Zinc finger MYM-type protein 1

Overview
NameZinc finger MYM-type protein 1
Smed IDSMED30008591
Length (bp)5596
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger MYM-type protein 1 (SMED30008591) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30008591) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger MYM-type protein 1 (SMED30008591) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30008591) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: PACSIN2 (protein kinase C and casein kinase substrate in neurons 2 [Source:HGNC Symbol;Acc:HGNC:8571])

HSP 1 Score: 81.6481 bits (200), Expect = 4.967e-15
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  429 VRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAI 485          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: PACSIN2 (protein kinase C and casein kinase substrate in neurons 2 [Source:HGNC Symbol;Acc:HGNC:8571])

HSP 1 Score: 81.6481 bits (200), Expect = 4.967e-15
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  429 VRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAI 485          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: PACSIN2 (protein kinase C and casein kinase substrate in neurons 2 [Source:HGNC Symbol;Acc:HGNC:8571])

HSP 1 Score: 81.6481 bits (200), Expect = 4.967e-15
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  429 VRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAI 485          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: PACSIN2 (protein kinase C and casein kinase substrate in neurons 2 [Source:HGNC Symbol;Acc:HGNC:8571])

HSP 1 Score: 81.2629 bits (199), Expect = 5.470e-15
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  388 VRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAI 444          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: PACSIN2 (protein kinase C and casein kinase substrate in neurons 2 [Source:HGNC Symbol;Acc:HGNC:8571])

HSP 1 Score: 81.2629 bits (199), Expect = 5.470e-15
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  388 VRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAI 444          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Match: sdpn-1 (SynDaPiN (Synaptic dynamin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q6AHQ8])

HSP 1 Score: 55.0694 bits (131), Expect = 4.027e-7
Identity = 22/49 (44.90%), Postives = 32/49 (65.31%), Query Frame = 1
Query: 5284 LYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 5430
            LYDY   E DE+ L++G++   L + D  GWC G+  G VGL+PA+Y +
Sbjct:  441 LYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRVSGNVGLFPASYVQ 489          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Match: sdpn-1 (SynDaPiN (Synaptic dynamin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q6AHQ8])

HSP 1 Score: 55.0694 bits (131), Expect = 4.162e-7
Identity = 22/49 (44.90%), Postives = 32/49 (65.31%), Query Frame = 1
Query: 5284 LYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 5430
            LYDY   E DE+ L++G++   L + D  GWC G+  G VGL+PA+Y +
Sbjct:  435 LYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRVSGNVGLFPASYVQ 483          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Match: sdpn-1 (SynDaPiN (Synaptic dynamin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q6AHQ8])

HSP 1 Score: 55.0694 bits (131), Expect = 4.162e-7
Identity = 22/49 (44.90%), Postives = 32/49 (65.31%), Query Frame = 1
Query: 5284 LYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 5430
            LYDY   E DE+ L++G++   L + D  GWC G+  G VGL+PA+Y +
Sbjct:  435 LYDYAPAEGDEIALRKGEMIEVLTEPDSLGWCTGRVSGNVGLFPASYVQ 483          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Match: Synd (gene:FBgn0053094 transcript:FBtr0083966)

HSP 1 Score: 93.2041 bits (230), Expect = 5.449e-19
Identity = 42/56 (75.00%), Postives = 46/56 (82.14%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 5436
            V V+ALYDY G E DELT KQGD+F KLEDEDEQGWCKG+ +GRVGLYPANY E  
Sbjct:  439 VPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGWCKGRMNGRVGLYPANYVETA 494          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Match: Synd (gene:FBgn0053094 transcript:FBtr0334725)

HSP 1 Score: 93.2041 bits (230), Expect = 5.533e-19
Identity = 42/56 (75.00%), Postives = 46/56 (82.14%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 5436
            V V+ALYDY G E DELT KQGD+F KLEDEDEQGWCKG+ +GRVGLYPANY E  
Sbjct:  440 VPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGWCKGRMNGRVGLYPANYVETA 495          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Match: Synd (gene:FBgn0053094 transcript:FBtr0334724)

HSP 1 Score: 93.2041 bits (230), Expect = 5.533e-19
Identity = 42/56 (75.00%), Postives = 46/56 (82.14%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 5436
            V V+ALYDY G E DELT KQGD+F KLEDEDEQGWCKG+ +GRVGLYPANY E  
Sbjct:  440 VPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGWCKGRMNGRVGLYPANYVETA 495          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.621e-26
Identity = 45/108 (41.67%), Postives = 69/108 (63.89%), Query Frame = 2
Query:  947 ILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLD---------NATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDETT 1243
            IL+ LID+  YL +Q  AF G++ES++S N+GN+IE++  L++++ ++K HLD             VS LS+  QND+I ++   +  KI +EIKE    SI+LDETT
Sbjct:  306 ILTRLIDISLYLARQGQAFRGDDESSSSANQGNFIELVKTLAQYDSVMKLHLDAIQEKQASMKKPQVSLLSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLDETT 413          

HSP 2 Score: 58.151 bits (139), Expect = 1.621e-26
Identity = 39/118 (33.05%), Postives = 66/118 (55.93%), Query Frame = 1
Query: 1252 QLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHK-LVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSCKIF 1602
            Q++ V+RYV  D  + ERF++   +  T   K L +++++ L++  L+ K +  Q YDGAA MSG   GLQ+ ++   + A +VH  AH L+LVL +S +       F+  +    +F
Sbjct:  420 QVSFVVRYV-RDMEVKERFLQVCTLEST-TGKELENVVISLLQDNGLDLKNIRGQGYDGAANMSGMYKGLQSRIRAHNEKALYVHCQAHCLNLVLVESAKSSIHFVTFFSLVEKLYVF 535          

HSP 3 Score: 56.9954 bits (136), Expect = 2.550e-7
Identity = 43/120 (35.83%), Postives = 62/120 (51.67%), Query Frame = 1
Query: 2266 QKLETEIKV---IFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRR 2616
            Q+L+TE+KV    F  S +K+      +LS +      + F    ++ K+  T+P +TAT ER FS M+ IKN  R+    ERLS L LI+IEK++          +  VINIF     R
Sbjct:  793 QQLKTELKVFHTTFKSSGMKS------MLSILKETSGQHVFPALVEMLKVYATLPVSTATVERSFSKMRLIKNQLRSLCSEERLSDLLLIAIEKDIPVD-------HSEVINIFKHMAHR 899          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons 1b [Source:NCBI gene;Acc:619246])

HSP 1 Score: 84.7297 bits (208), Expect = 2.631e-16
Identity = 43/66 (65.15%), Postives = 49/66 (74.24%), Query Frame = 1
Query: 5242 SPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            +P   D   V+VRALYDY G E+DELT K GD   KLEDEDEQGWCKG+ D G++GLYPANY E V
Sbjct:  380 NPFEEDSKGVRVRALYDYEGQEQDELTFKAGDELTKLEDEDEQGWCKGRLDSGQLGLYPANYVEPV 445          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons 1b [Source:NCBI gene;Acc:619246])

HSP 1 Score: 84.7297 bits (208), Expect = 2.631e-16
Identity = 43/66 (65.15%), Postives = 49/66 (74.24%), Query Frame = 1
Query: 5242 SPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            +P   D   V+VRALYDY G E+DELT K GD   KLEDEDEQGWCKG+ D G++GLYPANY E V
Sbjct:  380 NPFEEDSKGVRVRALYDYEGQEQDELTFKAGDELTKLEDEDEQGWCKGRLDSGQLGLYPANYVEPV 445          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons 1b [Source:NCBI gene;Acc:619246])

HSP 1 Score: 84.7297 bits (208), Expect = 2.631e-16
Identity = 43/66 (65.15%), Postives = 49/66 (74.24%), Query Frame = 1
Query: 5242 SPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            +P   D   V+VRALYDY G E+DELT K GD   KLEDEDEQGWCKG+ D G++GLYPANY E V
Sbjct:  380 NPFEEDSKGVRVRALYDYEGQEQDELTFKAGDELTKLEDEDEQGWCKGRLDSGQLGLYPANYVEPV 445          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2596])

