Calcium and integrin-binding family member 2

Overview
NameCalcium and integrin-binding family member 2
Smed IDSMED30008607
Length (bp)700
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium and integrin-binding family member 2 (SMED30008607) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium and integrin-binding family member 2 (SMED30008607) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium and integrin-binding family member 2 (SMED30008607) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium and integrin-binding family member 2 (SMED30008607) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008607

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30008607h1SMcG0000251 dd_Smed_v4_7205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Human
Match: CIB2 (calcium and integrin binding family member 2 [Source:HGNC Symbol;Acc:HGNC:24579])

HSP 1 Score: 118.242 bits (295), Expect = 1.220e-32
Identity = 71/193 (36.79%), Postives = 111/193 (57.51%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYK---PGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    +  + L D Y+  TF ++++I KL   F ++     P +Y    I    ++    I     +RENPFK+R+   FSE     + F + +DM SV  E+AP E+K +YAFK+Y+F+ DN++ K+DL   L R+     D E  ++    D +I+E+DLD DGK+ +A+FE +I K P+F+ TF I+I
Sbjct:    1 MGNKQTIFTEEQL-DNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMS---LIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVL--VCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI 187          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Human
Match: CIB1 (calcium and integrin binding 1 [Source:HGNC Symbol;Acc:HGNC:16920])

HSP 1 Score: 117.857 bits (294), Expect = 2.503e-32
Identity = 70/197 (35.53%), Postives = 122/197 (61.93%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEF--IANFKPIRENPFKDRLFRIFSEYNP-NGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC-NGDYESRIIQSA-----IDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            MG S  + L K+L+  Y+  TFL++QEI    + F ++      + R++  +      F  I +   ++ NPFK+R+ R+FS     + ++FE+ LD++SVFS+TA  ++K+HYAF++++FDDD  L+++D    L R+VNC  G+ E   + ++     ID I++ESD+D+DG I+ +EF+ +I + P+F  +F I
Sbjct:    1 MGGSG-SRLSKELLAEYQDLTFLTKQEILLAHRRFCELLP---QEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNRED----LSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKI 189          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Human
Match: CIB2 (calcium and integrin binding family member 2 [Source:HGNC Symbol;Acc:HGNC:24579])

HSP 1 Score: 110.923 bits (276), Expect = 3.208e-30
Identity = 56/132 (42.42%), Postives = 84/132 (63.64%), Query Frame = 3
Query:  291 FIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
             I     +RENPFK+R+   FSE     + F + +DM SV  E+AP E+K +YAFK+Y+F+ DN++ K+DL   L R+     D E  ++    D +I+E+DLD DGK+ +A+FE +I K P+F+ TF I+I
Sbjct:   15 LIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVL--VCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI 144          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Human
Match: CIB2 (calcium and integrin binding family member 2 [Source:HGNC Symbol;Acc:HGNC:24579])

HSP 1 Score: 108.612 bits (270), Expect = 1.755e-29
Identity = 54/124 (43.55%), Postives = 82/124 (66.13%), Query Frame = 3
Query:  315 RENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            +ENPFK+R+   FSE     + F + +DM SV  E+AP E+K +YAFK+Y+F+ DN++ K+DL   L R+     D E  ++    D +I+E+DLD DGK+ +A+FE +I K P+F+ TF I+I
Sbjct:   17 QENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVL--VCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI 138          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Human
Match: CIB4 (calcium and integrin binding family member 4 [Source:HGNC Symbol;Acc:HGNC:33703])

HSP 1 Score: 109.768 bits (273), Expect = 2.171e-29
Identity = 62/189 (32.80%), Postives = 110/189 (58.20%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIK 683
            MG      +  + ++ Y+  TFL+  EI  +   F  +  PG Y     ++A LT D+ +++   +R NPF+DR+ R+FS  +    +FE+ L M SVFSE A   +K  YAF++Y+F+++ ++ ++DL  ++ R++N + D    ++    + ++ ESDLD D  +S++EFE  + K P+FM +F I 
Sbjct:    1 MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKY----YKEATLTMDQ-VSSLPALRVNPFRDRICRVFS--HKGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLN-SDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIH 181          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Celegans
Match: calm-1 (CALMyrin (Calcium and Integrin Binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q93640])

HSP 1 Score: 102.064 bits (253), Expect = 1.107e-26
Identity = 65/190 (34.21%), Postives = 111/190 (58.42%), Query Frame = 3
Query:  126 SNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYK---PGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            S      ++ +D Y+  TF + ++I +L+K F  +     P N          LT +E +     ++ENPFK R+  +FSE     ++F++ LDM SVFSE AP+++K  YAF++Y++D D  L  DDL +M++ +     +     ++  I+ II+E+DLD D  I++AEFE ++ + P+F++TF I+I
Sbjct:   15 SKGGVFTREQLDEYQDCTFFTRKDIIRLYKRFYALNPHKVPTNMQGNRPAITTLTFEE-VEKMPELKENPFKRRICEVFSEDGRGNLSFDDFLDMFSVFSEMAPLQLKLKYAFRIYDYDGDELLGHDDLSKMIRSLT--RDELSDVEVEFIIERIIEEADLDGDSSINFAEFEHVVSRSPDFIRTFHIRI 201          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Celegans
Match: chpf-1 (Calcineurin-like EF-Hand Protein Family member [Source:UniProtKB/TrEMBL;Acc:Q23643])

HSP 1 Score: 58.9214 bits (141), Expect = 1.394e-10
Identity = 51/187 (27.27%), Postives = 90/187 (48.13%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLF-RIFSEYNPNGINFEETLDM---MSVFSETAPIEV-----------KTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEF 632
            MGNS+   L  + I+    +T  +  +I +L+  F  + K G          FL+ D+F+ N   +  NP  DR+    F+  + NG N E+ L+    + + +   PI             K  +AFK+Y+ + ++Y+++++   +L  +V  N    S  +    D  I+E+D D+DGKIS+ EF
Sbjct:    1 MGNSSSLMLRDEEIEEIMSETEFNRNQIVRLYSRFLSLDKKGQ--------GFLSRDDFL-NVPELAVNPLGDRIVDAFFTLASSNGDNEEQQLNFRQFVRILAHFQPISRVKKNALNSRKDKLLFAFKMYDLNKNDYITREEFKVILNSMVGAN--ITSDQLDKIADRTIEEADADRDGKISFDEF 176          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Celegans
Match: ncs-1 (Neuronal calcium sensor 1 [Source:UniProtKB/Swiss-Prot;Acc:P36608])

HSP 1 Score: 56.225 bits (134), Expect = 1.395e-9
Identity = 44/182 (24.18%), Postives = 86/182 (47.25%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPI--RENP--FKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDY-----ESRIIQSAIDGIIKESDLDKDGKISYAEFE 635
            MG  N       + D+ E+ T+ +E+EI++ +K F           R+  +  LT   F   +K    + +P  F   +F++F E     I F E +  +S+ S    ++ K H+AFKLY+ D D +++++++L ++  +    G       E    +  +D I +  D + D +++  EF+
Sbjct:    1 MGKGNSKLKSSQIRDLAEQ-TYFTEKEIKQWYKGF----------VRDCPNGMLTEAGFQKIYKQFFPQGDPSDFASFVFKVFDENKDGAIEFHEFIRALSITSR-GNLDEKLHWAFKLYDLDQDGFITRNEMLSIVDSIYKMVGSSVQLPEEENTPEKRVDRIFRMMDKNNDAQLTLEEFK 170          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Celegans
Match: chpf-2 (Calcineurin-like EF-Hand Protein Family member [Source:UniProtKB/TrEMBL;Acc:O16343])

HSP 1 Score: 55.0694 bits (131), Expect = 3.935e-9
Identity = 44/187 (23.53%), Postives = 88/187 (47.06%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIF-------SEYNPNGINFEETLDMMSVFSETAPIEV--------KTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEF 632
            MGNSN + L    +     +T  ++ +I +L+  F  + K G          +L+ D+F+ N   +  NP  DR+   F        +     + F + + +++ F   + ++         K  +AFK+Y+ + +NY+++++   +L  +V  N    S  +    D  ++E+D D+DGKIS+ +F
Sbjct:    1 MGNSNSSILSDAEMREIMDETQFNKHQILRLYTRFASLDKNGQ--------GYLSRDDFL-NVPELAVNPLGDRIIDAFFTLGDSDGDSKSGQLTFRQFVRILAHFQPISKVKDNALNSRKDKLRFAFKMYDLNKNNYITREEFKVILNSMVGAN--ITSDQLDKIADKTLEEADQDRDGKISFEDF 176          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Celegans
Match: cmd-1 (Calmodulin [Source:UniProtKB/Swiss-Prot;Acc:O16305])

HSP 1 Score: 48.521 bits (114), Expect = 3.340e-7
Identity = 38/157 (24.20%), Postives = 79/157 (50.32%), Query Frame = 3
Query:  183 LSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNG---INFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLI 644
            L+E++I +  + F    K G        D  +T  E     + + +NP +  L  + +E + +G   I+F E L MM+   +    E +   AF++++ D + ++S  +L    + V+   G+   ++    +D +I+E+D+D DG+++Y EF  ++
Sbjct:    5 LTEEQIAEFKEAFSLFDKDG--------DGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAEL----RHVMTNLGE---KLTDEEVDEMIREADIDGDGQVNYEEFVTMM 146          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Fly
Match: Cib2 (gene:FBgn0034558 transcript:FBtr0304717)

