163 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 2268          

HSP 4 Score: 125.176 bits (313), Expect = 4.541e-31
Identity = 95/106 (89.62%), Postives = 98/106 (92.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 5190 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 5295          

HSP 5 Score: 124.02 bits (310), Expect = 1.121e-30
Identity = 96/107 (89.72%), Postives = 99/107 (92.52%), Query Frame = 1
Query:  742 KNHRVDKHSL-NWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K HR+   +L NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 4480 KKHRISDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4586          

HSP 6 Score: 100.908 bits (250), Expect = 6.789e-23
Identity = 60/106 (56.60%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNK K                                  +DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 3783 KKHGIDINLPNWKFPKFSNKRK----------------------------------IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 3854          

HSP 7 Score: 97.0561 bits (240), Expect = 1.380e-21
Identity = 88/132 (66.67%), Postives = 93/132 (70.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSI---------------------------PEVDIDVDGKKKNIGLDINL 1056
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHL+I                           PEVDID+ GKK     D+NL
Sbjct: 3165 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 3296          

HSP 8 Score: 96.6709 bits (239), Expect = 1.677e-21
Identity = 87/127 (68.50%), Postives = 92/127 (72.44%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSI----------------------PEVDIDVDGKKKNIGLDINL 1056
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHL+                       PEVDID+ GKK     D+NL
Sbjct: 1595 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 1721          

HSP 9 Score: 92.4337 bits (228), Expect = 4.170e-20
Identity = 47/50 (94.00%), Postives = 48/50 (96.00%), Query Frame = 1
Query:  910 LDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            +DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 4204 IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4253          

HSP 10 Score: 76.2554 bits (186), Expect = 1.032e-14
Identity = 55/142 (38.73%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPNV  ++N  K D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P VD+           D DGKKK  GLDINLP
Sbjct: 5562 KPNVDIDIN--KPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNVDVDNNKPDIYIDLDADGKKKKHGLDINLP 5672          

HSP 11 Score: 75.8702 bits (185), Expect = 1.110e-14
Identity = 54/142 (38.03%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  GLDINLP
Sbjct:  770 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 880          

HSP 12 Score: 75.0998 bits (183), Expect = 2.288e-14
Identity = 54/142 (38.03%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  GLDINLP
Sbjct:  382 KPNVDIDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 492          

HSP 13 Score: 72.4034 bits (176), Expect = 1.536e-13
Identity = 53/142 (37.32%), Postives = 68/142 (47.89%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  +V+ NK D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 5640 KPNV--DVDNNKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 5750          

HSP 14 Score: 71.633 bits (174), Expect = 2.807e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 3439 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPPFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 3549          

HSP 15 Score: 71.633 bits (174), Expect = 2.884e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  ++N  K D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 4866 KPNVDIDIN--KPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 4976          

HSP 16 Score: 71.633 bits (174), Expect = 3.452e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4710 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4820          

HSP 17 Score: 70.4774 bits (171), Expect = 6.959e-13
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D+           DGKKK  G  INLP
Sbjct: 2548 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDADGKKKKHGFGINLP 2658          

HSP 18 Score: 70.4774 bits (171), Expect = 7.751e-13
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV   +N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 1723 KPNVDVYINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 1833          

HSP 19 Score: 70.0922 bits (170), Expect = 9.877e-13
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D       K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2392 KPNI--DVDNNKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2502          

HSP 20 Score: 69.707 bits (169), Expect = 1.130e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2626 KPNIDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVYINKPDIDIDLDVDGKKKKHGFGINLP 2736          

HSP 21 Score: 69.707 bits (169), Expect = 1.130e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 3361 KPNIDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 3471          

HSP 22 Score: 69.707 bits (169), Expect = 1.171e-12
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+D DGKKK  G  INLP
Sbjct: 2314 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDNNKPDIDIDLDADGKKKKHGFGINLP 2424          

HSP 23 Score: 69.707 bits (169), Expect = 1.193e-12
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+L  P VDID+           DGKKK  GLDINLP
Sbjct: 4788 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 4898          

HSP 24 Score: 69.707 bits (169), Expect = 1.193e-12
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+L  P VDID+           DGKKK  GLDINLP
Sbjct: 5484 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 5594          

HSP 25 Score: 69.707 bits (169), Expect = 1.247e-12
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 2841 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 2951          

HSP 26 Score: 69.707 bits (169), Expect = 1.281e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G      H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct:  614 KPNIDVDINKPDIDIDLDVDGKKIK--HGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 724          

HSP 27 Score: 69.707 bits (169), Expect = 1.304e-12
Identity = 52/142 (36.62%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 2470 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2580          