HSP 1 Score: 77.0258 bits (188), Expect = 3.056e-15
Identity = 38/60 (63.33%), Postives = 44/60 (73.33%), Query Frame = 1
Query: 5254 SDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGK-KDGRVGLYPANYAE 5430
            S E  V VRA+YDY G E+DEL+ K GD   KL +EDEQGWCKG+  +G VGLYPANY E
Sbjct:  129 STEMCVPVRAVYDYEGQEQDELSFKAGDELVKLSEEDEQGWCKGRLSNGTVGLYPANYVE 188          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 1.124e-30
Identity = 130/502 (25.90%), Postives = 216/502 (43.03%), Query Frame = 1
Query: 1219 VDNTGRNNIFIQLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSCKIFQPIIKTCSCI*SIFFSATTKSFSCEWEY-NGRLVKTVTRLQNLKLYFSSIKNQT--------SDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHFXXXXXXXXXXQLTS---QKR--------------ELSRKNISQHYKVLINKIGQKMISEM----ENRFDSLKQIKFIELTDTSQYENFQKQFPVDLINNLKINCMRYFDIQKLETEI-----KVIFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRRI 2619
            VD+T   +   QLA ++ YV NDG   ERFIKFI     +     S ++ T  E          QSYD A+ MSG   GLQA +K V  LA ++   AH L+LV   + E   +   F+     C I Q +          FFSA+    S  WE     L +  T ++NL     S ++          SD      SL+L + F        FL  L+ +N+I  Q +     LQ K   I    + +   ++   E+ +   +E +         L++ +   QKR              E +  +   ++++ +N+I   +IS++    +   D+    +F+       +E  Q Q      ++L +   +  D  +L +EI     +V     D K+    D +   + +  L +C+       ++ LT P T A+ +R FS +K IKNY R+    ERLS+L+++SIE E+ + +    +F D + +  + K R+I
Sbjct:  252 VDSTPDVSHTDQLAFIICYVKNDGIPKERFIKFIPNVGHKAENLFSAVMDTLKEYHIDILDCRGQSYDNASNMSGPYSGLQARIKQVNPLAVYIPCSAHSLNLVGTSAAESCREAVSFF-----C-ILQQLYH--------FFSAS----STRWEMLISHLKRKATVVKNLSTTRWSARSDAYIRENSSNSDSVSTAQSLLLQVDF-------HFLCTLFVWNKILSQVDRDNQALQAKSISILDASKIVNGLRSTFQEMRVISVDEIYFYARDVCEKLEIPATFPQKRKRKVKARASYESADEGASLSAGDNFRISLNQIFDVLISDLTWKSKTLMDTSVDFEFLSCPALVTFELSQLQ---KAASDLALKYSKDLDASELCSEIESFRHQVEAILPDAKSATPLD-LCQMIQDYSLADCYPNIDTAFRIFLTSPVTVASCKRSFSKLKLIKNYLRSSMEQERLSNLSILSIEHEMARKI----DFDDVIDHFAAMKARKI 720          

HSP 2 Score: 57.3806 bits (137), Expect = 1.124e-30
Identity = 32/105 (30.48%), Postives = 55/105 (52.38%), Query Frame = 2
Query:  941 RQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDN-----ATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDET 1240
            R +L  ++  V  L  + L F G +E   S+  GNY+ ++  ++EH+P L EH+           S LS  V  + I+ +++ V E I++E K+  + SI +D T
Sbjct:  151 RNVLKRVVTAVKTLSSRGLPFRGTDEKFGSLTNGNYLMLLEAIAEHDPFLAEHIKKYGNTGTGSTSYLSKTVCFEFIDIVASSVLEVIINEAKQAKYYSISVDST 255          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: cdk4 (cyclin-dependent kinase 4 [Source:Xenbase;Acc:XB-GENE-5900655])

HSP 1 Score: 80.8777 bits (198), Expect = 4.944e-15
Identity = 38/57 (66.67%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRA+YDY G E DEL+ K GD   K+EDEDEQGWCKG  D G+VGLYPANY E++
Sbjct:  346 VRVRAVYDYSGQESDELSFKSGDELTKIEDEDEQGWCKGVTDKGQVGLYPANYVEVI 402          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: PACSIN1 (protein kinase C and casein kinase substrate in neurons 1 [Source:NCBI gene;Acc:100494558])

HSP 1 Score: 78.5666 bits (192), Expect = 3.442e-14
Identity = 38/57 (66.67%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E+DEL+ K G+   KLEDEDEQGWC+G+ D GR GLYPANY E +
Sbjct:  383 VRVRALYDYEGQEQDELSFKAGEELTKLEDEDEQGWCRGQLDSGRQGLYPANYVESI 439          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: PACSIN1 (protein kinase C and casein kinase substrate in neurons 1 [Source:NCBI gene;Acc:100494558])

HSP 1 Score: 78.5666 bits (192), Expect = 4.114e-14
Identity = 38/57 (66.67%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E+DEL+ K G+   KLEDEDEQGWC+G+ D GR GLYPANY E +
Sbjct:  396 VRVRALYDYEGQEQDELSFKAGEELTKLEDEDEQGWCRGQLDSGRQGLYPANYVESI 452          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: PACSIN1 (protein kinase C and casein kinase substrate in neurons 1 [Source:NCBI gene;Acc:100494558])

HSP 1 Score: 78.5666 bits (192), Expect = 4.153e-14
Identity = 38/57 (66.67%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E+DEL+ K G+   KLEDEDEQGWC+G+ D GR GLYPANY E +
Sbjct:  388 VRVRALYDYEGQEQDELSFKAGEELTKLEDEDEQGWCRGQLDSGRQGLYPANYVESI 444          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:MGI Symbol;Acc:MGI:1345153])

HSP 1 Score: 81.2629 bits (199), Expect = 9.122e-17
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  123 VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 179          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:MGI Symbol;Acc:MGI:1345153])

HSP 1 Score: 80.8777 bits (198), Expect = 6.833e-16
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  215 VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 271          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:MGI Symbol;Acc:MGI:1345153])

HSP 1 Score: 81.6481 bits (200), Expect = 3.959e-15
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  429 VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 485          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:MGI Symbol;Acc:MGI:1345153])

HSP 1 Score: 81.6481 bits (200), Expect = 3.959e-15
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  429 VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 485          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Match: Pacsin2 (protein kinase C and casein kinase substrate in neurons 2 [Source:MGI Symbol;Acc:MGI:1345153])

HSP 1 Score: 81.6481 bits (200), Expect = 3.959e-15
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  429 VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 485          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|Q07839|EG13_ECHGR (Antigen EG13 OS=Echinococcus granulosus OX=6210 GN=EG13 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 5.944e-17
Identity = 39/49 (79.59%), Postives = 43/49 (87.76%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYP 5415
            V +RALYDY+GVE DEL+   GDLF KLEDEDEQGWCKG+KDGRVGLYP
Sbjct:  364 VPIRALYDYVGVEADELSFNSGDLFEKLEDEDEQGWCKGRKDGRVGLYP 412          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|Q07840|EM13_ECHMU (Antigen EM13 OS=Echinococcus multilocularis OX=6211 GN=EM13 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.562e-17
Identity = 39/49 (79.59%), Postives = 43/49 (87.76%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYP 5415
            V +RALYDY+GVE DEL+   GDLF KLEDEDEQGWCKG+KDGRVGLYP
Sbjct:  374 VPIRALYDYVGVEADELSFNSGDLFEKLEDEDEQGWCKGRKDGRVGLYP 422          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|Q4V920|PACN1_DANRE (Protein kinase C and casein kinase substrate in neurons protein 1 OS=Danio rerio OX=7955 GN=pacsin1b PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.986e-15
Identity = 43/66 (65.15%), Postives = 49/66 (74.24%), Query Frame = 1
Query: 5242 SPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            +P   D   V+VRALYDY G E+DELT K GD   KLEDEDEQGWCKG+ D G++GLYPANY E V
Sbjct:  380 NPFEEDSKGVRVRALYDYEGQEQDELTFKAGDELTKLEDEDEQGWCKGRLDSGQLGLYPANYVEPV 445          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|Q9UNF0|PACN2_HUMAN (Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 2.386e-14
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  429 VRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAI 485          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|Q9WVE8|PACN2_MOUSE (Protein kinase C and casein kinase substrate in neurons protein 2 OS=Mus musculus OX=10090 GN=Pacsin2 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.769e-14
Identity = 39/57 (68.42%), Postives = 45/57 (78.95%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E DEL+ K GD   K+EDEDEQGWCKG+ D G+VGLYPANY E +
Sbjct:  429 VRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAI 485          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: X1WND4 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.021e-119
Identity = 167/476 (35.08%), Postives = 272/476 (57.14%), Query Frame = 1
Query: 1252 QLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSCKIFQPIIKTCSCI*SIFFSATTKSFSCE--------------WEYNGRLVKTVTRLQN--LKLYFSSIKNQTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHFXXXXXXXXXXQLTSQKR----ELSRKNISQHYKVLINKIGQKMISEMENRFDSLKQIKFIELTDTSQYENFQKQFPVDLINNLKINCMRYFDIQKLETEIKVIFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRRI 2619
            QL+I+ RY++ +G + ERF+ F+DVS  R AK L++     L+     +KL+AQ+YDGAAVMSG+  GLQAL++   K A FVH  AH+L+L+L++S +   +CKVF+              T S + S F  +T + ++ E              W YN RLV+ ++  +   L L  + I+N      WD ++L  A GF Q + D DF   L  F +I PQ+ +L++ILQ KI+D++YC  KI +F N +   M   F++ +      LN       KR    E+S ++   +Y+ L  +I   +++++  RF  + +++F  L D S+++ F  QFP   +++LK +   YFD   L++E+ +++  ++  +K   +E+  ++ + +L     + TKL  L+LTIP T+A AER FS++KRI  Y RN +   RLS+L+++SIEK+LL  ++   +FYD VI  +S+K RRI
Sbjct:  269 QLSIIFRYITQEG-VQERFLGFVDVSQDRSAKCLAEHTFNILQEYNCENKLIAQTYDGAAVMSGQHNGLQALVRLKCKNAMFVHCYAHKLNLILKQSVDHIKECKVFF-------------LTLSGLSSFFSKSTKRIYALEQEVKKRFPSVAPTRWNYNSRLVEMMSEYKQEVLNLMDTIIENGEK---WDSETLSCARGFFQTIQDFDFNFFLLIFGDILPQATILFNILQTKIFDVTYCNTKILDFVNHLKN-MRNNFDQIWSKSEQYLNTEMPLRSKRLRITEVS-EDKKTNYRRLFFEIIDVLVTKINERFSEISKLQFFSLLDFSKFDQFVNQFPTSSMDSLKNSYGEYFDFSILKSELTIVYSSTEF-HKRNINELWLYLKSTELSESLPQVTKLSSLILTIPATSAGAERSFSTLKRIHTYLRNSQSQNRLSALSILSIEKQLLTQIQKENSFYDEVIEDYSKKPRRI 724          