HSP 1 Score: 115.546 bits (288), Expect = 7.026e-32
Identity = 69/193 (35.75%), Postives = 105/193 (54.40%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYK---PGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    +  ++L D Y+  TF + +EI ++ K FR++     P            + C E I     +RENPF+ R+   FS      ++FE+ LD +SVFSE AP ++K  YAFK+Y+FD D ++   DL+  L  +       E    Q   D +I+E+D+D DGK+S  EFE +I + P+F+ TF I+I
Sbjct:    1 MGNKVVTFTEQELDD-YQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPC-ECIEKMPELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLMSCLTTMTKNELSPEEH--QQIADKVIEEADVDGDGKLSILEFEHVILRAPDFLSTFHIRI 189          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Fly
Match: CanB (gene:FBgn0010014 transcript:FBtr0070764)

HSP 1 Score: 70.4774 bits (171), Expect = 6.548e-15
Identity = 52/174 (29.89%), Postives = 88/174 (50.57%), Query Frame = 3
Query:  126 SNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIG 647
             N   LP D+   ++        EI++L K FR +      D  N     L+ DEF++    +++NP   R+  IF       ++F+E +  +S FS       K  +AF++Y+ D+D Y+S  +L ++LK +V  N   +   +Q  +D  I  +D D+DGKIS+ EF  ++G
Sbjct:    2 GNETSLPMDMCSNFDA------DEIRRLGKRFRKL------DLDN--SGALSIDEFMS-LPELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNN--LKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVG 158          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Fly
Match: CanB (gene:FBgn0010014 transcript:FBtr0308348)

HSP 1 Score: 70.4774 bits (171), Expect = 6.548e-15
Identity = 52/174 (29.89%), Postives = 88/174 (50.57%), Query Frame = 3
Query:  126 SNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIG 647
             N   LP D+   ++        EI++L K FR +      D  N     L+ DEF++    +++NP   R+  IF       ++F+E +  +S FS       K  +AF++Y+ D+D Y+S  +L ++LK +V  N   +   +Q  +D  I  +D D+DGKIS+ EF  ++G
Sbjct:    2 GNETSLPMDMCSNFDA------DEIRRLGKRFRKL------DLDN--SGALSIDEFMS-LPELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNN--LKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVG 158          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Fly
Match: CanB2 (gene:FBgn0015614 transcript:FBtr0309866)

HSP 1 Score: 70.0922 bits (170), Expect = 1.030e-14
Identity = 51/174 (29.31%), Postives = 88/174 (50.57%), Query Frame = 3
Query:  126 SNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIG 647
             N   LP ++   ++        EI++L K FR +      D  N     L+ DEF++    +++NP   R+  IF       ++F+E +  +S FS       K  +AF++Y+ D+D Y+S  +L ++LK +V  N   +   +Q  +D  I  +D D+DGKIS+ EF  ++G
Sbjct:    2 GNETSLPMEMCSNFDA------DEIRRLGKRFRKL------DLDN--SGALSVDEFMS-LPELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNN--LKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVG 158          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Fly
Match: CanB2 (gene:FBgn0015614 transcript:FBtr0088930)

HSP 1 Score: 70.0922 bits (170), Expect = 1.030e-14
Identity = 51/174 (29.31%), Postives = 88/174 (50.57%), Query Frame = 3
Query:  126 SNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIG 647
             N   LP ++   ++        EI++L K FR +      D  N     L+ DEF++    +++NP   R+  IF       ++F+E +  +S FS       K  +AF++Y+ D+D Y+S  +L ++LK +V  N   +   +Q  +D  I  +D D+DGKIS+ EF  ++G
Sbjct:    2 GNETSLPMEMCSNFDA------DEIRRLGKRFRKL------DLDN--SGALSVDEFMS-LPELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNN--LKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVG 158          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Zebrafish
Match: cib1 (calcium and integrin binding 1 (calmyrin) [Source:ZFIN;Acc:ZDB-GENE-050417-170])

HSP 1 Score: 114.39 bits (285), Expect = 3.284e-31
Identity = 69/198 (34.85%), Postives = 121/198 (61.11%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIY--KPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFS--EYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC-NGDY-ESRI----IQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            MG +  + LPK+L+  Y++ TFL++QEI    K F ++   + G Y  R   +  LT  E       ++ NPF+ R+  +FS  +     + FE+ LD++S FS++A +E+K+HYAF++++FDDD  L   D    L+++VNC  G+  ++R+    ++  I  I++ESD+DKDG ++ +EF+ +I + P+F+ +F I
Sbjct:    1 MGGTA-SKLPKELLSEYQELTFLTKQEILLAHKRFSELQGRENGPYSSRVSMEKILTLPE-------LKSNPFRKRICHVFSTSDLRDGSLTFEDFLDLLSAFSDSATLEIKSHYAFRIFDFDDDGTLDGRD----LEKLVNCLTGETDDTRLTAEEMRQLISNILEESDIDKDGTVNLSEFQHVISRSPDFVSSFKI 186          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Zebrafish
Match: cib2 (calcium and integrin binding family member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1663])

HSP 1 Score: 108.997 bits (271), Expect = 2.914e-29
Identity = 67/191 (35.08%), Postives = 108/191 (56.54%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKP-GNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    +  + L D Y+  TF + +EI +L   + ++       DY N  D  +     I N   ++ENPF++R+   FSE     ++F + +DM SV SE AP E+K  YAFK+Y+F+ DNY+ K+DL + L ++     +     +    +  I+E+DLD D K+S+A+FE +I + P+F+ TF I+I
Sbjct:    1 MGNKQTIFTDEQL-DAYQDCTFFTRKEILRLHGRYHELAPHLVPMDYTNDPDVKVPL-ALIVNMPELKENPFRNRIVESFSEDGQGNLSFNDFVDMFSVLSEMAPRELKAIYAFKIYDFNVDNYICKEDLEKTLNKLT--KEELTPEEVNLVCEKAIEEADLDGDNKLSFADFENMISRAPDFLSTFHIRI 187          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Zebrafish
Match: cib3 (calcium and integrin binding family member 3 [Source:ZFIN;Acc:ZDB-GENE-121121-1])

HSP 1 Score: 99.7525 bits (247), Expect = 1.102e-25
Identity = 56/170 (32.94%), Postives = 103/170 (60.59%), Query Frame = 3
Query:  177 TFLSEQEIQKLFKNFRDIY-KPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIK 683
            T+ + +EI +LF  +RD+  +    DY N  D  L   E I +   +++NPF+ R+  +FSE     +  ++ LDM SV SE AP ++K +YAFK+Y+F++D+++ K DL + L ++     +     ++   + +I E+DLD DG++S  +F+ +I + P+F++ +V+K
Sbjct:    9 TYFTRKEILRLFHRYRDLAPQLVPLDYTNEPDVRLPY-ELIGSMPELKDNPFRQRIAEVFSEDGQGNMTLDDFLDMFSVMSEMAPRDLKAYYAFKIYDFNNDDFICKSDLEKTLNKLT--RNELTEDEVRMVCEKVIDEADLDNDGRLSLEDFQHMILRAPDFLR-YVLK 174          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Zebrafish
Match: cib1 (calcium and integrin binding 1 (calmyrin) [Source:ZFIN;Acc:ZDB-GENE-050417-170])

HSP 1 Score: 92.4337 bits (228), Expect = 3.225e-23
Identity = 48/135 (35.56%), Postives = 88/135 (65.19%), Query Frame = 3
Query:  288 EFIANFKPIRENPFKDRLFRIFS--EYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC-NGDY-ESRI----IQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMK 668
            E I     ++ NPF+ R+  +FS  +     + FE+ LD++S FS++A +E+K+HYAF++++FDDD  L   D    L+++VNC  G+  ++R+    ++  I  I++ESD+DKDG ++ +EF+ +I + P+F++
Sbjct:   24 EKILTLPELKSNPFRKRICHVFSTSDLRDGSLTFEDFLDLLSAFSDSATLEIKSHYAFRIFDFDDDGTLDGRD----LEKLVNCLTGETDDTRLTAEEMRQLISNILEESDIDKDGTVNLSEFQHVISRSPDFVR 154          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Zebrafish
Match: ppp3r1a (protein phosphatase 3, regulatory subunit B, alpha a [Source:ZFIN;Acc:ZDB-GENE-081113-3])

HSP 1 Score: 70.8626 bits (172), Expect = 6.252e-15
Identity = 48/161 (29.81%), Postives = 85/161 (52.80%), Query Frame = 3
Query:  195 EIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFV 677
            EI++L K F+ +      D  N     L+ +EF++    +++NP   R+  IF       ++F+E ++ +S FS     E+K  +AF++Y+ D D Y+S  +L ++LK +V  N   +   +Q  +D  I  +D D DG+IS+ EF  ++G +    K  V
Sbjct:   19 EIKRLGKRFKKL------DLDN--SGSLSVEEFMS-LPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEMKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNN--LKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVV 168          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Xenopus
Match: cib1 (calcium and integrin binding 1 [Source:NCBI gene;Acc:496971])