HSP 28 Score: 69.3218 bits (168), Expect = 1.738e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4632 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 4742          

HSP 29 Score: 69.3218 bits (168), Expect = 1.901e-12
Identity = 51/142 (35.92%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct:  692 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 802          

HSP 30 Score: 69.3218 bits (168), Expect = 1.901e-12
Identity = 51/142 (35.92%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 1801 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 1911          

HSP 31 Score: 68.9366 bits (167), Expect = 2.117e-12
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H +D +  +WKLPKF  K KK KG                               D++VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct:  460 KPNIDVDINKPDIDIDLDVDGKK--KKHGLDINLPDWKLPKFEGKLKKPKG-------------------------------DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 568          

HSP 32 Score: 68.9366 bits (167), Expect = 2.155e-12
Identity = 64/172 (37.21%), Postives = 81/172 (47.09%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDL------------DINTPEIDFXXXXXXXXX------------------XXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV   +N+   D + D  G    K H    +  +WKLP F  K KK KG++D+            DIN P+ID D +    K                   K K  KG++D++VE P+  IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 2704 KPNVDVYINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2873          

HSP 33 Score: 68.5514 bits (166), Expect = 2.845e-12
Identity = 51/147 (34.69%), Postives = 67/147 (45.58%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVD----------------IDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDI V+L  P++D                +D+DGKKK  GLD NLP
Sbjct: 3964 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIVVNLKKPDIDNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4079          

HSP 34 Score: 68.5514 bits (166), Expect = 2.897e-12
Identity = 53/142 (37.32%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +DID           +D KKK  GLDINLP
Sbjct: 1271 KPNVDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDIDNNKPDIDIDLDIDSKKKKHGLDINLP 1381          

HSP 35 Score: 68.1662 bits (165), Expect = 4.373e-12
Identity = 51/141 (36.17%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKK   G  INLP
Sbjct:  537 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKIKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKIKHGFGINLP 646          

HSP 36 Score: 67.781 bits (164), Expect = 5.619e-12
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D           +D KKK  GLDINLP
Sbjct: 1879 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDNNKPDIDIDLDIDSKKKKHGLDINLP 1989          

HSP 37 Score: 67.3958 bits (163), Expect = 7.348e-12
Identity = 51/142 (35.92%), Postives = 64/142 (45.07%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D       K H    +  NWKLP F  K KK  G++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+D+           DGKKK  G  INLP
Sbjct: 1193 KPNI--DVDNNKPDIDIDLDVDGKKKKHGFGINLPNWKLPTFEGKVKKPNGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDADGKKKKHGFGINLP 1303          

HSP 38 Score: 66.6254 bits (161), Expect = 1.139e-11
Identity = 45/117 (38.46%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4577 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4664          

HSP 39 Score: 66.6254 bits (161), Expect = 1.139e-11
Identity = 45/117 (38.46%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 5286 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5373          

HSP 40 Score: 66.2402 bits (160), Expect = 1.515e-11
Identity = 59/178 (33.15%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEI-----------DFXXXXXXXXXXXXXXXXXLDVNVEV-------------------------PDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+           DFD N KK        K  +D++++V                         P+  IDI  KK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 5341 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKRIDIDVEGPEVDIDIHWKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5516          

HSP 41 Score: 65.855 bits (159), Expect = 2.588e-11
Identity = 54/155 (34.84%), Postives = 79/155 (50.97%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEV--PDASIDI-----------------------QGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D D +  ++K        K D+ +++  PD  I+I                       +GKK K ++D+ +  P +DID+DGKK  I  DINLP
Sbjct: 4339 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRIS-DINLP 4490          

HSP 42 Score: 65.4698 bits (158), Expect = 3.066e-11
Identity = 50/137 (36.50%), Postives = 79/137 (57.66%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKK------HKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H +D +  +WKLPKF  K KK KG  DLD+  P+ID D + KK K +        +V+++     IDI+ K       +K D+++ ++ P++DI++DGKKK  G++I LP
Sbjct:  848 KPNIDVDINKPDIDIDLDVDGKK--KKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIESKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 980          

HSP 43 Score: 65.0846 bits (157), Expect = 3.764e-11
Identity = 52/150 (34.67%), Postives = 74/150 (49.33%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI-----------------QGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE  ID  G   K       KK  +D+++  PD  ID+                 Q K+   DID H    ++++D+DGKKK  GLD NLP
Sbjct: 3517 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDAMARKRNMETERRNRSQCKEPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 3664          