HSP 2 Score: 117.857 bits (294), Expect = 1.021e-119
Identity = 58/102 (56.86%), Postives = 74/102 (72.55%), Query Frame = 2
Query:  938 NRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDETT 1243
            NR ++S LID  CYL +QEL F G++E   S NRGNY+E+INL+   +  L  HL  ATV SGLS ++QNDLI +ISNV+ +K+  EIK  DFVSII+DETT
Sbjct:  161 NRYVVSRLIDATCYLAKQELPFRGHDEQITSTNRGNYVELINLMGTLDLKLSGHLSTATVFSGLSGDIQNDLIQSISNVLMKKVTLEIKNVDFVSIIMDETT 262          

HSP 3 Score: 104.76 bits (260), Expect = 1.021e-119
Identity = 49/127 (38.58%), Postives = 78/127 (61.42%), Query Frame = 1
Query:  469 TLLNKSNMEADN---CNCIIEKLFEQSFSSRLFDDKMEIIKNGKSTPFLENLRTRTKKCVRHFSTDKYQKIEWLTGCKSFCAIYCWSCLLYKHEKNVWNGKVGFSDLNNFEKAEKGTQL-QPHIYCV 837
            +L + SN+  ++   C CIIE+L ++SF +  F +K  II  G+ TP L+NL+++ KK  R+F++  Y   +WL+GC+    +YCW C+L+  E NVW  K GF DLNN+   +   +  + HI C+
Sbjct:    3 SLASTSNLNLNDNNYCKCIIEQLLQKSFGTYSFSEKQNIINKGRPTPKLQNLKSKNKKTFRYFNSSYYDSNKWLSGCEKTQKLYCWPCILFSRESNVW-SKFGFVDLNNYHNLKHRHETNRSHIECL 128          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2S2NR69 (Zinc finger MYM-type protein 1 OS=Schizaphis graminum OX=13262 GN=ZMYM1_111 PE=4 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 6.886e-110
Identity = 170/460 (36.96%), Postives = 258/460 (56.09%), Query Frame = 1
Query: 1252 QLAIVLRYVSND-GAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSC-KIFQPIIKTCSCI*SIFFSATTKSFSCEWEYNGRLVKTVTRLQNLKL-YFSSIKNQTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHFXXXXXXXXXXQLTSQKRELSRKNISQHYKVLINKIGQKMISEMENRFDSLKQIKFIELTDTSQYENFQKQFPVDLINNLK-INCMRYFDIQKLETEIKVIFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRRI 2619
            QL+  LRYV ++ G   ERFI F+DVS  R A  L   ++  +    L HKLVAQ+YDGAAVMSG  GGLQ  +K +   A FVH  +H L+LVL +S      CK+F+  +      F    K    + +       K+    W ++ RLV TV    +  + +F  + + ++D  WD ++++L+  F  FL       LL  F++IF  +++LY++LQ K  DI YC++KI E K  +    +  FE+ +E +  +    +   + R+         YKVL N+I   +++ ++ RF SL + +F+ L D S+Y N+  +FP   + NL+  N    FD  +L  E+ V++   +  N  Y  +++  +   DL + F E  KL +L+LTIP TTA+ ER FS++KRIK+Y R+ +G ERLSSL+LISIEKELL   K+   FYD VIN F +++RRI
Sbjct:  261 QLSTTLRYVHHETGEAHERFISFVDVSADRSADGLLKYVIDIVNRYELKHKLVAQTYDGAAVMSGHVGGLQVKVKELYPRALFVHCFSHSLNLVLSQSASNIKDCKIFFQTLTGMGSFFTKSSKRTHALSNFTRKKMPKNAPTRWNFSSRLVNTVHEYNSYFIEFFQHVLDNSND--WDNEAIVLSQVFINFLDSRQTYFLLIVFSKIFSLTDILYEVLQTKRLDILYCVKKIEETKCQLQNYRLNLFEQLWETVLSDKGDFEPQRKIRD-----PKTFYKVLFNEIFDNILTNLQARFGSLNKFEFLSLIDPSKYSNYTNEFPNSALENLQESNFGEIFDFIRLRNELIVLYKSEEFLNTPY--DLVKKIKMNDLISVFQEVFKLSQLILTIPITTASVERSFSALKRIKSYQRSTQGQERLSSLSLISIEKELLHKEKNHPEFYDKVINEFIKQERRI 711          

HSP 2 Score: 97.0561 bits (240), Expect = 6.886e-110
Identity = 46/103 (44.66%), Postives = 72/103 (69.90%), Query Frame = 2
Query:  935 KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDETT 1243
            KNR +L   ID VC+L   EL F G+NE   S ++GN++  +NLLS ++ +L  HL+ + +  G S+ +QNDLI ++SN+++  I SEIK ++FV+I+LDET+
Sbjct:  152 KNRDVLKRFIDCVCFLVIHELPFRGHNERVNSFDQGNFLGCLNLLSSYDSILNVHLETSKIFRGTSNRIQNDLICSVSNIISTSIESEIKNSNFVAILLDETS 254          

HSP 3 Score: 91.2781 bits (225), Expect = 6.886e-110
Identity = 45/121 (37.19%), Postives = 64/121 (52.89%), Query Frame = 1
Query:  490 MEADNCNCIIEKLFEQSFSSRLFDDKMEIIKNGKSTP----FLENLRTRTKKCVRHFSTDKYQKIEWLTGCKSFCAIYCWSCLLYKHEKNVWNGKVGFSDLNNFEKA-EKGTQLQPHIYCV 837
            M  D+ NC+IE L E  F  + F +K+ I+KNG+  P       N + + K  +RHF+   Y    WLTG      ++CW C+L+  EKNVW+   GF +LNN     +K  + Q HI  V
Sbjct:    1 MNTDSNNCLIEHLLENEFHLKNFGEKLTIVKNGRPCPEIPKLTSNHKEKNKVYIRHFNISNYLNTPWLTGSAKLNKLFCWPCVLFTREKNVWSHS-GFVNLNNLTNGIQKHERSQTHISSV 120          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A067R633 (Zinc finger MYM-type protein 1 OS=Zootermopsis nevadensis OX=136037 GN=L798_07285 PE=4 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.008e-108
Identity = 164/474 (34.60%), Postives = 270/474 (56.96%), Query Frame = 1
Query: 1219 VDNTGRNNIFIQLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWS-CKIFQPIIKTCSCI*SIFFSATTKSFSCEWEYNGRLVKTVTRLQN-LKLYFSSIKNQTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHFXXX---XXXXXXXQLTSQKRELSRKNISQ--HYKVLINKIGQKMISEMENRFDSLKQIKFIELTDTSQYENFQKQFPVDLINNLKINCMRYFDIQKLETEIKVIFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRRI 2619
            VD +G++    QL+ VLRYV+ DG++ ERFI+F DVS  R A +LS  +   +       KLVAQ+YDGAAVM GE  GLQ L+++  + A FVH  AH+L+LVL++S E   +CKVF+  +      F    K  +    +            W Y  RLV+ +++L+  L  +F S+ N T   +WD ++ I A G+ + L D DF   L  F+ + PQ++ L++I+Q  I +ISYC + + EF+N + E  +  FEE +      +      +L +++  ++  N  Q  +Y+ L  +I   M  ++ NRF  + ++KF+ L D   ++++ + FP     +L ++  RYFD   L+TE+ VI+   +      +D +L ++   +L+    E TKL  L+LTIP T+A+ E  FS++KR+  Y  + +  ERL+ L+L++IEK +L+ L+S+ NF  +VI+IFS+K+  +
Sbjct:  250 VDVSGKS----QLSSVLRYVTPDGSVQERFIRFSDVSQDRSAASLSVHVFNLINEFRCGEKLVAQTYDGAAVMVGEHNGLQELIRDKYETAFFVHCYAHQLNLVLRQSVECIPECKVFFETLSGFASFFSKSSKRLAAFDKLVTRRLPSVAPTIWLYAERLVEVISQLKTELINFFKSVTNDTK--EWDGETRISARGYYEILQDFDFNFYLKVFSGVLPQAKELFEIMQ-TIGNISYCSKIVEEFQNFLTE-KLNSFEEVWSESVSCSQGDEHSELLAKRPRIAVINNDQKIYYQRLYREIIDTMKGQLTNRFSEILKLKFVSLLDFGNFKHYSEMFPAAAYESLLLSYGRYFDALLLKTELSVIYSSEEFLKSNISD-LLRYLITSNLNTALPEVTKLSALLLTIPTTSASVEGSFSALKRVNTYLHSTQTQERLTKLSLMTIEKRILQDLESSPNFCSSVIDIFSEKNSSV 714          