HSP 1 Score: 123.635 bits (309), Expect = 1.010e-34
Identity = 70/194 (36.08%), Postives = 124/194 (63.92%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFS--EYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYE--SRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGNS+ ++L K LI+ Y++ T+L++QEI   +K F ++ +  N    NI    +  + F+ N   ++ NPF DR+  +FS  E     ++FE+ LDM+S FSE+A +EVK+HYAF++++FD D  L++ DL  ++ ++     D +  +  ++  I  I++ESD+DKDG I+++EF+ +I + P+F+ +F I +
Sbjct:    1 MGNSS-SHLSKQLINEYQELTYLTKQEIILAYKRFSEVAQKDNRS--NIESLRIPKERFL-NLPELKANPFNDRICTVFSTSEQEDGSMSFEDFLDMLSAFSESATLEVKSHYAFRIFDFDGDGALNESDLEHLVNKLTGDKDDTKLSNSEMRQLIANILEESDIDKDGTINHSEFQHVISRSPDFISSFKIML 190          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Xenopus
Match: cib2 (calcium and integrin binding family member 2 [Source:NCBI gene;Acc:780271])

HSP 1 Score: 110.923 bits (276), Expect = 8.186e-30
Identity = 70/192 (36.46%), Postives = 112/192 (58.33%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPG--NYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    +  + L D Y+  TF + +EI +L   F ++  P     DY +  D  L   + I N   + ENPFK+R+ + FSE     ++F + +DM SV SE AP E+K  YAFK+Y+F+ DN++ K DL + L ++     + E   +    + +I+E+D+D DGK+++A+FE +I K P+F+ TF I+I
Sbjct:    1 MGNKQTIFTDEQL-DAYQDCTFFTRKEILRLHGRFYEL-APNIVPMDYTDDPDVKLPM-QLIINMPELVENPFKERIVQSFSEDGEGNLSFNDFVDMFSVMSEMAPRELKAIYAFKIYDFNTDNFICKSDLEKTLNKLT--REELEEEEVNLVCEKVIEEADMDGDGKLAFADFENMISKAPDFLSTFHIRI 187          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Xenopus
Match: fads2 (fatty acid desaturase 2 [Source:Xenbase;Acc:XB-GENE-1010230])

HSP 1 Score: 104.375 bits (259), Expect = 5.058e-27
Identity = 62/188 (32.98%), Postives = 106/188 (56.38%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYK---PGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKT 671
            MGN    +  + L D Y+  TF + +EI +LF  +RD+     P   DY N  D  +   E I +   +++NPF+ R+  +FSE     +  ++ LDM SV SE AP ++K  YAFK+Y+F++D+Y+ K DL + L ++     +     +    + +I E+D+D DGK+S  +F+ +I + P+F++ 
Sbjct:    1 MGNKQTIFTAEQL-DTYQDCTFFTRKEILRLFNRYRDLAPQLVPD--DYTNKPDVKIPY-ELIGSMPELKDNPFRQRIAEVFSEDGDGNMTLDDFLDMFSVLSEMAPKDLKAFYAFKIYDFNNDDYICKSDLEKTLNKLT--RNELTPEEVCLVCEKVIDEADVDNDGKLSLEDFQHMIVRAPDFLRV 182          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Xenopus
Match: cib2 (calcium and integrin binding family member 2 [Source:NCBI gene;Acc:780271])

HSP 1 Score: 95.9005 bits (237), Expect = 4.717e-24
Identity = 49/127 (38.58%), Postives = 82/127 (64.57%), Query Frame = 3
Query:  288 EFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMK 668
            + I N   + ENPFK+R+ + FSE     ++F + +DM SV SE AP E+K  YAFK+Y+F+ DN++ K DL + L ++     + E   +    + +I+E+D+D DGK+++A+FE +I K P+F++
Sbjct:   55 QLIINMPELVENPFKERIVQSFSEDGEGNLSFNDFVDMFSVMSEMAPRELKAIYAFKIYDFNTDNFICKSDLEKTLNKLT--REELEEEEVNLVCEKVIEEADMDGDGKLAFADFENMISKAPDFLR 179          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Xenopus
Match: cib1 (calcium and integrin binding 1 [Source:NCBI gene;Acc:496971])

HSP 1 Score: 92.8189 bits (229), Expect = 5.909e-23
Identity = 52/139 (37.41%), Postives = 89/139 (64.03%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFS--EYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVV 527
            MGNS+ ++L K LI+ Y++ T+L++QEI   +K F ++ +  N    NI    +  + F+ N   ++ NPF DR+  +FS  E     ++FE+ LDM+S FSE+A +EVK+HYAF++++FD D  L++ DL  ++ ++ 
Sbjct:    1 MGNSS-SHLSKQLINEYQELTYLTKQEIILAYKRFSEVAQKDNRS--NIESLRIPKERFL-NLPELKANPFNDRICTVFSTSEQEDGSMSFEDFLDMLSAFSESATLEVKSHYAFRIFDFDGDGALNESDLEHLVNKLT 135          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Mouse
Match: Cib1 (calcium and integrin binding 1 (calmyrin) [Source:MGI Symbol;Acc:MGI:1344418])

HSP 1 Score: 118.627 bits (296), Expect = 6.908e-33
Identity = 70/197 (35.53%), Postives = 122/197 (61.93%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEF--IANFKPIRENPFKDRLFRIFSEY-NPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC-NGDYESRIIQSA-----IDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            MG S  + L K+L+  Y+  TFL++QEI    + F ++  P   + R + ++  T   F  I +   ++ NPFK+R+  +FS     + ++FE+ LD++SVFS+TA  ++K+HYAF++++FDDD  L ++D    L ++VNC  G+ E   + ++     ID I++ESD+D+DG I+ +EF+ +I + P+F  +F I
Sbjct:    1 MGGSG-SRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPP---EQRTVEESLHTRVSFEQILSLPELKANPFKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDRED----LSQLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKI 189          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Mouse
Match: Cib2 (calcium and integrin binding family member 2 [Source:MGI Symbol;Acc:MGI:1929293])

HSP 1 Score: 116.316 bits (290), Expect = 6.285e-32
Identity = 69/193 (35.75%), Postives = 110/193 (56.99%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYK---PGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN       ++ +D Y+  TF ++++I KL   F ++     P +Y    I    ++    I     +RENPFK+R+   FSE     + F + +DM SV  E+AP E+K +YAFK+Y+F+ DN++ K+DL   L R+     + E   +    D +I+E+DLD DGK+ +A+FE +I K P+F+ TF I+I
Sbjct:    1 MGNK-QTIFTEEQLDNYQDCTFFNKKDILKLHARFYELAPNLVPMDYRKSPIVHVPMS---LIIQMPELRENPFKERIVEAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLEMTLARLT--KSELEEDEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI 187          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Mouse
Match: Cib1 (calcium and integrin binding 1 (calmyrin) [Source:MGI Symbol;Acc:MGI:1344418])

HSP 1 Score: 108.997 bits (271), Expect = 3.558e-29
Identity = 68/196 (34.69%), Postives = 119/196 (60.71%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENP-FKDRLFRIFSEY-NPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC-NGDYESRIIQSA-----IDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            MG S  + L K+L+  Y+  TFL++QEI    + F ++  P   + R + ++  T      +F+ I   P  K+R+  +FS     + ++FE+ LD++SVFS+TA  ++K+HYAF++++FDDD  L ++D    L ++VNC  G+ E   + ++     ID I++ESD+D+DG I+ +EF+ +I + P+F  +F I
Sbjct:    1 MGGSG-SRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPP---EQRTVEESLHT----RVSFEQILSLPELKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDRED----LSQLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKI 184          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Mouse
Match: Cib4 (calcium and integrin binding family member 4 [Source:MGI Symbol;Acc:MGI:1920509])

HSP 1 Score: 107.457 bits (267), Expect = 1.134e-28
Identity = 61/189 (32.28%), Postives = 111/189 (58.73%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIK 683
            MG      +  + ++ Y+  TFL+  EI  +   F  +   G    ++ ++A LT D+ +++   +R NPF+DR+ R+FS  + N  +FE+ L M SVFSE A   +K  YAF++Y+F+++ ++ ++DL E++ R++  + D    ++   +  ++ ESDLD D  +S++EFE  + K P+FM +F I 
Sbjct:    1 MGQCLRYQMQWEDLEEYQALTFLTRNEILCIHDTFLKLCPSG----KHYKEATLTMDQ-VSSLPALRVNPFRDRICRVFS--HDNVFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLEEIVLRLLK-SDDASEDLLMDVMHHVLSESDLDNDSMLSFSEFEHAMAKSPDFMNSFRIH 181          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Mouse
Match: Cib3 (calcium and integrin binding family member 3 [Source:MGI Symbol;Acc:MGI:2685953])

HSP 1 Score: 105.531 bits (262), Expect = 9.152e-28
Identity = 59/194 (30.41%), Postives = 111/194 (57.22%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYK---PGNYDYR-NIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN        + ++ Y+  TF + +EI +LF  ++D+     P +Y     ++  +    E I +   +++NPF+ R+ ++FS+     +  E  LDM SV SE AP ++K +YAFK+Y+F++DNY+   DL + + R+    G+  +  +    + ++ E+D D+DG++S  +F+ +I + P+F+ TF I+I
Sbjct:    1 MGN-KQTVFSHEQLEEYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTSPKVKVPY----ELIGSMPELKDNPFRQRIAQVFSQDGDGHMTLENFLDMFSVMSEMAPRDLKAYYAFKIYDFNNDNYICAWDLEQTVTRLT--RGELSAEEVTLVCEKVLDEADGDQDGRLSLEDFQNMILRAPDFLSTFHIRI 187          
BLAST of Calcium and integrin-binding family member 2 vs. UniProt/SwissProt
Match: sp|Q9R010|CIB1_RAT (Calcium and integrin-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Cib1 PE=1 SV=3)