HSP 44 Score: 65.0846 bits (157), Expect = 3.900e-11
Identity = 44/117 (37.61%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2259 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2346          

HSP 45 Score: 64.6994 bits (156), Expect = 5.141e-11
Identity = 50/133 (37.59%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVD----------------LDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D                LDIN P+        K K    +      ++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKK  GLD NLP
Sbjct: 4244 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEVQKYRQQEKKHGLDINLPDWKLPKFEGKLKKPKGA------LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4370          

HSP 46 Score: 64.3142 bits (155), Expect = 6.366e-11
Identity = 46/117 (39.32%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D   PE+D                             IDI GKK KGD DV+L  P VDI           DVDGKKK  G  INLP
Sbjct:  327 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDFEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDVDGKKKKHGFGINLP 414          

HSP 47 Score: 63.929 bits (154), Expect = 1.057e-10
Identity = 45/117 (38.46%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KN  +D +  +WKLPKF  K KK KG++D+D+  PE D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 1138 KNIGLDINLPDWKLPKFEGKIKKPKGEIDIDVEGPEFD-----------------------------IDIHGKKPKGDFDVNLKKPNIDVDNNKPDIDIDLDVDGKKKKHGFGINLP 1225          

HSP 48 Score: 63.5438 bits (153), Expect = 1.219e-10
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  +++ NK D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 1349 KPNI--DIDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 1457          

HSP 49 Score: 63.5438 bits (153), Expect = 1.274e-10
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 2919 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 3027          

HSP 50 Score: 63.5438 bits (153), Expect = 1.274e-10
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 4944 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 5052          

HSP 51 Score: 63.1586 bits (152), Expect = 1.509e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 1426 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 1533          

HSP 52 Score: 63.1586 bits (152), Expect = 1.509e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 2996 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3103          

HSP 53 Score: 63.1586 bits (152), Expect = 1.509e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 3633 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3740          

HSP 54 Score: 63.1586 bits (152), Expect = 1.509e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 5021 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 5128          

HSP 55 Score: 62.003 bits (149), Expect = 3.539e-10
Identity = 54/149 (36.24%), Postives = 82/149 (55.03%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXX---------XLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D    +  K H +D +  +WKLPKF  K KK KG   LD+  P+ID D + KK K +               K D+++E P+  +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 1957 KPNI--DVDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 2101          

HSP 56 Score: 57.7658 bits (138), Expect = 9.172e-9
Identity = 51/155 (32.90%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASI--DIQGKKHK-----------------------GDIDVHLSIPEVDIDVDGKKKNIGLDINL 1056
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D +    ++D  G   K +     K   +D++   PD  I  DI GKK+K                       G+ID+++  PEVDID+ GKK   G D+N 
Sbjct: 5718 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDFEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDMDIEVDIDGKKNKHGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVDIDIHGKKPKGGFDVNF 5870          

HSP 57 Score: 55.8398 bits (133), Expect = 3.785e-8
Identity = 53/152 (34.87%), Postives = 67/152 (44.08%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI----QGKKH-----------------------------KGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE  ID  G   K       KK  +DV++  PD  ID+    + KKH                             KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 3845 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVQKSTLTFMGKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 3996          

HSP 58 Score: 55.0694 bits (131), Expect = 6.820e-8
Identity = 55/146 (37.67%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI------------QGKKHKGDIDVHLSIP----EVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D               KG +DV    PD  IDI             GKKH+   D+ +  P    ++DIDV  KKK  G+DINLP
Sbjct: 4048 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-------DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLP 4184          

HSP 59 Score: 52.7582 bits (125), Expect = 3.029e-7
Identity = 38/116 (32.76%), Postives = 51/116 (43.97%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1017
            PNV  + ++   D E D  G      H +D +  +WKLPKF    KK KG++DL +  PE+D                             IDI GKK KG  DV+   P +DID+
Sbjct: 5795 PNVDIDFHKPDMDIEVDIDGKKNK--HGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVD-----------------------------IDIHGKKPKGGFDVNFKKPNIDIDI 5879          
BLAST of SMED30008609 vs. Planmine SMEST
Match: SMESG000052306.1 (SMESG000052306.1)

HSP 1 Score: 486.108 bits (1250), Expect = 3.266e-156
Identity = 322/338 (95.27%), Postives = 324/338 (95.86%), Query Frame = 1
Query:   46 MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQISKKRSS+SSHSSSKSS SNKGLRKIKGKSLKKTTKKGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLD NTPEIDFDGNAKKSKDK K  K    +NVE P ASIDIQGKK KGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct:    1 MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELPVSANFSENISTKGQISKKRSSVSSHSSSKSSGSNKGLRKIKGKSLKKTTKKGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQSSQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTITAGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDTNTPEIDFDGNAKKSKDKLKKGKLD--INVEEPYASIDIQGKKLKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 336          