HSP 2 Score: 98.5969 bits (244), Expect = 1.008e-108
Identity = 48/99 (48.48%), Postives = 70/99 (70.71%), Query Frame = 2
Query:  938 NRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILD 1234
            NR I+S  ID +CYL QQEL F G+ E+  S NRGNY+E ++  + ++  L+ HL+ +T++ G S ++QNDLI++IS V+  KI  E+K+T FVSII D
Sbjct:  149 NRYIVSCFIDAICYLAQQELPFRGHLENTESENRGNYLEYLHRRARYDEKLRVHLETSTLLIGTSHDIQNDLIDSISTVMINKIKEEVKQTHFVSIIED 247          

HSP 3 Score: 94.7449 bits (234), Expect = 1.008e-108
Identity = 46/109 (42.20%), Postives = 63/109 (57.80%), Query Frame = 1
Query:  490 MEADNCNCIIEKLFEQSFSSRLFDDKMEIIKNGKSTPFLENLRTRTKKCVRHFSTDKYQKIEWLTGCKSFCAIYCWSCLLYKHEKNVWNGKVGFSDLNNFEKAEKGTQL 816
            ME + C+C IE L +QSFS R F  K  II+ G+  PFL  +   +K  +RHFS   Y    WL GCK   ++YCW CLL+  E+N+W    G SD+ +F   +K  +L
Sbjct:    1 MEDEVCDCAIEDLLKQSFSCRDFATKKRIIETGRPIPFLTKMVKLSKNRLRHFSDSWYNTDLWLCGCKKSSSLYCWPCLLFSTERNMWTTN-GVSDIASFYVLKKRHEL 108          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2J7PE47 (Uncharacterized protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G13112 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 4.592e-108
Identity = 165/462 (35.71%), Postives = 244/462 (52.81%), Query Frame = 1
Query: 1252 QLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSCK-IFQPIIKTCSCI*SIFFSATTKSFSCEWEYNGRLVKTVTRL-QNLKLYFSSIKNQTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHFXXXXXXXXXXQLTSQKR----ELSRKNISQHYKVLINKIGQKMISEMENRFDSLKQIKFIELTDTSQYENFQKQFPVDLINNLKINCMRYFDIQKLETEIKVIFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRRI 2619
            QLA VLRYV+ DG + ERF++F DVS  R A +L +  L  L +     KL+AQ+YDGAAVM+ +  G+QA ++     A FVH  AHRL+LVL +S     + KVF+  +   +  F    K    + S             W+Y+ RL +TV    + ++    SI  +  +  WD +++  A G    L D DF  +L  F+ IFP S  L+ ILQ K  DI++C  KI EFK+ +  L    F+  +  +    +    T  KR     +S +     YK L  +I   +   +  RF     + F+ L D   +  ++  FP    + LK N   +FD   L++E+ V+F D D+      D +  +M    L   F +  KLC+LVLTIP T+A  ER FS++KR+KNY RN +  +RLSSLAL++IEK  L  L+S  +F D VI++F++K+RRI
Sbjct:  258 QLASVLRYVTADGNVEERFLRFTDVSSDRSANSLFNHALEILNDFECGPKLIAQTYDGAAVMASQHAGVQAKIREQYPNAIFVHCYAHRLNLVLAQSASFIKEVKVFFATLSGFRTFFAKSTKRTEALDSHLRKRFPSIAPTRWQYHSRLAETVHEYREGIENLLVSIIEEPEE--WDVETISSARGLLSLLRDFDFNFMLKIFSSIFPYSGALFKILQTKRSDIAFCNTKIDEFKHHMQRLR-GGFDHLWSEMENVFDSNGPTRPKRIRIDSMSGEERKNSYKRLFCEIIDVVCQNVSVRFSENATLLFLSLLDARYFPMYRTSFPEKAFSCLKENYGAFFDFVALKSELLVMFSDPDMAKDSVYD-LHQYMYALQLSCVFPQIFKLCELVLTIPATSAADERSFSALKRLKNYLRNSQNQDRLSSLALMNIEKSFLNKLQSKPSFLDEVIDLFAKKNRRI 715          

HSP 2 Score: 106.686 bits (265), Expect = 4.592e-108
Identity = 48/103 (46.60%), Postives = 78/103 (75.73%), Query Frame = 2
Query:  935 KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDETT 1243
            +NR+ +  LI  VC+LG Q LAF G++ES AS+NRGNYIE++N+L+ ++  L  HL+++T   G S ++QN+LI+++S ++T +I  EI + ++VS+ILDET+
Sbjct:  149 QNRKFVGQLITAVCFLGSQGLAFRGHDESVASVNRGNYIEVLNMLARYDSDLHNHLESSTAFRGSSPDIQNELIHSVSELMTMEIKKEISKANYVSLILDETS 251          

HSP 3 Score: 98.2117 bits (243), Expect = 4.592e-108
Identity = 49/118 (41.53%), Postives = 73/118 (61.86%), Query Frame = 1
Query:  490 MEADNCNCIIEKLFEQSFSSRLFDDKMEIIKNGKSTPFLENLRTRTKKCVRHFSTDKYQKIEWLTGCKSFCAIYCWSCLLYKHEKNVWNGKVGFSDLNNFEKAEK--GTQLQPHIYCV 837
            +  DN +C+IEKL +  FSS  +++K++II+ G   P L  L T+ K C RHF+T  Y+ I WL GC     ++CW CLL+  EK+V+N   G++D+NN  K+ K  G  +  HI C+
Sbjct:    3 LSCDN-HCVIEKLLQTPFSSLSYNEKLKIIEEGAPKPNL-TLHTKVKSCTRHFNTSLYEAIPWLCGCDKLNKLFCWPCLLFSKEKHVFNS-AGYNDINNIYKSGKRHGHSVN-HIACL 116          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2J7Q0R2 (Uncharacterized protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G05761 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 5.696e-108
Identity = 165/462 (35.71%), Postives = 244/462 (52.81%), Query Frame = 1
Query: 1252 QLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSCK-IFQPIIKTCSCI*SIFFSATTKSFSCEWEYNGRLVKTVTRL-QNLKLYFSSIKNQTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHFXXXXXXXXXXQLTSQKR----ELSRKNISQHYKVLINKIGQKMISEMENRFDSLKQIKFIELTDTSQYENFQKQFPVDLINNLKINCMRYFDIQKLETEIKVIFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRRI 2619
            QLA VLRYV+ DG + ERF++F DVS  R A +L +  L  L +     KL+AQ+YDGAAVM+ +  G+QA ++     A FVH  AHRL+LVL +S     + KVF+  +   +  F    K    + S             W+Y+ RL +TV    + ++    SI  +  +  WD +++  A G    L D DF  +L  F+ IFP S  L+ ILQ K  DI++C  KI EFK+ +  L    F+  +  +    +    T  KR     +S +     YK L  +I   +   +  RF     + F+ L D   +  ++  FP    + LK N   +FD   L++E+ V+F D D+      D +  +M    L   F +  KLC+LVLTIP T+A  ER FS++KR+KNY RN +  +RLSSLAL++IEK  L  L+S  +F D VI++F++K+RRI
Sbjct:  258 QLASVLRYVTADGNVEERFLRFTDVSSDRSANSLFNHALEILNDFECGPKLIAQTYDGAAVMASQHAGVQAKIREQYPNAIFVHCYAHRLNLVLAQSASFIKEVKVFFATLSGFRTFFAKSTKRTEALDSHLRKRFPSIAPTRWQYHSRLAETVHEYREGIENLLVSIIEEPEE--WDVETISSARGLLSLLRDFDFNFMLKIFSSIFPYSGALFKILQTKRSDIAFCNTKIDEFKHHMQRLR-GGFDHLWSEMENVFDSNGPTRPKRIRIDSMSGEERKNSYKRLFCEIIDVVCQNVSVRFSENATLLFLSLLDARYFPMYRTSFPEKAFSCLKENYGAFFDFVALKSELLVMFSDPDMAKDSVYD-LHQYMYALQLSCVFPQIFKLCELVLTIPATSAADERSFSALKRLKNYLRNSQNQDRLSSLALMNIEKSFLNKLQSKPSFLDEVIDLFAKKNRRI 715          