HSP 1 Score: 122.094 bits (305), Expect = 2.813e-33
Identity = 71/197 (36.04%), Postives = 123/197 (62.44%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEF--IANFKPIRENPFKDRLFRIFSEY-NPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC-NGDYESRIIQSA-----IDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            MG S  + L K+L+  Y+  TFL++QEI    + F ++  P   ++R + ++  T   F  I +   ++ NPFK+R+  +FS     + ++FE+ LD++SVFS+TA  ++K+HYAF++++FDDD  L ++D    L R+VNC  G+ E   + ++     ID I++ESD+D+DG I+ +EF+ +I + P+F  +F I
Sbjct:    1 MGGSG-SRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPP---EHRTVEESLHTRVSFEQILSLPELKANPFKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDRED----LSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKI 189          
BLAST of Calcium and integrin-binding family member 2 vs. UniProt/SwissProt
Match: sp|Q9Z0F4|CIB1_MOUSE (Calcium and integrin-binding protein 1 OS=Mus musculus OX=10090 GN=Cib1 PE=1 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 4.832e-32
Identity = 70/197 (35.53%), Postives = 122/197 (61.93%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEF--IANFKPIRENPFKDRLFRIFSEY-NPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC-NGDYESRIIQSA-----IDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            MG S  + L K+L+  Y+  TFL++QEI    + F ++  P   + R + ++  T   F  I +   ++ NPFK+R+  +FS     + ++FE+ LD++SVFS+TA  ++K+HYAF++++FDDD  L ++D    L ++VNC  G+ E   + ++     ID I++ESD+D+DG I+ +EF+ +I + P+F  +F I
Sbjct:    1 MGGSG-SRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPP---EQRTVEESLHTRVSFEQILSLPELKANPFKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDRED----LSQLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKI 189          
BLAST of Calcium and integrin-binding family member 2 vs. UniProt/SwissProt
Match: sp|O75838|CIB2_HUMAN (Calcium and integrin-binding family member 2 OS=Homo sapiens OX=9606 GN=CIB2 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 5.857e-32
Identity = 71/193 (36.79%), Postives = 111/193 (57.51%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYK---PGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    +  + L D Y+  TF ++++I KL   F ++     P +Y    I    ++    I     +RENPFK+R+   FSE     + F + +DM SV  E+AP E+K +YAFK+Y+F+ DN++ K+DL   L R+     D E  ++    D +I+E+DLD DGK+ +A+FE +I K P+F+ TF I+I
Sbjct:    1 MGNKQTIFTEEQL-DNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMS---LIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVL--VCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI 187          
BLAST of Calcium and integrin-binding family member 2 vs. UniProt/SwissProt
Match: sp|Q99828|CIB1_HUMAN (Calcium and integrin-binding protein 1 OS=Homo sapiens OX=9606 GN=CIB1 PE=1 SV=4)

HSP 1 Score: 117.857 bits (294), Expect = 1.202e-31
Identity = 70/197 (35.53%), Postives = 122/197 (61.93%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEF--IANFKPIRENPFKDRLFRIFSEYNP-NGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC-NGDYESRIIQSA-----IDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            MG S  + L K+L+  Y+  TFL++QEI    + F ++      + R++  +      F  I +   ++ NPFK+R+ R+FS     + ++FE+ LD++SVFS+TA  ++K+HYAF++++FDDD  L+++D    L R+VNC  G+ E   + ++     ID I++ESD+D+DG I+ +EF+ +I + P+F  +F I
Sbjct:    1 MGGSG-SRLSKELLAEYQDLTFLTKQEILLAHRRFCELLP---QEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNRED----LSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKI 189          
BLAST of Calcium and integrin-binding family member 2 vs. UniProt/SwissProt
Match: sp|B1A8Z2|CIB1_SHEEP (Calcium and integrin-binding protein 1 OS=Ovis aries OX=9940 GN=CIB1 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.505e-31
Identity = 67/195 (34.36%), Postives = 123/195 (63.08%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEY-NPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC-NGDYESRIIQSA-----IDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            MG S  + L K+L+  Y+  TFL++QEI    + F ++    +        A ++ ++ I +   ++ NPFK+R+ ++FS   + + ++FE+ LD++SVFS+TA  ++K+HYAF++++FDDD  L+++D    L ++VNC  G+ E   + ++     ID I++ESD+D+DG I+ +EF+ +I + P+F  +F I
Sbjct:    1 MGGSG-SRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEHRSVEESLQARVSLEQ-ILSLPELKANPFKERICKVFSTSPSRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNRED----LSQLVNCLTGESEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKI 189          
BLAST of Calcium and integrin-binding family member 2 vs. TrEMBL
Match: A0A4Y2GCQ9 (Calcium and integrin-binding family member 2 OS=Araneus ventricosus OX=182803 GN=CIB2 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.019e-34
Identity = 77/180 (42.78%), Postives = 113/180 (62.78%), Query Frame = 3
Query:  147 KDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            ++L+D+ +K T+LS ++I KL+K F   Y P   D +N     +    ++     +  NPF DR+ ++F     + I+FE+ LDMMSVF E API+VKT YAF++Y+FDDD+ LS++D+LE+L R + CN +         ID +  E+DLD DG ISY EFE LI K P+FM  F ++I
Sbjct:   24 QELMDL-QKLTYLSRKQILKLYKEFTS-YNPDMQDPKNP----ILPQSYLLLMPELAVNPFLDRIIKVFCS-QMHHISFEDFLDMMSVFCEEAPIDVKTSYAFRIYDFDDDDMLSREDVLELLNR-LKCNNELSDEDCADIIDSVFLEADLDTDGYISYPEFEQLITKSPDFMHAFRMRI 195          
BLAST of Calcium and integrin-binding family member 2 vs. TrEMBL
Match: A0A1S3J9H7 (calcium and integrin-binding family member 3 OS=Lingula unguis OX=7574 GN=LOC106170989 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 4.331e-34
Identity = 72/198 (36.36%), Postives = 116/198 (58.59%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPG------NYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC--NGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    +  + L+  Y+  +F + +EI ++F  FR++Y  G      + +   IR  F    E +   + +RENPF+ R+  +FSE     + F++ LDM SVFSE AP ++K+ YAF++Y+FD DN+L K D    L+R + C    +  S  +    + +++E+DLD DGK+SY EFE +I + P+F+ TF I+I
Sbjct:    1 MGNKQTTFTDEQLV-AYQDCSFFTRKEILRIFHRFRELYSEGVPKDMTHNEAHTIRVPF----EEVEKMQELRENPFRRRICEVFSEDGRGNMTFDDFLDMFSVFSEAAPRDLKSVYAFRIYDFDGDNFLGKHD----LERTLGCLTRNELTSEEVDLVCEKVMEEADLDDDGKLSYVEFEHVISRAPDFLGTFHIRI 189          
BLAST of Calcium and integrin-binding family member 2 vs. TrEMBL
Match: A0A2C9JUE4 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106068697 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.047e-33
Identity = 74/197 (37.56%), Postives = 118/197 (59.90%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDI-------YKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    + P+ L + Y+  T+ ++Q+I ++FK F++I        K  N  Y   +   L  D+ + N   +RENPF+ R+  +FS+ N   + F++ L+M SVFSE AP E+K  YAFK+Y+FD DN+L + DL   LK +   +   E   ++  +D +++E+DLD DG +SY EFE +I + P+F+ TF I+I
Sbjct:    1 MGNQESIFSPQQL-EAYQDCTYFTKQDIIRIFKRFKEIDPSRIQQSKMSNLHY--CQSETLPADK-LENIPELRENPFRRRILEVFSQDNTGDLAFDDFLNMFSVFSEDAPREIKAVYAFKIYDFDGDNFLGRSDLETTLKALTQNSLKTEE--VKFVLDQVLEETDLDSDGMLSYIEFEHVISRAPDFLTTFHIRI 191          
BLAST of Calcium and integrin-binding family member 2 vs. TrEMBL
Match: A0A210Q6W0 (Calcium and integrin-binding protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15079 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 4.895e-33
Identity = 74/193 (38.34%), Postives = 121/193 (62.69%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDY-RNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYE--SRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MG S   +  ++L D Y++ T+ +++EI  +FK FRD+  P + D  RN++      ++ + +   ++ NPFKDR+ R+FS      + FE+ LDMMSVFSE AP E+K  YAFK+Y+FD D+ +S+DDL +M+ R+     D E   + +   +  I+KE+DLD D ++S++EF+ +I K P F  +F I++
Sbjct:    1 MGASQSVFSEEELQD-YQELTYFTKKEILHVFKIFRDL-SPRDVDRDRNVK----LNEDLVMSLPELKMNPFKDRIVRVFSS-EEGCLTFEDFLDMMSVFSEKAPKEIKAQYAFKIYDFDGDDEISRDDLKKMVLRLCPSQKDTELKKQEVDRLVGEILKEADLDNDDRLSFSEFQHVISKAPEFESSFRIRL 186          
BLAST of Calcium and integrin-binding family member 2 vs. TrEMBL
Match: G3MLE7 (Uncharacterized protein OS=Amblyomma maculatum OX=34609 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 5.790e-33
Identity = 70/192 (36.46%), Postives = 111/192 (57.81%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGD--YESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MG        ++L D Y + TFL+++EI   FK FR I     +  +  R        FI      R NPF+DRL R+FS    + ++FE+ LD++SV SE API+VK  YAF++Y+ DDD  L +DDL EM++R+ + +     E+  +Q  I+ ++ E+DLD+ G +S  EF+  + K P+F  +F +++
Sbjct:    1 MGAGQSQLTAEELRD-YRELTFLTKKEILHAFKRFRAIAAEEVHADKQARIPV----SFIEQMPEFRCNPFRDRLLRVFSSCKDDRMSFEDFLDLLSVLSEEAPIDVKAEYAFQIYDMDDDGVLGEDDLEEMIRRLTSWDSGCRLETPDVQRIIEQVLAEADLDRSGHMSLMEFQHCMLKNPDFASSFSLRL 187          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Cavefish
Match: cib1 (calcium and integrin binding 1 [Source:NCBI gene;Acc:103024758])