HSP 2 Score: 130.954 bits (328), Expect = 4.270e-33
Identity = 96/106 (90.57%), Postives = 99/106 (93.40%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAK SKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID+DGKKKNIGLDINLP
Sbjct: 1042 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKISKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDIDGKKKNIGLDINLP 1147          

HSP 3 Score: 129.028 bits (323), Expect = 2.334e-32
Identity = 104/147 (70.75%), Postives = 112/147 (76.19%), Query Frame = 1
Query:  634 LTITAGLEFQ-----IKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            L    GL+F+      K  V   V     D + D K    ++ H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 4435 LPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISEKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4581          

HSP 4 Score: 125.946 bits (315), Expect = 2.001e-31
Identity = 96/106 (90.57%), Postives = 98/106 (92.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 2168 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 2273          

HSP 5 Score: 125.176 bits (313), Expect = 4.671e-31
Identity = 95/106 (89.62%), Postives = 98/106 (92.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGK+DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 5185 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKIDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 5290          

HSP 6 Score: 97.0561 bits (240), Expect = 1.393e-21
Identity = 88/132 (66.67%), Postives = 93/132 (70.45%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSI---------------------------PEVDIDVDGKKKNIGLDINL 1056
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHL+I                           PEVDID+ GKK     D+NL
Sbjct: 1595 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 1726          

HSP 7 Score: 96.6709 bits (239), Expect = 1.692e-21
Identity = 87/127 (68.50%), Postives = 92/127 (72.44%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSI----------------------PEVDIDVDGKKKNIGLDINL 1056
            K H +D +  NWK PKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHL+                       PEVDID+ GKK     D+NL
Sbjct: 3170 KKHGIDINLPNWKFPKFSNKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASIDIQGKKHKGDIDVHLNWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNL 3296          

HSP 8 Score: 92.4337 bits (228), Expect = 4.248e-20
Identity = 47/50 (94.00%), Postives = 48/50 (96.00%), Query Frame = 1
Query:  910 LDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            +DVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 4194 IDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 4243          

HSP 9 Score: 85.8853 bits (211), Expect = 5.795e-18
Identity = 53/106 (50.00%), Postives = 56/106 (52.83%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            K H +D +  NWK PKFSNK                                          +PDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKK  GLDINLP
Sbjct: 3772 KKHGIDINLPNWKFPKFSNK------------------------------------------IPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKKHGLDINLP 3835          

HSP 10 Score: 76.2554 bits (186), Expect = 1.080e-14
Identity = 55/142 (38.73%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPNV  ++N  K D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P VD+           D DGKKK  GLDINLP
Sbjct: 5557 KPNVDIDIN--KPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNVDVDNNKPDIYIDLDADGKKKKHGLDINLP 5667          

HSP 11 Score: 75.8702 bits (185), Expect = 1.182e-14
Identity = 54/142 (38.03%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  GLDINLP
Sbjct:  770 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 880          

HSP 12 Score: 75.0998 bits (183), Expect = 2.415e-14
Identity = 54/142 (38.03%), Postives = 69/142 (48.59%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  GLDINLP
Sbjct:  382 KPNVDIDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIDGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGLDINLP 492          

HSP 13 Score: 72.4034 bits (176), Expect = 1.592e-13
Identity = 53/142 (37.32%), Postives = 68/142 (47.89%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  +V+ NK D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 5635 KPNV--DVDNNKPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 5745          

HSP 14 Score: 71.633 bits (174), Expect = 2.962e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 3439 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPPFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 3549          

HSP 15 Score: 71.633 bits (174), Expect = 3.016e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  ++N  K D   D       K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 4861 KPNVDIDIN--KPDIYIDLDADGKKKKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 4971          

HSP 16 Score: 71.2478 bits (173), Expect = 3.643e-13
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4705 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4815          

HSP 17 Score: 70.4774 bits (171), Expect = 7.410e-13
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D+           DGKKK  G  INLP
Sbjct: 2553 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDADGKKKKHGFGINLP 2663          

HSP 18 Score: 70.4774 bits (171), Expect = 8.180e-13
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV   +N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 1728 KPNVDVYINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 1838          

HSP 19 Score: 70.0922 bits (170), Expect = 1.024e-12
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D       K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2397 KPNI--DVDNNKPDIDIDLDADGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2507          