HSP 2 Score: 106.686 bits (265), Expect = 5.696e-108
Identity = 48/103 (46.60%), Postives = 78/103 (75.73%), Query Frame = 2
Query:  935 KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDETT 1243
            +NR+ +  LI  VC+LG Q LAF G++ES AS+NRGNYIE++N+L+ ++  L  HL+++T   G S ++QN+LI+++S ++T +I  EI + ++VS+ILDET+
Sbjct:  149 QNRKFVGQLITAVCFLGSQGLAFRGHDESVASVNRGNYIEVLNMLARYDSDLHNHLESSTAFRGSSPDIQNELIHSVSELMTMEIKKEISKANYVSLILDETS 251          

HSP 3 Score: 97.8265 bits (242), Expect = 5.696e-108
Identity = 49/118 (41.53%), Postives = 73/118 (61.86%), Query Frame = 1
Query:  490 MEADNCNCIIEKLFEQSFSSRLFDDKMEIIKNGKSTPFLENLRTRTKKCVRHFSTDKYQKIEWLTGCKSFCAIYCWSCLLYKHEKNVWNGKVGFSDLNNFEKAEK--GTQLQPHIYCV 837
            +  DN +C+IEKL +  FSS  +++K++II+ G   P L  L T+ K C RHF+T  Y+ I WL GC     ++CW CLL+  EK+V+N   G++D+NN  K+ K  G  +  HI C+
Sbjct:    3 LSCDN-HCVIEKLLQTPFSSLSYNEKLKIIEEGAPKPNL-TLHTKVKSCTRHFNTSLYEAIPWLCGCDKLKKLFCWPCLLFSKEKHVFNS-AGYNDINNIYKSGKRHGHSVN-HIACL 116          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000034915.1 (pep primary_assembly:Astyanax_mexicanus-2.0:4:24766423:24768072:-1 gene:ENSAMXG00000029140.1 transcript:ENSAMXT00000034915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 5.111e-72
Identity = 103/309 (33.33%), Postives = 158/309 (51.13%), Query Frame = 1
Query: 1219 VDNTGRNNIFIQLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFY-HFIWSCKIFQPIIKTCSCI*SIFFSATTKSFSCEWEYNGRLVKTV-TRLQNLKLYFSSIKNQTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHFXXXXXXXXXXQLTSQKRELSRKNISQHYKVLINKIGQKMISEMENRF 2139
            VD T   +   QL++VLRYV+ DG I ERF+KF DV+ ++ A  ++++++  LE+     K+VAQ YDGAAVM+    G+QA +K  I  A F+H  AH L+LV+ +   K  +CK+F+ H       F    K    +  I      +     W    RLV TV  +   LK  F+ I     DF  D D++  A G+   L + DF   L  F +IF  ++VL+DILQ K +D+ +C+ K+ EF   I++       EHF+ I             R  +  +   HYK L   I   +++++++RF
Sbjct:  244 VDETTDISNTTQLSLVLRYVTEDG-IKERFVKFEDVTKSKRAHDIAELVMKCLEDFECVGKVVAQCYDGAAVMASGLNGVQAKVKEKIPQALFIHCYAHTLNLVMSQGVAKIRECKIFFSHPTGLAAFFSKSPKRTQLLDEICQKRLPRVAPTRWNLASRLVCTVFEKKDALKDVFNYIVEHHEDF--DHDAIHSADGYLSHLENFDFNFFLVTFKDIFGHADVLFDILQSKSFDMHFCLAKVEEFCTFIEQQ-----REHFDQIYDTTVTETGEPTARR-THTDARAHYKALHGHILDSILNQVQDRF 543          

HSP 2 Score: 101.679 bits (252), Expect = 5.111e-72
Identity = 47/103 (45.63%), Postives = 71/103 (68.93%), Query Frame = 2
Query:  935 KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDETT 1243
            KNR+IL  LID V +LG+QEL F G++E   S N GNY+E+++ L+E++  L  HL  + V +G S  +QNDLIN ++ V+ + I  EIK+  F ++++DETT
Sbjct:  146 KNREILKRLIDCVIFLGKQELPFRGHDEGRVSANLGNYLELLSFLAEYDKDLHYHLSTSKVFTGTSGTIQNDLINVVAEVIGKSIKDEIKDAAFTAVMVDETT 248          

HSP 3 Score: 69.707 bits (169), Expect = 5.111e-72
Identity = 33/100 (33.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  514 IIEKLFEQSFSSRLFDDKMEIIKNGKSTPFLENLRTRTKKCVRHFSTDKYQKIEWLTGCKSFCAIYCWSCLLYKHEKNVWNGKVGFSDLNNFEKAEKGTQ 813
            I+ +L    FS R F++K++I++ G+ TP L+ L    K  VRHF    +++  WLTG      +Y W CLL+    +      GF +L+   KA +  Q
Sbjct:    6 IVSELLTTPFSRRTFNEKVDIVRKGRPTPHLQILTQAGKGYVRHFQASNWERYPWLTGSVQRKKLYYWDCLLFSSSDSSVWSNTGFDNLSCLTKAAQKHQ 105          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000040045.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001233.1:775353:781174:-1 gene:ENSAMXG00000039134.1 transcript:ENSAMXT00000040045.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 3.233e-31
Identity = 123/475 (25.89%), Postives = 209/475 (44.00%), Query Frame = 1
Query: 1225 NTGRNNIFIQLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLE-NETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSCKIFQPIIKTCSCI*SIFFSATTKSFSCEWEYNGRLVKTVTRL---QNLKLYFSSIKNQT---------SDFDWDKDSLI-----LAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHFXXXXXXXXXXQLTSQKRELSRKNISQHYK-------VLINKIGQKMISEM--ENRFDSLKQIKFIELTDTSQYENFQKQFPV--DLINNLKINCMRYFDIQKLETEIKVI--FWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTL 2556
            +  R+    QL++ +RYV+  G I ERF+  + V +  DA+++++ I   L  N   + K VAQ+YDGAAVMSG  GG+QA  +     A +VH  AH L+LVL  +C   ++ + F+  + S   F                     FS     + + V+T TRL   Q   +  SS +             +F    + L+     LA+G    L     + LL  F+ +      L+  LQK+  D++    +  E+KN + + + +K  +          +    + K  +S ++  Q  K       V+ +  G    SE    +  D LKQ       D    E  ++ F V  +L+  ++ +   +++I     E+ V   F+    +     +++L+     D D  F       +  LTIP ++ + ER FS+++R+  + R   G  RL  LA++SIEKELL T+
Sbjct:  170 DEARDGKREQLSLCVRYVTG-GMIKERFLA-LTVLMGFDAESIANTIEQQLALNGIGDLKCVAQTYDGAAVMSGAVGGVQAHFRKKHPEAVYVHCYAHELNLVLCHTCRAISEAREFFEILESVYSF---------------------FSSSLVNHHKFVETQTRLGLQQTELVQLSSTRGACQLRSVNCVLDNFPAIIECLLGINTPLAVGLRVKLCKFSSVYLLVMFHTLLSLCAGLHLYLQKENLDLA----RAMEYKNAVTDSLKEKRSDSTAGELHARALAICDANKLVVSDESSKQRRKTKRMVDYVVESTCGAGAGSEATSSSNADDLKQRLLFPCLDRMLAELEKRFFDVSEELLCGIQASLALHYNIDLKPAEVMVASNFFKRKNETGGDVEDMLAVYKQLDADM-FPTLKATVQAALTIPVSSCSCERSFSALRRLHTWLRRTMGQNRLHHLAVMSIEKELLDTI 616          