HSP 1 Score: 116.316 bits (290), Expect = 3.878e-32
Identity = 70/200 (35.00%), Postives = 121/200 (60.50%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGN----YDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFS--EYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC-NGDYE-----SRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            MG +  + LPKDL+  Y++ TFL++QEI    K F ++   G+    ++ R      LT  E       ++ NPF+ R+  +FS  +     ++FE+ LD++S FS++A +E+K+HYAF++++FDDD  L   D    L+++VNC  G+ E     S  ++  I+ I++ESD+DKDG ++ +EF+ +I + P+F+ +F I
Sbjct:    1 MGTA-ASKLPKDLLSEYQELTFLTKQEILLAHKRFTELLDRGDRQQAFNSRVPMTKVLTLPE-------LKSNPFRKRICNVFSTSDVKDGSLSFEDFLDLLSAFSDSATLEIKSHYAFRIFDFDDDGTLDSGD----LEKLVNCLTGETEDTRLTSEEMKQLINNILEESDIDKDGTVNLSEFQHVISRSPDFVSSFKI 188          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Cavefish
Match: cib3 (calcium and integrin binding family member 3 [Source:NCBI gene;Acc:111194533])

HSP 1 Score: 112.849 bits (281), Expect = 1.089e-30
Identity = 63/191 (32.98%), Postives = 112/191 (58.64%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIY-KPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    +  + L D Y+  T+ + +EI +LF  +RD+  +    DY N  D  L   E I +   +++NPF+ R+  +FSE     +  ++ LDM SV SE AP ++K +YAFK+Y+F++D+++ K DL + L ++     +     ++   + ++ E+DLD DG++S  +F+ +I + P+F+ TF I+I
Sbjct:    1 MGNKQTIFTAQQL-DAYQDCTYFTRKEILRLFHRYRDLAPQLVPLDYTNQPDVRLPY-ELIGSMPELKDNPFRQRIAEVFSEDGEGNMTLDDFLDMFSVLSEMAPRDLKAYYAFKIYDFNNDDFICKSDLEKTLNKLT--RNELTEDEVRMVCEKVMDEADLDNDGRLSLEDFQHMIVRAPDFLSTFHIRI 187          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Cavefish
Match: cib2 (calcium and integrin binding family member 2 [Source:NCBI gene;Acc:103027299])

HSP 1 Score: 109.383 bits (272), Expect = 1.793e-29
Identity = 68/191 (35.60%), Postives = 108/191 (56.54%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKP-GNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    +  + L D Y+  TF + +EI +L   F ++       DY +  D  +     I N   ++ENPF++R+   FSE     ++F + +DM SV SE AP E+K  YAFK+Y+F+ DNYL K+DL + L ++     +     +    +  I+E+DLD D K+S+A+FE +I + P+F+ TF I+I
Sbjct:    1 MGNKQTIFTDEQL-DAYQDCTFFTRKEILRLHGRFHELAPHLVPMDYTDDPDVKIPL-ALIVNMPELKENPFRNRIVESFSEDGLGNLSFNDFVDMFSVLSEMAPRELKAIYAFKIYDFNVDNYLCKEDLEKTLNKLT--KEELTPEEVNLVCEKAIEEADLDGDSKLSFADFENMISRAPDFLSTFHIRI 187          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Cavefish
Match: cib2 (calcium and integrin binding family member 2 [Source:NCBI gene;Acc:103027299])

HSP 1 Score: 102.834 bits (255), Expect = 6.090e-27
Identity = 64/185 (34.59%), Postives = 104/185 (56.22%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKP-GNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMK 668
            MGN    +  + L D Y+  TF + +EI +L   F ++       DY +  D  +     I N   ++ENPF++R+   FSE     ++F + +DM SV SE AP E+K  YAFK+Y+F+ DNYL K+DL + L ++     +     +    +  I+E+DLD D K+S+A+FE +I + P+F++
Sbjct:    1 MGNKQTIFTDEQL-DAYQDCTFFTRKEILRLHGRFHELAPHLVPMDYTDDPDVKIPL-ALIVNMPELKENPFRNRIVESFSEDGLGNLSFNDFVDMFSVLSEMAPRELKAIYAFKIYDFNVDNYLCKEDLEKTLNKLT--KEELTPEEVNLVCEKAIEEADLDGDSKLSFADFENMISRAPDFLR 181          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Cavefish
Match: cib3 (calcium and integrin binding family member 3 [Source:NCBI gene;Acc:111194533])

HSP 1 Score: 100.523 bits (249), Expect = 5.059e-26
Identity = 64/192 (33.33%), Postives = 114/192 (59.38%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIY-KPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVV-NCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    +  + L D Y+    +S++++  LF  +RD+  +    DY N  D  L   E I +   +++NPF+ R+  +FSE     +  ++ LDM SV SE AP ++K +YAFK+Y+F++D+++ K DL + L ++  N   + E R++    + ++ E+DLD DG++S  +F+ +I + P+F+ TF I+I
Sbjct:    1 MGNKQTIFTAQQL-DAYQ----VSQEKL--LFHRYRDLAPQLVPLDYTNQPDVRLPY-ELIGSMPELKDNPFRQRIAEVFSEDGEGNMTLDDFLDMFSVLSEMAPRDLKAYYAFKIYDFNNDDFICKSDLEKTLNKLTRNELTEDEVRMV---CEKVMDEADLDNDGRLSLEDFQHMIVRAPDFLSTFHIRI 181          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Sea Lamprey
Match: cib2 (calcium and integrin binding family member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1663])

HSP 1 Score: 115.546 bits (288), Expect = 6.825e-33
Identity = 53/133 (39.85%), Postives = 91/133 (68.42%), Query Frame = 3
Query:  288 EFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            + I     ++ENPF+ R+  +FSE     ++F + +DM S FSETAP E+K +YAFK+Y+F+DD+++ + DLL++L+ +      +E  ++   ID +++E+DLD D K+S+A+FE +I + P+F+ TF I+I
Sbjct:   29 QLIGTMPELKENPFRQRILEVFSEDGQGNMSFSDFVDMFSAFSETAPRELKVYYAFKIYDFNDDSFIGRGDLLQVLQCLTRDEMSHEELLL--VIDKVLEEADLDDDSKLSFADFEHMISRAPDFISTFHIRI 159          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Sea Lamprey
Match: cib2 (calcium and integrin binding family member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1663])

HSP 1 Score: 114.005 bits (284), Expect = 7.221e-32
Identity = 67/192 (34.90%), Postives = 110/192 (57.29%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIY-KPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLY-NFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN       ++ +D Y+  TF + +EI +L   + ++  +    DY    D  L   + I N   ++ENPFK R+  +FSE     ++F + +DM SVFSE AP E+K +YAFK+Y +F+ D ++ K+DL+  L ++     +     +    D +++E+DLD D K+SYA+FE +I + P F+ TF I+I
Sbjct:    1 MGN-KQTIFTEEQLDAYQDCTFFTRKEILRLHARYHELAPQLVPMDYTKEPDIKLP-PQLICNMPELKENPFKQRIVEVFSEDGSGNLSFNDFVDMFSVFSEMAPRELKAYYAFKIYADFNADGFICKEDLVVTLNKLT--RDELAEEEVTLVCDKVVEEADLDCDNKLSYADFENMISRAPEFLSTFHIRI 188          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009304.1 (pep scaffold:Pmarinus_7.0:GL479988:26077:30241:1 gene:ENSPMAG00000008415.1 transcript:ENSPMAT00000009304.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 5.035e-17
Identity = 51/172 (29.65%), Postives = 90/172 (52.33%), Query Frame = 3
Query:  177 TFLSEQEIQKLFKNFR--DIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            T     EI++L K FR  D+   G+          L+ DEF++    +++NP   R+  IF       ++F+E ++ +S FS     + K  +AF++Y+ D D Y+S  +L ++LK +V  N   +   +Q  +D  I  +D D DG+IS+ EF  ++G + +F K  V+ +
Sbjct:   13 THFDADEIKRLGKRFRKLDLDNSGS----------LSVDEFMS-LPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKDQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNN--LKDTQLQQIVDKTILNADKDGDGRISFEEFCAVVGGL-DFHKKMVVDV 170          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000781.1 (pep scaffold:Pmarinus_7.0:GL476952:2198:8857:1 gene:ENSPMAG00000000709.1 transcript:ENSPMAT00000000781.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 9.883e-13
Identity = 46/161 (28.57%), Postives = 79/161 (49.07%), Query Frame = 3
Query:  195 EIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFV 677
            EI++L K FR +   G+          L+ +EF++    +++NP   R+  IF       ++F+E ++ +S FS     E K    +   N D D Y+S  +L ++LK +V  N   +   +Q  +D  I  +D D DG+IS+ EF  ++G +    K  V
Sbjct:   19 EIKRLGKRFRKLDLDGS--------GSLSVEEFMS-LPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRCKYSSCNMDRDGYISNGELFQVLKMMVGNN--LKDTQLQQIVDKTIINADKDGDGRISFEEFCEVVGGMDIHKKMVV 168          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004125.1 (pep scaffold:Pmarinus_7.0:GL483005:7747:12994:-1 gene:ENSPMAG00000003768.1 transcript:ENSPMAT00000004125.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 4.528e-12
Identity = 37/126 (29.37%), Postives = 65/126 (51.59%), Query Frame = 3
Query:  276 LTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKI 653
            L+ DEF++    +  NP   R+  I        ++F E ++ +S F+     E K  +AF++Y+ D D +++  +L  +LK +V  N       +Q  +D  I  +D D DGK+S+ EF  +IG +
Sbjct:   32 LSADEFLS-LPELHNNPLVRRVVDILDSDGDGEVDFAEFIEGISRFTINGTKEEKLKFAFQIYDVDRDGFITNGELFGVLKTMVGRN--LRDPQLQQIVDKSIISADADGDGKVSFPEFCTMIGDL 154          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Yeast
Match: CNB1 (Calcineurin B; regulatory subunit of calcineurin, a Ca++/calmodulin-regulated type 2B protein phosphatase which regulates Crz1p (stress-response transcription factor); other calcineurin subunit encoded by CNA1 and/or CMP1; regulates function of Aly1p alpha-arrestin; myristoylation by Nmt1p reduces calcineurin activity in response to submaximal Ca signals, is needed to prevent constitutive phosphatase activity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001673])