HSP 20 Score: 69.707 bits (169), Expect = 1.203e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2631 KPNIDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVYINKPDIDIDLDVDGKKKKHGFGINLP 2741          

HSP 21 Score: 69.707 bits (169), Expect = 1.203e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 3361 KPNIDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 3471          

HSP 22 Score: 69.707 bits (169), Expect = 1.247e-12
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+D DGKKK  G  INLP
Sbjct: 2319 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDNNKPDIDIDLDADGKKKKHGFGINLP 2429          

HSP 23 Score: 69.707 bits (169), Expect = 1.281e-12
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+L  P VDID+           DGKKK  GLDINLP
Sbjct: 4783 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 4893          

HSP 24 Score: 69.707 bits (169), Expect = 1.281e-12
Identity = 52/142 (36.62%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KG  DV+L  P VDID+           DGKKK  GLDINLP
Sbjct: 5479 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGVFDVNLKKPNVDIDINKPDIYIDLDADGKKKKHGLDINLP 5589          

HSP 25 Score: 69.707 bits (169), Expect = 1.328e-12
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVD-----------GKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D++            KKK  GLDINLP
Sbjct: 2846 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDINKPDIDIDLDIDSKKKKHGLDINLP 2956          

HSP 26 Score: 69.707 bits (169), Expect = 1.364e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G      H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct:  614 KPNIDVDINKPDIDIDLDVDGKKIK--HGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 724          

HSP 27 Score: 69.707 bits (169), Expect = 1.377e-12
Identity = 52/142 (36.62%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 2475 KPNVDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2585          

HSP 28 Score: 69.3218 bits (168), Expect = 1.851e-12
Identity = 50/142 (35.21%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4627 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 4737          

HSP 29 Score: 68.9366 bits (167), Expect = 2.024e-12
Identity = 51/142 (35.92%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct:  692 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 802          

HSP 30 Score: 68.9366 bits (167), Expect = 2.024e-12
Identity = 51/142 (35.92%), Postives = 65/142 (45.77%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 1806 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 1916          

HSP 31 Score: 68.9366 bits (167), Expect = 2.254e-12
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H +D +  +WKLPKF  K KK KG                               D++VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct:  460 KPNIDVDINKPDIDIDLDVDGKK--KKHGLDINLPDWKLPKFEGKLKKPKG-------------------------------DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 568          

HSP 32 Score: 68.9366 bits (167), Expect = 2.254e-12
Identity = 64/172 (37.21%), Postives = 81/172 (47.09%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDL------------DINTPEIDFXXXXXXXXX------------------XXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPNV   +N+   D + D  G    K H    +  +WKLP F  K KK KG++D+            DIN P+ID D +    K                   K K  KG++D++VE P+  IDI GKK KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 2709 KPNVDVYINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 2878          

HSP 33 Score: 68.5514 bits (166), Expect = 3.112e-12
Identity = 53/142 (37.32%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +DID           +D KKK  GLDINLP
Sbjct: 1271 KPNVDVDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDIDNNKPDIDIDLDIDSKKKKHGLDINLP 1381          

HSP 34 Score: 68.5514 bits (166), Expect = 3.225e-12
Identity = 51/139 (36.69%), Postives = 72/139 (51.80%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKG------DIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE  ID  G   K       KK  +D+++  PD  ID+     K       DID H    ++++D+DGKKK  GLD NLP
Sbjct: 3517 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDAMARKRNMEPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 3653          

HSP 35 Score: 68.5514 bits (166), Expect = 3.284e-12
Identity = 51/131 (38.93%), Postives = 72/131 (54.96%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D D + KK+K        K D  ++ P   ID+  K    DID H    ++++D+DGKKK  GLD NLP
Sbjct: 3943 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKAKGDIVVNLKKPD--IDKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4069          

HSP 36 Score: 68.1662 bits (165), Expect = 3.928e-12
Identity = 55/159 (34.59%), Postives = 81/159 (50.94%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEV--PDASIDI-----------------------QGKKHKGDIDVHLSIPEVDIDVDGKKKNI----GLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D D +  ++K        K D+ +++  PD  I+I                       +GKK K ++D+ +  P +DID+DGKK  I    G+DINLP
Sbjct: 4329 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLPSMKGLKFEGKGKKPKSEVDLGVKTPSIDIDIDGKKHRISEKHGIDINLP 4485          

HSP 37 Score: 68.1662 bits (165), Expect = 4.614e-12
Identity = 51/141 (36.17%), Postives = 66/141 (46.81%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKK   G  INLP
Sbjct:  537 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKIKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNIDVDINKPDIDIDLDVDGKKIKHGFGINLP 646          