HSP 2 Score: 58.151 bits (139), Expect = 3.233e-31
Identity = 32/104 (30.77%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  935 KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLD--NATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDET 1240
            + R+ L  ++ V   LG+Q + F G++ES  S  +G + E   L+ + +P LK +    N T    LSS  QN+++   +  VT  I+ E++E    +I+ DE 
Sbjct:   72 ERREYLKRIVAVTSLLGKQGIPFRGHDESCESHGKGMFAECFKLVQKFDPFLKSYTPPLNTTY---LSSCSQNEMVQCCAEEVTATIVKEMREAQMFAIMADEA 172          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000040801.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000046.1:3031619:3038346:1 gene:ENSAMXG00000043357.1 transcript:ENSAMXT00000040801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 6.780e-31
Identity = 124/502 (24.70%), Postives = 215/502 (42.83%), Query Frame = 1
Query: 1225 NTGRNNIFIQLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLE-NETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSCKIFQPIIKTCSCI*SIFFSATTKSFSCEWEYNGRLVKTVTR--LQNLKL----------YFSSIKNQTSDFDWDKDSLI-----LAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHFXXXXXXXXXXQLTSQKREL------------------SRKNISQHYKVLINKIGQKMISEMENRFDSLKQIKFIELTDTS-QYENFQKQFPVDLINNLKINCMRYFDIQKLETEIKVIFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQ-KDRR 2616
            +  R+    QL++ +RYV+  G I ERF+   ++ +  DA+++++     L  N   + K VAQ+YDGAAVMSG  GG+QA  +     A +VH  AH L+LVL  +C   ++ + F+  + S   F                     FS     + + V+T TR  LQ  +L             S+     +F    + L+     LA+G    L     + LL  F+ +      L+  LQK+  D++    +  E+KN + + + +K  +          +    + K  +                  S  N     + L+     +M++E+E RF  + +     +   S + E F     V L++ L ++     D++  E  +   F+    +     +++L+     D D  F       +  LTIP ++ + ER FS+++R+  + R   G  RL  LA++SIEKELL ++       D VI+ F+  K RR
Sbjct:  253 DEARDGKREQLSLCVRYVTG-GMIKERFLALTEL-MGFDAESIANTTEQQLALNGIGDLKCVAQTYDGAAVMSGAVGGVQAHFRKKHPEAVYVHCYAHELNLVLCHTCRAISEAREFFEILESVYSF---------------------FSSSLVNHHKFVETQTRLGLQQTELVQLSSTRWACQLRSVNCVLDNFPAIIECLLGINTPLAVGLRVKLCKFSSVYLLVMFHTLLSLCAGLHLYLQKENIDLA----RAMEYKNAVTDSLKEKRSDSTAGELHARALAICDANKLRMVDYVVESTCGAGAGSEATSSSNADDLKQRLLFPCLDRMLAELEKRFSDVSEELLCGIQACSPKSEQF---LSVPLLSALALH--YNIDLKPAEVMVASNFFKRKNETGGDVEDMLAVYKQLDADM-FPTLKATVQAALTIPVSSCSCERSFSALRRLHTWLRRTMGQNRLHHLAVMSIEKELLDSISP-----DIVIDRFANLKVRR 716          

HSP 2 Score: 60.077 bits (144), Expect = 6.780e-31
Identity = 33/104 (31.73%), Postives = 56/104 (53.85%), Query Frame = 2
Query:  935 KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLD--NATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDET 1240
            + R+ L  ++ V   LG+Q + F G++ES  S ++G + E   LL + +P LK +    N T    LSS  QN+++   +  VT  I+ E++E    +I+ DE 
Sbjct:  155 ERREYLKRIVAVTSLLGKQGIPFRGHDESCESHDKGMFAECFKLLQKFDPFLKSYTPPLNTTY---LSSCSQNEMVQCCAEEVTATIVKEMREAQMFAIMADEA 255          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000042930.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:25471427:25473738:-1 gene:ENSAMXG00000037442.1 transcript:ENSAMXT00000042930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 1.881e-25
Identity = 40/98 (40.82%), Postives = 65/98 (66.33%), Query Frame = 2
Query:  947 ILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDET 1240
            +L  + DV   L    LAF G+ E    +N GN++ +I+LL+ ++P+L+E LD  + V+ LS ++QN+LI  +S  V ++I+SEIKE +F S+I+D T
Sbjct:   75 VLMRITDVTLTLASCNLAFRGHREKVGELNSGNFLSVIDLLARYDPVLRELLDKKSNVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTT 172          

HSP 2 Score: 57.3806 bits (137), Expect = 1.881e-25
Identity = 43/127 (33.86%), Postives = 64/127 (50.39%), Query Frame = 1
Query: 1252 QLAIVLRYVS-----NDGAIL----ERFIKFIDVSLTRDAKALSDIILTFLE-NETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSCKIF 1602
            QL+ V RYV+      D AI     E F+ F ++S  + A+ L   I   ++ N  L HK   Q YDGA+ MSG   G+Q  + +    A +VH  AH L+LVL  +C+   + K +Y  +    +F
Sbjct:  180 QLSQVFRYVTVRKDEADNAIAVDINESFLGFQNIS-DQTAQGLETKITELIQSNGLLLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVF 305          

HSP 3 Score: 58.5362 bits (140), Expect = 5.885e-8
Identity = 33/72 (45.83%), Postives = 46/72 (63.89%), Query Frame = 1
Query: 2401 KLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRR 2616
            KL LTIP T A+AER FS +K IKNY R+    +RLS LA++SIE +  + +  TE     ++  F+QK+ R
Sbjct:  566 KLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSGLAMLSIESQRSRRMDLTE-----IVKEFAQKNVR 632          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000032220.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:13450075:13452201:1 gene:ENSAMXG00000029800.1 transcript:ENSAMXT00000032220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 2.180e-25
Identity = 68/236 (28.81%), Postives = 117/236 (49.58%), Query Frame = 1
Query: 1252 QLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHK--LVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSCKIFQPIIKTCSCI*SIFFSATTKSFSCEWEYNGRLVKT-----VTRLQNLKLYFSSIKN--QTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCI 1932
            Q+++V+RY  + GA+ E F+ F + +   DA  L+D I+  L++  L ++  LV Q+YDGA+VMSG+  G+QA +K   K A +VH  AH L+LVL  + +   +   F+  +    +F     + S +   + S   + +        RL  T        L+N+     +IK   Q    +   D  + A G    + D  F+V L  F ++F ++++L D+LQ    D+S  +
Sbjct:  171 QISLVVRYYFS-GAVHESFLHF-ESADRLDAAGLTDKIIHILQSHGLEYRDNLVGQAYDGASVMSGKYTGVQARIKEQAKHAFYVHCSAHCLNLVLVDTVKTVPEADQFFSLLERLYVF----TSGSYVHQKWLSVQKEMYEGAPRELQRLSDTRWACRYMSLRNIIDRLPAIKRVLQEIAHEHHGDRSVEARGLLAQI-DLQFIVYLVTFCKVFGETKLLSDMLQSPSLDLSKAV 399          

HSP 2 Score: 63.1586 bits (152), Expect = 2.180e-25
Identity = 31/101 (30.69%), Postives = 64/101 (63.37%), Query Frame = 2
Query:  938 NRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDET 1240
            NR  +  + +V+     Q +A  G+NESA S N+GN++ I+  +++H+  +K+ L +       S  +QN++++ ++++V  KI+ E+K+++  SI++DET
Sbjct:   63 NRDYIKTIAEVLLLTATQNIAQRGHNESADSDNKGNFMAILETIAKHDKTVKKRLTSIHNAKYTSKVIQNEVLSCLADMVRTKIIEEVKDSEVFSIMVDET 163          

HSP 3 Score: 64.3142 bits (155), Expect = 1.179e-9
Identity = 41/95 (43.16%), Postives = 56/95 (58.95%), Query Frame = 1
Query: 2335 EILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRRI 2619
            E+ SFM        F E  KLCK+ ++IP TTA+ ER FS++K +K Y R+    ERLS+L ++SIE    KTL + E F D      + K+RRI
Sbjct:  561 ELASFME--PYKEVFFELYKLCKVAVSIPVTTASCERSFSTLKLVKTYLRSTMTDERLSNLGVLSIESRRAKTL-NLEEFVDLFAR--NHKNRRI 650          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Match: ABI1 (abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:11320])

HSP 1 Score: 51.2174 bits (121), Expect = 2.028e-6
Identity = 24/65 (36.92%), Postives = 43/65 (66.15%), Query Frame = 1
Query: 5245 PVFSDEDYV-QVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 5436
            P ++ + Y+ +V A+YDY   +EDEL+ ++G + Y ++  D+ GW +G  +G+ GL+P NY E +
Sbjct:  386 PPWAPKSYLEKVVAVYDYNKDKEDELSFQEGSIIYVIKKNDD-GWYEGTMNGQTGLFPGNYVEPI 449          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Match: ABI1 (abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:11320])

HSP 1 Score: 49.6766 bits (117), Expect = 5.272e-6
Identity = 23/65 (35.38%), Postives = 41/65 (63.08%), Query Frame = 1
Query: 5245 PVFSDEDYV-QVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 5436
            P ++ + Y+ +V A+YDY+  ++DEL+  +G + Y +   D+ GW +G  +G  GL+P NY E +
Sbjct:  386 PEWAPKIYIEKVVAVYDYVQDKDDELSFHEGSIIYVVRKNDD-GWYEGATNGHTGLFPGNYVEPI 449          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Match: crkl (v-crk avian sarcoma virus CT10 oncogene homolog-like [Source:ZFIN;Acc:ZDB-GENE-040426-2951])

HSP 1 Score: 48.521 bits (114), Expect = 7.022e-6
Identity = 22/58 (37.93%), Postives = 34/58 (58.62%), Query Frame = 1
Query: 5257 DEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAE 5430
            DE    VRAL+D+ G +E++L  K+G++   +   +EQ W    K+GR G+ P  Y E
Sbjct:  129 DESVEFVRALFDFPGNDEEDLPFKRGEILTIVAKPEEQWWSARNKEGRTGMVPVPYVE 186          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Match: stam (signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 [Source:ZFIN;Acc:ZDB-GENE-031118-123])