HSP 1 Score: 71.633 bits (174), Expect = 4.681e-16
Identity = 49/166 (29.52%), Postives = 84/166 (50.60%), Query Frame = 3
Query:  144 PKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCD--EFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFE 635
            P  ++D   + T     EI++L K F  +           RD+  + D  EF++    +  NP   R+  +F   N   ++F+E +  +S+FS     + K  +AFK+Y+ D D ++S  +L  +LK +V  N D E   +Q  +D  I E+D D DG++S+ EF+
Sbjct:    5 PSKIVDGLLEDTNFDRDEIERLRKRFMKLD----------RDSSGSIDKNEFMS-IPGVSSNPLAGRIMEVFDADNSGDVDFQEFITGLSIFSGRGSKDEKLRFAFKIYDIDKDGFISNGELFIVLKIMVGSNLDDEQ--LQQIVDRTIVENDSDGDGRLSFEEFK 157          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Yeast
Match: FRQ1 (N-myristoylated calcium-binding protein; may have a role in intracellular signaling through its regulation of the phosphatidylinositol 4-kinase Pik1p; member of the recoverin/frequenin branch of the EF-hand superfamily; human NCS1 functionally complements the heat sensitivity of a frq1 ts mutant [Source:SGD;Acc:S000002781])

HSP 1 Score: 51.6026 bits (122), Expect = 9.421e-9
Identity = 46/175 (26.29%), Postives = 83/175 (47.43%), Query Frame = 3
Query:  141 LPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPI----RENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLL-------EMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEF 632
            L KD +   ++ T+   +EIQ+  K F           R+     L  ++F+  +K          F + LF +F + N   I+FEE + ++S  S    +E K  +AF+LY+ + D Y++ D++L       +M+  +V  N D  +  ++  +  I K  D ++DG I+  EF
Sbjct:    8 LSKDDLTCLKQSTYFDRREIQQWHKGF----------LRDCPSGQLAREDFVKIYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSR-GTLEEKLSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMR--VKKIFKLMDKNEDGYITLDEF 169          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Nematostella
Match: EDO47515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM01])

HSP 1 Score: 119.013 bits (297), Expect = 1.520e-33
Identity = 69/194 (35.57%), Postives = 119/194 (61.34%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRI----IQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MG S+  +   +L D Y++ T+ +++EI   FK F  +        R  ++A L+    I     ++ NPF+DR+ ++FS      + FE+ LDMMSVFSE AP  VK  YAF++Y+F++D+Y+ ++DL +++ R+       E R+    +Q+ I+ I +E+DLD+D ++S+AEFE +I K P+F+ +F I++
Sbjct:    1 MGASHSQFTEDELKD-YQELTYFTQKEILHCFKRFMQLDPEA---VRLNKNAKLS-QRKILTLPELKVNPFRDRICKVFSSSKDGSLTFEDFLDMMSVFSENAPKSVKVEYAFRIYDFNEDDYICENDLKKVIMRLCG-----EQRLSDDNMQAMIEKIFEEADLDEDNQLSFAEFEHVISKAPDFVNSFRIRM 184          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Nematostella
Match: EDO36724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHW4])

HSP 1 Score: 99.3673 bits (246), Expect = 3.943e-26
Identity = 57/187 (30.48%), Postives = 104/187 (55.61%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYK---PGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMK 668
            MGN    +  + L D Y+  TF +  +I ++ K +R ++    P   DY+ +    L     +     ++ENPFK R+ ++FS      + F++ L+MMSV S++AP E+K  YAFK+++FD D  L   DL + +  V    GD +   +Q  ++ ++ E+D+D+ G +++ EFE ++ + P F++
Sbjct:    1 MGNKVCAFTEEQLED-YQDCTFFTRADILRIHKRYRALHPVLIPD--DYKELETQPLLKMRHLLKLPELKENPFKCRICQVFSVNGSGALTFDDFLNMMSVLSDSAPRELKVKYAFKIFDFDGDQKLGPTDLAQTVLSVT--GGDLKEDEVQFVVESLLSEADIDETGYLNFLEFEKVLERAPEFLR 182          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Nematostella
Match: EDO48535 (Predicted protein; Protein phosphatase 3 (Formerly 2B), regulatory subunit B [Source:UniProtKB/TrEMBL;Acc:A7RJ82])

HSP 1 Score: 77.7962 bits (190), Expect = 5.417e-18
Identity = 54/184 (29.35%), Postives = 92/184 (50.00%), Query Frame = 3
Query:  126 SNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFV 677
             N   LP D++      T     EI++L K FR +      D  N     L+ +EF++    +++NP   R+  IF       ++F+E ++ +S FS     E K  +AF++Y+ D+D Y+S  +L ++LK +V  N   +   +Q  +D  I  +D D DGKI ++EF  ++G +    K  V
Sbjct:    2 GNEASLPGDMV------THFDADEIRRLGKRFRKL------DLDN--SGSLSVEEFMS-LPELQQNPLVQRVITIFDADGNGEVDFKEFIEGVSQFSVKGDKESKLKFAFRIYDMDNDGYISNGELFQVLKMMVGNN--LKETQLQQIVDKTILNADKDGDGKICFSEFCAIVGNMDVHKKMVV 168          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Nematostella
Match: EDO47573 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMB6])

HSP 1 Score: 67.0106 bits (162), Expect = 9.331e-14
Identity = 51/181 (28.18%), Postives = 86/181 (47.51%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEF---IANFKPIRE-NPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDY-----ESRIIQSAIDGIIKESDLDKDGKISYAEF 632
            MG  N    P+ L D+     F SE E+Q+ +K F           ++  D  L+ +EF     NF P  + + F + +FR F       I+F E +  +SV S    +E K  +AF +Y+ D + Y+S+ ++LE+++ +    G       +    +   D I ++ D + DGK+S AEF
Sbjct:    1 MGKQNSKLKPEQLADLKNNTEF-SETELQEWYKGF----------LKDCPDGSLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFICALSVTSR-GKLEEKLKWAFSMYDLDGNGYISRQEMLEIVRAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDKNLDGKLSLAEF 169          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Nematostella
Match: EDO47572 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMB5])

HSP 1 Score: 65.855 bits (159), Expect = 2.195e-13
Identity = 50/181 (27.62%), Postives = 86/181 (47.51%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEF---IANFKPIRE-NPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDY-----ESRIIQSAIDGIIKESDLDKDGKISYAEF 632
            MG  N    P+ L D+     F S++E+Q+ +K F           ++     LT +EF     NF P  + + F + +FR F       I+F E +  +SV S    +E K  +AF +Y+ D + Y+S+ ++LE+++ +    G       +    +   D I ++ D + DGK+S AEF
Sbjct:    1 MGKQNSKLKPEQLADLKNNTEF-SDEELQEWYKGF----------LKDCPTGHLTVEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFICALSVTSR-GKLEQKLKWAFSMYDLDGNGYISRQEMLEIVRAIYKMVGSVMKMPEDESTPEKRTDKIFRQMDKNLDGKLSLAEF 169          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Medaka
Match: cib1 (calcium and integrin binding 1 [Source:NCBI gene;Acc:101168863])