HSP 38 Score: 67.781 bits (164), Expect = 6.035e-12
Identity = 52/142 (36.62%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            KPNV  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P +D+D           +D KKK  GLDINLP
Sbjct: 1884 KPNVDIDINKPDIDIDLDADGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKAKGDIDVNLKKPNIDVDNNKPDIDIDLDIDSKKKKHGLDINLP 1994          

HSP 39 Score: 67.3958 bits (163), Expect = 7.683e-12
Identity = 51/142 (35.92%), Postives = 64/142 (45.07%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D       K H    +  NWKLP F  K KK  G++D+D+  PE+D                             IDI GKK KGD DV+L  P VD+D+           DGKKK  G  INLP
Sbjct: 1193 KPNI--DVDNNKPDIDIDLDVDGKKKKHGFGINLPNWKLPTFEGKVKKPNGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDADGKKKKHGFGINLP 1303          

HSP 40 Score: 66.6254 bits (161), Expect = 1.201e-11
Identity = 45/117 (38.46%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 4572 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 4659          

HSP 41 Score: 66.6254 bits (161), Expect = 1.201e-11
Identity = 45/117 (38.46%), Postives = 57/117 (48.72%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 5281 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5368          

HSP 42 Score: 66.2402 bits (160), Expect = 1.584e-11
Identity = 59/178 (33.15%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEI-----------DFXXXXXXXXXXXXXXXXXLDVNVEV-------------------------PDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H    +  +WKLP F  K KK KG++D+D+  PE+           DFD N KK        K  +D++++V                         P+  IDI  KK KGDIDV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 5336 KPNIDVDINKPDIDIDLDVDGKK--KKHGFGINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKRIDIDVEGPEVDIDIHWKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLP 5511          

HSP 43 Score: 65.4698 bits (158), Expect = 3.235e-11
Identity = 50/137 (36.50%), Postives = 79/137 (57.66%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKK------HKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  ++N+   D + D  G    K H +D +  +WKLPKF  K KK KG  DLD+  P+ID D + KK K +        +V+++     IDI+ K       +K D+++ ++ P++DI++DGKKK  G++I LP
Sbjct:  848 KPNIDVDINKPDIDIDLDVDGKK--KKHGLDINLPDWKLPKFEGKLKKPKG--DLDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIESKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 980          

HSP 44 Score: 65.0846 bits (157), Expect = 4.115e-11
Identity = 44/117 (37.61%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE+D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 2264 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDVDINKPDIDIDLDVDGKKKKHGFGINLP 2351          

HSP 45 Score: 64.6994 bits (156), Expect = 5.472e-11
Identity = 50/133 (37.59%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVD----------------LDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDID-----------VDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D                LDIN P+        K K    +      ++VE PD  +DI GKK KG+ID+++  P VDID           +DGKKK  GLD NLP
Sbjct: 4234 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEVQKYRQQEKKHGLDINLPDWKLPKFEGKLKKPKGA------LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 4360          

HSP 46 Score: 64.3142 bits (155), Expect = 6.656e-11
Identity = 46/117 (39.32%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D   PE+D                             IDI GKK KGD DV+L  P VDI           DVDGKKK  G  INLP
Sbjct:  327 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDFEGPEVD-----------------------------IDIHGKKPKGDFDVNLKKPNVDIDINKPDIDIDLDVDGKKKKHGFGINLP 414          

HSP 47 Score: 63.929 bits (154), Expect = 1.076e-10
Identity = 46/141 (32.62%), Postives = 70/141 (49.65%), Query Frame = 1
Query:  664 IKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            ++PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 3620 MEPNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3729          

HSP 48 Score: 63.5438 bits (153), Expect = 1.115e-10
Identity = 45/117 (38.46%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIP-----------EVDIDVDGKKKNIGLDINLP 1059
            KN  +D +  +WKLPKF  K KK KG++D+D+  PE D                             IDI GKK KGD DV+L  P           ++D+DVDGKKK  G  INLP
Sbjct: 1138 KNIGLDINLPDWKLPKFEGKIKKPKGEIDIDVEGPEFD-----------------------------IDIHGKKPKGDFDVNLKKPNIDVDNNKPDIDIDLDVDGKKKKHGFGINLP 1225          

HSP 49 Score: 63.5438 bits (153), Expect = 1.309e-10
Identity = 51/142 (35.92%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  +++ NK D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 1349 KPNI--DIDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 1457          

HSP 50 Score: 63.5438 bits (153), Expect = 1.368e-10
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 2924 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 3032          