HSP 1 Score: 49.2914 bits (116), Expect = 7.106e-6
Identity = 21/51 (41.18%), Postives = 35/51 (68.63%), Query Frame = 1
Query: 5272 QVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANY 5424
            +VRALYD+   E++ELT + G++   L+D D   W KG+ +  +GL+P+N+
Sbjct:  214 KVRALYDFEAAEDNELTFRAGEILTVLDDSD-ANWWKGETESGLGLFPSNF 263          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 48.9062 bits (115), Expect = 7.276e-6
Identity = 22/54 (40.74%), Postives = 31/54 (57.41%), Query Frame = 1
Query: 5275 VRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 5436
             RALYDY   ++ E++   GDL   +E  D+  W     DG  G++PANY E+V
Sbjct:  302 ARALYDYQAADDTEISFDPGDLISNIEQIDDGWWNGSGPDGSRGMFPANYVELV 355          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Yeast
Match: LSB3 (Protein containing a C-terminal SH3 domain; binds Las17p, which is a homolog of human Wiskott-Aldrich Syndrome protein involved in actin patch assembly and actin polymerization; protein abundance increases in response to DNA replication stress; LSB3 has a paralog, YSC84, that arose from the whole genome duplication [Source:SGD;Acc:S000002968])

HSP 1 Score: 50.8322 bits (120), Expect = 1.374e-6
Identity = 23/66 (34.85%), Postives = 36/66 (54.55%), Query Frame = 1
Query: 5242 SPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQG-WCKGKKDGRVGLYPANYAEIV 5436
            +P        +  ALY + G E  +L  ++GD+   L+  D Q  W  G+ +GR G++PANY E+V
Sbjct:  394 APTSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV 459          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO42689 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0K6])

HSP 1 Score: 66.6254 bits (161), Expect = 4.714e-11
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 1
Query: 5245 PVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 5436
            P   D+  V V ALYDY   E+DEL+ K G++  KL + D+QGWC+G+ + R GL+PA Y E +
Sbjct:  376 PPPMDDLAVPVLALYDYEAAEDDELSFKAGEIVTKLSERDDQGWCRGRINHRTGLFPAEYVEAL 439          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO40596 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q7])

HSP 1 Score: 51.2174 bits (121), Expect = 4.285e-7
Identity = 34/88 (38.64%), Postives = 51/88 (57.95%), Query Frame = 1
Query: 2365 LDNCFIEYTK----LCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRR 2616
            L NC  E+      L +++ T+  T+A +ER FS+MKR+K Y RN   +ER SSLALIS+     ++L       DA+I+ F+ +  R
Sbjct:   70 LKNCDAEFYPNVHVLLRILCTLSVTSAESERSFSTMKRLKTYLRNTMSTERESSLALISVHYN--RSLD-----VDAIIDTFATRHPR 150          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO40662 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J7])

HSP 1 Score: 54.299 bits (129), Expect = 4.865e-7
Identity = 34/88 (38.64%), Postives = 51/88 (57.95%), Query Frame = 1
Query: 2365 LDNCFIEYTK----LCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRR 2616
            L NC  E+      L +++ T+P T+A +ER FS+MKR+K Y RN   +ER  SLALIS+     ++L       DA+I+ F+ +  R
Sbjct:  221 LKNCDAEFYPNVHVLLRILCTLPVTSAESERSFSTMKRLKTYLRNTMSTEREPSLALISVHYN--RSLDV-----DAIIDTFATRHPR 301          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO38710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC74])

HSP 1 Score: 50.0618 bits (118), Expect = 2.432e-6
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 1
Query: 5254 SDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDE--DEQGWCKGKKDGRVGLYPANYAEIV 5436
            ++E  ++ +  YDY    EDEL LK GD+   ++ E  D  GW +G+ DG+ GL+P N+ EI+
Sbjct:  153 AEEPVLRAKVTYDYEQQNEDELELKVGDIITIVKKEVFDTPGWMEGELDGKTGLFPDNFVEIL 215          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO31290 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYD1])

HSP 1 Score: 49.6766 bits (117), Expect = 4.493e-6
Identity = 23/56 (41.07%), Postives = 32/56 (57.14%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 5436
            V   ALYDY   +++E+T    D+   +E  DE  W     DGR G++PANY EI+
Sbjct:  189 VTATALYDYQQADDNEITFDPDDIITNIEQIDEGWWRGTGPDGRHGMFPANYVEII 244          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000041223.1 (zinc finger MYM-type protein 1 [Source:NCBI gene;Acc:101155882])

HSP 1 Score: 214.157 bits (544), Expect = 2.814e-96
Identity = 148/480 (30.83%), Postives = 251/480 (52.29%), Query Frame = 1
Query: 1219 VDNTGRNNIFIQLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFL-ENETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFI-----------WSCKIFQPIIKTCSCI*SIFFSATTKSFSCEWEYNGRLVKTV-TRLQNLKLYFSSIKNQTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHFXXXXXXXXXXQLTSQKRELSRKNISQHYKVLINKIGQKMISEMENRFDSLKQIKFIELTDTSQYENFQKQFPVDLINNLKINCMRYFDIQKLETEIKVIFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRRI 2619
            V+ T   +   QLA+ LRYV+  G + ERF++F DV+  + A  ++ +++ FL ENE L+ K+VAQ ++GA V S    G+QA +K    LA F+H  AH+LSLVL +   K  +CK+F+  +           W  ++   I +             T +    W+   R+V TV  + + LK  F  I    S++  D+DS+  A GF   L   +F  LL+ FN IF  S++L+ ILQ K  D+ +C+ ++ EF +      +++    +E +             R+    +  +HY+ L   I   +I + + RF   +++ F+ L D  ++  +++ FP   +++L  +    FD  +L+TE+ V++   D   K  +D IL F+   +L     +  +   L LTIP + A+ +R FS+++RI+ +A+N  G  RLS+LAL++IEK+ L  LK   N ++ VI  F +K+RR+
Sbjct:  248 VEETTDASNAAQLALALRYVTRSG-VKERFVRFEDVTSGKRADDIAGLVIKFLLENECLD-KVVAQCFEGATVTSSGLNGVQAKVKESAPLALFIHCYAHQLSLVLSQGASKLKECKIFFAHLNGLVAFFSRSPWRTQLLDEICQR-------RLPGVTPT---PWQSTSRVVNTVFEKREALKELFGHILENHSEY--DEDSVRCADGFKALLDCFEFCFLLHTFNGIFHYSDMLFSILQDKKSDVQFCLDRVKEFCD-----TVERERSRYEGVYEATERAAGAPSARKCHAVDPREHYRQLHGSILDNIICQTQTRFQDHEKMMFVTLLDPLRFLEYRRSFPHAGLSSLARSHGALFDFSQLKTELTVMYTMDDFYGKSPSD-ILHFIHQNNLSEVMKQLYRFVCLALTIPASPASVKRTFSALERIQTHAKNTTGQTRLSALALMAIEKDFLMELKCV-NLHERVIEQFLRKERRM 706          

HSP 2 Score: 102.064 bits (253), Expect = 2.814e-96
Identity = 50/106 (47.17%), Postives = 72/106 (67.92%), Query Frame = 2
Query:  926 KSLKNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDETT 1243
            K  KNR+IL  LID V +LG+QEL+F G +ES  S NRGNY E++++++E N  L  HL      SG S  +Q+DLI+AI  V+ ++I  E+K   FVS++++ETT
Sbjct:  147 KVKKNREILKRLIDCVLFLGKQELSFRGRDESGGSSNRGNYCELLSVIAESNTDLHYHLSTNEAFSGTSGKIQDDLISAIDEVIRDEIRREVKNAPFVSVMVEETT 252          

HSP 3 Score: 80.4925 bits (197), Expect = 2.814e-96
Identity = 37/101 (36.63%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  514 IIEKLFEQSFSSRLFDDKMEIIKNGKSTPFLENLRTRTKKCVRHFSTDKYQKIEWLTGCKSFCAIYCWSCLLYKHEKN-VWNGKVGFSDLNNFEKAEKGTQ 813
            ++  L  + FS R   +K++I+K G+ TP L +L       VRHF    Y++  WLTG +  C +YCW CLL+  +++ VW+   GF +L    KA K  Q
Sbjct:   10 LVADLISRPFSRRTLQEKLDIVKKGRVTPALTSLSQPGGGFVRHFQVTNYERYPWLTGSEVHCKLYCWECLLFALDRHGVWS-HTGFGNLTCLTKAAKKHQ 109          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 2.664e-21
Identity = 45/107 (42.06%), Postives = 68/107 (63.55%), Query Frame = 1
Query: 1219 VDNTGRNNIFIQLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHK--LVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVL 1533
            VD T   +   Q++ V+RY  N G++ E F+ F + +   +A ALS  I+  L+   L++K  LV Q+YDGA+VMSG++ G+QA +K+   LA +VH  AH L+LVL
Sbjct:  317 VDETKDMSKKEQMSFVIRYYYN-GSVCECFLAF-EAAQRLNAAALSQKIIEILQKHGLDYKNHLVGQAYDGASVMSGKNTGVQARIKSEAPLAFYVHCNAHCLNLVL 421          