HSP 1 Score: 114.005 bits (284), Expect = 4.086e-31
Identity = 66/199 (33.17%), Postives = 122/199 (61.31%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIY---KPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPN--GINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC--NGDYESRI----IQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            MG +  + L K ++  Y++ TFL++QEI   +K F ++    +     YR   +A L   E       ++ NPF +R+ ++FS  + +   +NF++ LD++S FS++A +E+K+HYAF++++FDDD  L + D    L+++VNC   G  ++ +    ++  ID I++ESD+DKDG ++ +EF+ +I + P+F+ +F I
Sbjct:    1 MGTT-ASQLDKGMLSEYQELTFLTKQEILLAYKRFSELLPKEETNGISYRIPMNAILELPE-------LKTNPFNERICKVFSTSDSHDGSLNFDDFLDLLSAFSDSATLEIKSHYAFRIFDFDDDGTLGRQD----LEKLVNCLTGGTGDTSLTPDEMKQLIDNILEESDIDKDGTVNLSEFQHVISRSPDFVSSFKI 187          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Medaka
Match: CIB2 (calcium and integrin binding family member 2 [Source:NCBI gene;Acc:101164382])

HSP 1 Score: 103.99 bits (258), Expect = 2.159e-27
Identity = 63/191 (32.98%), Postives = 104/191 (54.45%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKP-GNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGN    +  + L    E    + E E Q+L   FR++       DY N  D  +     I     ++ENPF++R+   FSE     ++F + +DM S   E +P E+KT YAFK+Y+F+ DN++ K+D+ + L ++    G+  +  +    +  I+E+DLD D K+S+A+FE +I K P+F+  F I+I
Sbjct:    1 MGNKQTTFTEEQL----EAYQVMLESEEQRLHGRFRELAPHLVPLDYTNNPDVKVPLT-LIVTMPELKENPFRERIVETFSEDGQGNLSFNDFVDMFSALCEASPRELKTIYAFKIYDFNRDNFICKEDMDKTLNKLT--KGELTAEEVALVCNKAIEEADLDGDSKLSFADFENMISKAPDFLSNFHIRI 184          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Medaka
Match: cib2 (calcium and integrin-binding family member 2-like [Source:NCBI gene;Acc:101166471])

HSP 1 Score: 100.523 bits (249), Expect = 5.069e-26
Identity = 57/143 (39.86%), Postives = 85/143 (59.44%), Query Frame = 3
Query:  249 DYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFV 677
            DY N  D  +     I N   ++ENPF+DR+   FSE     ++F E +DM SV SE AP E+K  YAFK+Y+F+ DNYL K+DL + L ++     +     ++   +  I E+DLD D K+SYA+FE +I + P+F++  V
Sbjct:   39 DYTNEPDCKIPL-ALIVNMPELKENPFRDRIVESFSEDGMGNLSFNEFVDMFSVLSEMAPRELKAIYAFKIYDFNVDNYLCKEDLEKTLNKLT--KEELTPEEVELVCEKTIVEADLDGDSKLSYADFENMITRAPDFLRYLV 178          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Medaka
Match: cib3 (calcium and integrin binding family member 3 [Source:NCBI gene;Acc:101170623])

HSP 1 Score: 98.9821 bits (245), Expect = 1.774e-25
Identity = 47/133 (35.34%), Postives = 86/133 (64.66%), Query Frame = 3
Query:  288 EFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            E I +   +++NPF+ R+  +FSE     ++ ++ LDM SV SE AP ++K +YAFK+Y+F++D++L K DL + L ++    G+     ++   + ++ E+DLD DG++S  +F+ +I + P+F+ TF I+I
Sbjct:   56 ELIGSMPELKDNPFRQRIAEVFSEDGEGNMSLDDFLDMFSVLSEMAPRDLKAYYAFKIYDFNNDDFLCKSDLEKTLTKLT--RGELGEDEVKMVCEKVMDEADLDNDGRLSLEDFQHMIVRAPDFLSTFHIRI 186          
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Medaka
Match: ENSORLT00000014732.2 (calcium and integrin-binding protein 1-like [Source:NCBI gene;Acc:101169107])

HSP 1 Score: 92.0485 bits (227), Expect = 8.631e-23
Identity = 64/183 (34.97%), Postives = 108/183 (59.02%), Query Frame = 3
Query:  165 YEKKTFLSEQEIQKLFKNFRDIY---KPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNP--NGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNC---NGDYESRI---IQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVI 680
            YE+ TFL++QEI   +K F  +    +    DYR   +  L   E       ++ NPFK+R+ ++FS  +     ++F++ LD +S FSE+A +E+K+HYAF +++F+DD  L + D    LK++VNC     D  S     ++  I+ I+ ESD+DKDG ++ +EF+ +I + P+F+ +F I
Sbjct:   16 YEELTFLTKQEILLAYKRFDKLVPKEEKNRIDYRVRMEDILELPE-------LKFNPFKERICKVFSTSDKKDGSLDFDDFLDFLSAFSESATLEIKSHYAFHIFDFEDDGTLGRQD----LKQLVNCLTGKADKTSLTADEMKQLINNILAESDIDKDGTVNLSEFQHVISRSPDFVSSFKI 187          
BLAST of Calcium and integrin-binding family member 2 vs. Planmine SMEST
Match: SMESG000065551.1 (SMESG000065551.1)

HSP 1 Score: 381.719 bits (979), Expect = 1.237e-136
Identity = 189/190 (99.47%), Postives = 189/190 (99.47%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGNSNHNYLPKDLIDVY KKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI
Sbjct:    1 MGNSNHNYLPKDLIDVYVKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 190          
BLAST of Calcium and integrin-binding family member 2 vs. Planmine SMEST
Match: SMESG000065550.1 (SMESG000065550.1)

HSP 1 Score: 205.682 bits (522), Expect = 3.297e-67
Identity = 100/190 (52.63%), Postives = 142/190 (74.74%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI 686
            MGNSN  YLP+D+I +YEKK +L+E+EIQK+FK FRDI  PG Y+Y +I+   +  ++F + FK I+ENPFKDR+F++FSE + +GI FE  L MMS+FSE AP EVK  YAFK+Y+FDDDNYLSK DL E+  ++++ + D +  II+ AI+ I KE  L +D  + +A+FE L+ K+P+FM TF+++I
Sbjct:    1 MGNSNAKYLPQDMIHMYEKKYYLTEREIQKIFKKFRDINTPGQYNYNDIQHFTVNSEDFNSKFKLIKENPFKDRIFKVFSEDDEDGIKFEGVLGMMSIFSENAPFEVKVRYAFKIYDFDDDNYLSKKDLYELSSKILDEDLDSKEIIIEKAIESIFKEVGLGQDEMMGFAKFEDLLSKVPDFMNTFIMRI 190          
BLAST of Calcium and integrin-binding family member 2 vs. Planmine SMEST
Match: SMESG000081409.1 (SMESG000081409.1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.815e-17
Identity = 53/184 (28.80%), Postives = 94/184 (51.09%), Query Frame = 3
Query:  126 SNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFV 677
             N + LP ++   ++      ++EI++L K F+ +   G+          L+ DEF++    +++NP   R+  IF   +   ++F+E ++ MS FS     E K  +AFK+Y+ D D ++S  +L ++LK +V  N   +   +Q  +D  I  +D D DGKISY EF  ++  +    K  V
Sbjct:    2 GNESSLPVEMCSTFD------QEEIRRLGKRFKKLDLDGS--------GSLSVDEFMS-LPQLQQNPLVQRVIEIFDSDSNGEVDFKEFIEGMSQFSVKGNKESKLKFAFKIYDIDRDGFISNGELFQVLKMMVGNN--LKETQLQQIVDKTIMFADKDGDGKISYEEFCAVVSGMDVHSKMVV 168          
BLAST of Calcium and integrin-binding family member 2 vs. Planmine SMEST
Match: SMESG000019278.1 (SMESG000019278.1)

HSP 1 Score: 75.8702 bits (185), Expect = 5.135e-17
Identity = 52/169 (30.77%), Postives = 86/169 (50.89%), Query Frame = 3
Query:  126 SNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEF 632
             N   LP +L   ++      + E+++L K FR +   G+          L+ +EF++    +++NP   R+  IF       ++F+E +D MS FS     E K  +AFK+Y+ D D ++S  +L ++LK +V  N   +   +Q  +D  I  +D D DGKISY EF
Sbjct:    2 GNEASLPIELCSTFD------QDELRRLGKRFRKLDLDGS--------GSLSVEEFMS-LPQLQQNPLVQRVIEIFDSDGNGEVDFKEFIDGMSQFSVKGNKEAKLRFAFKIYDMDRDGFISNGELFQVLKIMVGNN--LKDAQLQQIVDKTIIFADKDGDGKISYEEF 153          
BLAST of Calcium and integrin-binding family member 2 vs. Planmine SMEST
Match: SMESG000018297.1 (SMESG000018297.1)