HSP 51 Score: 63.5438 bits (153), Expect = 1.368e-10
Identity = 51/142 (35.92%), Postives = 66/142 (46.48%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDI-----------DVDGKKKNIGLDINLP 1059
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D                               VE PD  +DI GKK KG+ID+++  P VDI           D+DGKKK  GLD NLP
Sbjct: 4939 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALD-------------------------------VEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEVDIDGKKKKHGLDFNLP 5047          

HSP 52 Score: 63.1586 bits (152), Expect = 1.577e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 1426 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 1533          

HSP 53 Score: 63.1586 bits (152), Expect = 1.577e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 3001 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 3108          

HSP 54 Score: 63.1586 bits (152), Expect = 1.577e-10
Identity = 46/139 (33.09%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D                             +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 5016 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVD-----------------------------VDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 5123          

HSP 55 Score: 62.003 bits (149), Expect = 3.766e-10
Identity = 54/149 (36.24%), Postives = 82/149 (55.03%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXX---------XLDVNVEVPDASIDIQGKKHKGDIDV---------HLSIPEVDIDVDGKKKNIGLDINLP 1059
            KPN+  +V+ NK D + D    +  K H +D +  +WKLPKF  K KK KG   LD+  P+ID D + KK K +               K D+++E P+  +DI G + KG++DV          ++ P++DI++DGKKK  G++I LP
Sbjct: 1962 KPNI--DVDNNKPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGA--LDVEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDIDIEGPEVDVDIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDGKKKKHGINIGLP 2106          

HSP 56 Score: 57.7658 bits (138), Expect = 9.585e-9
Identity = 51/155 (32.90%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  667 KPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASI--DIQGKKHK-----------------------GDIDVHLSIPEVDIDVDGKKKNIGLDINL 1056
            KPN+  ++N  K D + D    +  K H +D +  +WKLPKF  K KK KG +D +    ++D  G   K +     K   +D++   PD  I  DI GKK+K                       G+ID+++  PEVDID+ GKK   G D+N 
Sbjct: 5713 KPNIDVDIN--KPDIDIDLDIDSKKKKHGLDINLPDWKLPKFEGKLKKPKGALDFEAPDIDVDIHGKKPKGEIDLNVKNPNVDIDFHKPDMDIEVDIDGKKNKHGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVDIDIHGKKPKGGFDVNF 5865          

HSP 57 Score: 56.6102 bits (135), Expect = 2.233e-8
Identity = 53/150 (35.33%), Postives = 67/150 (44.67%), Query Frame = 1
Query:  742 KNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPE--IDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI----QGKKH---------------------------KGDIDVHLSIPEVDIDV-----------DGKKKNIGLDINLP 1059
            K H +D +  +WKLP F  K KK KG++D+D+  PE  ID  G   K       KK  +DV++  PD  ID+    + KKH                           KGD DV+L  P VDID+           DGKKK  G  INLP
Sbjct: 3826 KKHGLDINLPDWKLPTFEGKVKKPKGEIDIDVEGPEVDIDIHGKKPKGDIDVNLKKPNIDVDINKPDIDIDLDVDGKKKKHGFGINLPDWKLPTFEGKKSTLTFMGKPKGDFDVNLKKPNVDIDINKPDIDIDLDADGKKKKHGFGINLP 3975          

HSP 58 Score: 54.6842 bits (130), Expect = 7.252e-8
Identity = 55/146 (37.67%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDI------------QGKKHKGDIDVHLSIP----EVDIDVDGKKKNIGLDINLP 1059
            PNV  + ++   D E D  G    K H +D +  +WKLPKF  K KK KG++D+DI  PE+D               KG +DV    PD  IDI             GKKH+   D+ +  P    ++DIDV  KKK  G+DINLP
Sbjct: 4038 PNVDIDFHKPDIDIEVDIDGKK--KKHGLDFNLPDWKLPKFEGKLKKPKGELDIDIRGPEVDV-------DIHGNRAKGNVDVTFNKPDLEIDITKPDMDIEIDDIDGKKHRISGDLSVDKPDADIDIDIDVSNKKKKHGIDINLP 4174          