HSP 1 Score: 66.2402 bits (160), Expect = 2.636e-13
Identity = 52/179 (29.05%), Postives = 91/179 (50.84%), Query Frame = 3
Query:  117 MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIRDAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFSET------APIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQSAIDGIIKESDLDKDGKISYAEFE 635
            MGN+N   L    I+    +T  S+++I++L+  F  + K  N         +LT   F+     +  NP  DR+   F + N + +NF++ +  +++F +T      +  E+K  + F LY+ D D  +S ++L+ ML+ +V  N    S  + +  +  + E+DLD DG ISY EFE
Sbjct:    1 MGNANCKILDASEIENISIETGFSDKQIRRLYNRFVALDKEDN--------GYLTRQTFLL-IPELAINPLGDRIVHEFFKNNVDELNFKDFVHKLAIFRKTSVDSTKSSRELKLKFLFDLYDLDKDEKISLEELMGMLQMMVGEN--ITSEQMNNIGERTMAEADLDNDGYISYGEFE 168          
The following BLAST results are available for this feature:
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CIB21.220e-3236.79calcium and integrin binding family member 2 [Sour... [more]
CIB12.503e-3235.53calcium and integrin binding 1 [Source:HGNC Symbol... [more]
CIB23.208e-3042.42calcium and integrin binding family member 2 [Sour... [more]
CIB21.755e-2943.55calcium and integrin binding family member 2 [Sour... [more]
CIB42.171e-2932.80calcium and integrin binding family member 4 [Sour... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calm-11.107e-2634.21CALMyrin (Calcium and Integrin Binding protein) ho... [more]
chpf-11.394e-1027.27Calcineurin-like EF-Hand Protein Family member [S... [more]
ncs-11.395e-924.18Neuronal calcium sensor 1 [Source:UniProtKB/Swiss... [more]
chpf-23.935e-923.53Calcineurin-like EF-Hand Protein Family member [S... [more]
cmd-13.340e-724.20Calmodulin [Source:UniProtKB/Swiss-Prot;Acc:O1630... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cib27.026e-3235.75gene:FBgn0034558 transcript:FBtr0304717[more]
CanB6.548e-1529.89gene:FBgn0010014 transcript:FBtr0070764[more]
CanB6.548e-1529.89gene:FBgn0010014 transcript:FBtr0308348[more]
CanB21.030e-1429.31gene:FBgn0015614 transcript:FBtr0309866[more]
CanB21.030e-1429.31gene:FBgn0015614 transcript:FBtr0088930[more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cib13.284e-3134.85calcium and integrin binding 1 (calmyrin) [Source:... [more]
cib22.914e-2935.08calcium and integrin binding family member 2 [Sour... [more]
cib31.102e-2532.94calcium and integrin binding family member 3 [Sour... [more]
cib13.225e-2335.56calcium and integrin binding 1 (calmyrin) [Source:... [more]
ppp3r1a6.252e-1529.81protein phosphatase 3, regulatory subunit B, alpha... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cib11.010e-3436.08calcium and integrin binding 1 [Source:NCBI gene;A... [more]
cib28.186e-3036.46calcium and integrin binding family member 2 [Sour... [more]
fads25.058e-2732.98fatty acid desaturase 2 [Source:Xenbase;Acc:XB-GEN... [more]
cib24.717e-2438.58calcium and integrin binding family member 2 [Sour... [more]
cib15.909e-2337.41calcium and integrin binding 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cib16.908e-3335.53calcium and integrin binding 1 (calmyrin) [Source:... [more]
Cib26.285e-3235.75calcium and integrin binding family member 2 [Sour... [more]
Cib13.558e-2934.69calcium and integrin binding 1 (calmyrin) [Source:... [more]
Cib41.134e-2832.28calcium and integrin binding family member 4 [Sour... [more]
Cib39.152e-2830.41calcium and integrin binding family member 3 [Sour... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R010|CIB1_RAT2.813e-3336.04Calcium and integrin-binding protein 1 OS=Rattus n... [more]
sp|Q9Z0F4|CIB1_MOUSE4.832e-3235.53Calcium and integrin-binding protein 1 OS=Mus musc... [more]
sp|O75838|CIB2_HUMAN5.857e-3236.79Calcium and integrin-binding family member 2 OS=Ho... [more]
sp|Q99828|CIB1_HUMAN1.202e-3135.53Calcium and integrin-binding protein 1 OS=Homo sap... [more]
sp|B1A8Z2|CIB1_SHEEP1.505e-3134.36Calcium and integrin-binding protein 1 OS=Ovis ari... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2GCQ91.019e-3442.78Calcium and integrin-binding family member 2 OS=Ar... [more]
A0A1S3J9H74.331e-3436.36calcium and integrin-binding family member 3 OS=Li... [more]
A0A2C9JUE43.047e-3337.56Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A210Q6W04.895e-3338.34Calcium and integrin-binding protein 1 OS=Mizuhope... [more]
G3MLE75.790e-3336.46Uncharacterized protein OS=Amblyomma maculatum OX=... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cib13.878e-3235.00calcium and integrin binding 1 [Source:NCBI gene;A... [more]
cib31.089e-3032.98calcium and integrin binding family member 3 [Sour... [more]
cib21.793e-2935.60calcium and integrin binding family member 2 [Sour... [more]
cib26.090e-2734.59calcium and integrin binding family member 2 [Sour... [more]
cib35.059e-2633.33calcium and integrin binding family member 3 [Sour... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cib26.825e-3339.85calcium and integrin binding family member 2 [Sour... [more]
cib27.221e-3234.90calcium and integrin binding family member 2 [Sour... [more]
ENSPMAT00000009304.15.035e-1729.65pep scaffold:Pmarinus_7.0:GL479988:26077:30241:1 g... [more]
ENSPMAT00000000781.19.883e-1328.57pep scaffold:Pmarinus_7.0:GL476952:2198:8857:1 gen... [more]
ENSPMAT00000004125.14.528e-1229.37pep scaffold:Pmarinus_7.0:GL483005:7747:12994:-1 g... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CNB14.681e-1629.52Calcineurin B; regulatory subunit of calcineurin, ... [more]
FRQ19.421e-926.29N-myristoylated calcium-binding protein; may have ... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO475151.520e-3335.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367243.943e-2630.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485355.417e-1829.35Predicted protein; Protein phosphatase 3 (Formerly... [more]
EDO475739.331e-1428.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475722.195e-1327.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cib14.086e-3133.17calcium and integrin binding 1 [Source:NCBI gene;A... [more]
CIB22.159e-2732.98calcium and integrin binding family member 2 [Sour... [more]
cib25.069e-2639.86calcium and integrin-binding family member 2-like ... [more]
cib31.774e-2535.34calcium and integrin binding family member 3 [Sour... [more]
ENSORLT00000014732.28.631e-2334.97calcium and integrin-binding protein 1-like [Sourc... [more]
back to top
BLAST of Calcium and integrin-binding family member 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065551.11.237e-13699.47SMESG000065551.1[more]
SMESG000065550.13.297e-6752.63SMESG000065550.1[more]
SMESG000081409.11.815e-1728.80SMESG000081409.1[more]
SMESG000019278.15.135e-1730.77SMESG000019278.1[more]
SMESG000018297.12.636e-1329.05SMESG000018297.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008607 ID=SMED30008607|Name=Calcium and integrin-binding family member 2|organism=Schmidtea mediterranea sexual|type=transcript|length=700bp
CTTTATTTGAACAGCCTTTATAAATTCAATCTGCCAATTTTATTTGAATA
TATAATTTAATATTTCACTTGTTGAAATAGAATTTTTGAGTCAAGAAAAA
GTAAGTCGTTTGAAAAATGGGCAATTCCAATCATAATTACCTTCCAAAGG
ATTTAATTGATGTTTATGAAAAGAAAACGTTTTTATCGGAGCAAGAAATT
CAAAAATTATTTAAAAATTTTCGAGATATTTATAAACCTGGAAATTACGA
CTACAGAAATATCCGAGACGCTTTTCTAACTTGCGATGAATTTATCGCTA
ATTTTAAACCAATCAGAGAAAATCCATTTAAAGACAGATTATTTAGGATT
TTCTCGGAATATAATCCCAATGGAATCAATTTTGAGGAGACATTGGACAT
GATGTCGGTGTTTTCAGAGACTGCACCTATTGAAGTCAAAACCCATTATG
CGTTTAAACTATACAACTTTGACGACGATAATTATTTATCTAAAGATGAT
TTATTGGAAATGTTGAAGCGAGTCGTCAATTGTAATGGAGATTACGAAAG
CCGAATAATTCAAAGTGCCATTGACGGCATCATTAAAGAATCTGATTTGG
ATAAAGACGGAAAAATAAGTTATGCTGAATTTGAATTACTGATAGGGAAA
ATTCCTAATTTTATGAAAACATTTGTTATAAAAATATAATATATTTGAAT
back to top

protein sequence of SMED30008607-orf-1

>SMED30008607-orf-1 ID=SMED30008607-orf-1|Name=SMED30008607-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=191bp
MGNSNHNYLPKDLIDVYEKKTFLSEQEIQKLFKNFRDIYKPGNYDYRNIR
DAFLTCDEFIANFKPIRENPFKDRLFRIFSEYNPNGINFEETLDMMSVFS
ETAPIEVKTHYAFKLYNFDDDNYLSKDDLLEMLKRVVNCNGDYESRIIQS
AIDGIIKESDLDKDGKISYAEFELLIGKIPNFMKTFVIKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007229integrin-mediated signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 151..179
e-value: 0.03
score: 23.5
coord: 108..136
e-value: 19.0
score: 7.5
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 108..173
e-value: 1.6E-11
score: 44.5
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 147..182
score: 10.106
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 104..139
score: 8.6
IPR002048EF-hand domainCDDcd00051EFhcoord: 108..172
e-value: 5.66359E-7
score: 42.9201
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 11..104
e-value: 4.4E-22
score: 80.0
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 106..190
e-value: 2.3E-16
score: 61.9
NoneNo IPR availablePANTHERPTHR45791FAMILY NOT NAMEDcoord: 1..189
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 160..172
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 4..188