HSP 59 Score: 52.7582 bits (125), Expect = 3.110e-7
Identity = 38/116 (32.76%), Postives = 51/116 (43.97%), Query Frame = 1
Query:  670 PNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFSNKSKKSKGQVDLDINTPEIDFXXXXXXXXXXXXXXXXXLDVNVEVPDASIDIQGKKHKGDIDVHLSIPEVDIDV 1017
            PNV  + ++   D E D  G      H +D +  +WKLPKF    KK KG++DL +  PE+D                             IDI GKK KG  DV+   P +DID+
Sbjct: 5790 PNVDIDFHKPDMDIEVDIDGKKNK--HGLDFNLPDWKLPKFEGIVKKPKGEIDLYVEGPEVD-----------------------------IDIHGKKPKGGFDVNFKKPNIDIDI 5874          
The following BLAST results are available for this feature:
BLAST of SMED30008609 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008609 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052306.12.468e-15695.27SMESG000052306.1[more]
SMESG000052306.12.469e-15695.27SMESG000052306.1[more]
SMESG000052306.12.881e-15695.27SMESG000052306.1[more]
SMESG000052306.12.937e-15695.27SMESG000052306.1[more]
SMESG000052306.13.266e-15695.27SMESG000052306.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008609 ID=SMED30008609|Name=SMED30008609|organism=Schmidtea mediterranea sexual|type=transcript|length=1061bp
TACAATATATCATTTTATTAACAACGAAGGTCCAACAAGTTTTTTATGTC
TCAAATAAACCTCGGTGAGGCACATTTTTCCGTAAAATCTGAAACTCCCA
GTATTAAAGTTGAATCCAAATTGAATGAAAAGCTCGCAATATCGAAAAGC
AAAGATTTTAAAATTGGGGAAATCGATGTTCATGGAGAGCTTCCTGTTTC
TGCAAATTTTTCAGAAAATATTTCGACTAAAGGTCAAATCAGTAAGAAAA
GAAGTAGTATGTCAAGTCATTCTAGCTCAAAGTCTAGTGAATCCAACAAA
GGATTGAGAAAGATTAAAGGAAAGTCACTGAAAAAAACGACTAAGAAAGG
ATTCAATTTAAACATTAAAAATAAATCAAAAATTAAAGATAGTGGTGAAA
GTGTCAGTTCAAATGATTCTGTCGGAATTTTTGGCTGCTCTAAACAGCGA
AAAAAGAAGTCTTATAGCCCAAGATCTGTTAATCAATCACAATCATCACA
AGGATATAAAGGAACTTTCACTAAGCTATCTTCACTTAAAAGACAAAAAC
AAGAGGATGTAAATACAGATAATAACGAAGTAAATTTATCTAAGGAAGCA
GAGCCAAATAAAAACATTACACATATAACAGACTTAACCATAACAGCTGG
TTTAGAATTTCAAATAAAACCAAATGTAGCAACCAATGTAAATGAGAATA
AACAAGACGCGGAATTTGATAATAAGGGAACTACTACAACAAAAAATCAT
AGAGTAGATAAACACTCACTAAATTGGAAGTTGCCAAAATTTAGTAATAA
AAGTAAGAAATCTAAAGGACAGGTTGATCTCGATATAAATACTCCTGAAA
TCGATTTCGATGGAAATGCCAAAAAATCTAAAGATAAAAATAAATCGAAA
AAGGGAAAACTAGATGTTAATGTTGAAGTACCAGATGCTAGCATCGATAT
TCAGGGAAAGAAGCATAAAGGAGACATTGATGTTCATTTGAGTATCCCAG
AAGTTGATATTGATGTCGACGGCAAGAAAAAGAACATTGGCTTAGACATT
AATTTACCAGA
back to top

protein sequence of SMED30008609-orf-1

>SMED30008609-orf-1 ID=SMED30008609-orf-1|Name=SMED30008609-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=338bp
MSQINLGEAHFSVKSETPSIKVESKLNEKLAISKSKDFKIGEIDVHGELP
VSANFSENISTKGQISKKRSSMSSHSSSKSSESNKGLRKIKGKSLKKTTK
KGFNLNIKNKSKIKDSGESVSSNDSVGIFGCSKQRKKKSYSPRSVNQSQS
SQGYKGTFTKLSSLKRQKQEDVNTDNNEVNLSKEAEPNKNITHITDLTIT
AGLEFQIKPNVATNVNENKQDAEFDNKGTTTTKNHRVDKHSLNWKLPKFS
NKSKKSKGQVDLDINTPEIDFDGNAKKSKDKNKSKKGKLDVNVEVPDASI
DIQGKKHKGDIDVHLSIPEVDIDVDGKKKNIGLDINLP
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000428musculature system
PLANA:0000463cholinergic neuron
PLANA:0000478pharynx musculature
PLANA:0002032epidermal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 141..163
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 133..187
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 270..286
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 266..286
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 56..87
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 56..119
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20