HSP 2 Score: 54.299 bits (129), Expect = 2.664e-21
Identity = 28/101 (27.72%), Postives = 59/101 (58.42%), Query Frame = 2
Query:  938 NRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDET 1240
            NR+ +  + + +     Q +A  G+ ES    ++GN++ I+ LL+++NP++K  +      + L  + QN++I+ ++ +V   I  E+ E++  SI++DET
Sbjct:  221 NREYIKVVGETLLLTATQNIAQRGHKESEVD-SKGNFLAIMELLAKNNPIVKRKMAGQRNATCLGHDTQNEMIDCLAEMVRSSITGEVAESEAFSILVDET 320          

HSP 3 Score: 51.9878 bits (123), Expect = 6.708e-6
Identity = 30/85 (35.29%), Postives = 51/85 (60.00%), Query Frame = 1
Query: 2371 NCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQK--DRRI 2619
            +CF    KLCK+ L +P +TA+ ER FS++K IK   R+    ERLS+L ++S+E    + +       D  +++F++K  +RR+
Sbjct:  582 HCF----KLCKVALALPVSTASCERSFSTLKLIKTALRSTISDERLSNLGVLSVESRRARAIN-----LDDFVDVFAKKHSNRRV 657          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons protein 1 [Source:NCBI gene;Acc:101158350])

HSP 1 Score: 81.6481 bits (200), Expect = 2.219e-15
Identity = 39/57 (68.42%), Postives = 46/57 (80.70%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E+DELT K G+   KLEDEDEQGWCKG+ D G++GLYPANY E +
Sbjct:  387 VRVRALYDYEGQEQDELTFKAGEELTKLEDEDEQGWCKGRLDNGKLGLYPANYVEAI 443          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: pacsin1b (protein kinase C and casein kinase substrate in neurons protein 1 [Source:NCBI gene;Acc:101158350])

HSP 1 Score: 81.6481 bits (200), Expect = 2.219e-15
Identity = 39/57 (68.42%), Postives = 46/57 (80.70%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKD-GRVGLYPANYAEIV 5436
            V+VRALYDY G E+DELT K G+   KLEDEDEQGWCKG+ D G++GLYPANY E +
Sbjct:  387 VRVRALYDYEGQEQDELTFKAGEELTKLEDEDEQGWCKGRLDNGKLGLYPANYVEAI 443          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: si:ch211-51c14.1 (protein kinase C and casein kinase substrate in neurons protein 3 [Source:NCBI gene;Acc:101165059])

HSP 1 Score: 80.4925 bits (197), Expect = 3.376e-15
Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 1
Query: 5269 VQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRV-GLYPANYAEIV 5436
            V+VRALYDY+G E DEL+ K G+ F K+EDED+QGWC+G KDG   GLYPANY E+V
Sbjct:  332 VRVRALYDYVGQETDELSFKAGEEFLKIEDEDDQGWCRGMKDGGWEGLYPANYVEVV 388          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000054559.1 (SMESG000054559.1)

HSP 1 Score: 143.28 bits (360), Expect = 1.029e-35
Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
Query: 5236 RESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 5436
            RESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV
Sbjct:  384 RESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 450          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000054559.1 (SMESG000054559.1)

HSP 1 Score: 142.124 bits (357), Expect = 5.086e-35
Identity = 66/67 (98.51%), Postives = 67/67 (100.00%), Query Frame = 1
Query: 5236 RESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 5436
            +ESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV
Sbjct:  428 KESPVFSDEDYVQVRALYDYIGVEEDELTLKQGDLFYKLEDEDEQGWCKGKKDGRVGLYPANYAEIV 494          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000069312.1 (SMESG000069312.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.186e-21
Identity = 41/109 (37.61%), Postives = 63/109 (57.80%), Query Frame = 2
Query:  935 KNRQILSWLIDVVCYLGQQELAFCGNNESAA---SINRGNYIEIINLLSEHNPLLKEHLDNAT----VVSGLSSNVQNDLINAISNVVTEKILSEIKETDFVSIILDET 1240
            K R +L  L+  V +L  Q LA  G+ ES A   S N GN++  + LL+E++PLL  H+D+A      VS LS   QN+ I+ +++ V  K+L++IK   +  I+ D T
Sbjct:  265 KWRDVLKRLLSCVKFLASQNLALRGHAESLATNNSSNVGNFLATLKLLAEYDPLLSNHIDHARQNPGSVSYLSPQTQNESISLLASKVRNKLLNDIKRNKYYGILFDST 373          

HSP 2 Score: 57.7658 bits (138), Expect = 1.186e-21
Identity = 67/257 (26.07%), Postives = 111/257 (43.19%), Query Frame = 1
Query: 1261 IVLRYV----SNDG-AILERFIKFIDVSLTRDAKALSDIILTFLENETLN-HKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKENQCKVFYHFIWSCKI-FQPIIKTCSCI*SIFFSATTKSFSCEWEYNGRLVKT----VTRLQNLKLYFSSIKNQTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITEFKNMIDELMIQKFEEHF 1998
            + +RYV    SN    I E F+ FI++   +DA  L  +I   LE + L      +Q YD AA+MSG   GLQ  + N    A FV+   H L+L    S +++     F+  I S  + F       + + ++  +   +     W      VK     V  +  L   FS+  +QT D   D + L+  I       D +FLVLL+F+++I  + + +   LQ    +       +   +  ++E+  +  EE F
Sbjct:  385 VSMRYVNVYFSNKTVTIKESFLGFIELH-AKDAATLEHVIADTLEADNLRLDDCRSQCYDNAALMSGHISGLQQRICNRNPRAIFVNCNNHSLNLAGMHSAKQDAVAVTFFRTIKSIYLYFSRSTLRWNELKNVISNTVKRECETRWSARADAVKAVHNGVNEIVGLLEIFSADNSQTQDTRADAERLLANI------LDFNFLVLLHFWHQILGKIDRVQKRLQDPTVNFGEAASDLQSLELHLNEVRSELCEEAF 634          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 64.3142 bits (155), Expect = 3.564e-18
Identity = 123/509 (24.17%), Postives = 210/509 (41.26%), Query Frame = 1
Query: 1216 CVDNTGRNNIFIQLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKE--------NQCKVFYHFIWSCKIFQPIIKTCSCI*SIFFSATTKSFS-CEWEYNGRLVKTVTRLQN--LKLYFS--SIKNQTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITE-------------FKNMI---DELMIQ-KFEEHFXX---XXXXXXXXQLTSQKRELSRKNISQHYKV-LINKIGQKMISEMENRFDSLKQI--------KFIELTDTSQYENFQKQFPVDLINNLKINCMRYFDIQKLETEIKVIFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRR 2616
            C  +TG      Q+ +V+RYV         +IK  +V L      +SD              +  Q YD  + MSG+  GLQ  + +    A F+   AH L+L +  +            N   V+  F  S   +Q + K          S T K  S   WE     +K +  L+N   ++Y S   I  ++S      ++  LA     +     F+  +  + EI  + + +  ++QK  ++IS C   I E             F+N +   +EL +  + E  F     +    +  Q + ++ E  +    +H+++   N I    IS +  RF++L           KFI++    ++E  +K    DL N  K       DI  +E   +++     IK++   +E++ F+   +L+  F       KL+LT+P   A+ ER FS +K IKN+ R     E LS++++I+IE E    +  + N   AV    S+K RR
Sbjct:  355 CTPDTGH---VEQITMVIRYV---------YIKNYEVELNYLELNISD--------------MRGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNVK-------SLTLKQVSETRWEAR---IKAIRPLRNELGEIYDSLIEIAEESSMPTVRHEAECLANKLKSY----KFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLQISNELCVALETEPDFPAEISVRSRHHRKQFSYERDEDIQFTPKEHFQISFFNVILDTAISSLTTRFETLSGFERCFGFLYKFIDM----EHEEIKKSC-FDLHNKFKDG--ESCDISGVELYQELVSLKIIIKDRKQPEELIKFLYKYNLETSFPNVATSLKLLLTVPVFVASGERSFSKLKIIKNHLRTSMTQECLSNISIIAIENE----IADSTNIEGAVEEFASKKSRR 812          

HSP 2 Score: 48.9062 bits (115), Expect = 3.564e-18
Identity = 29/108 (26.85%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  944 QILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNV--------QNDLINAISNVVTEKILSEIKETDFVSIILDETT 1243
            QI+  +I VV +L  Q LAF G++      N GN+++ I ++ + +  + +H+      +   +++        QN++I  ++  + + IL+ IKE  + S+ILD T 
Sbjct:  250 QIVKRMISVVQFLAGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDTMADHIKRVQEPNAPKNHMPHYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTP 357          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 63.929 bits (154), Expect = 4.600e-18
Identity = 123/509 (24.17%), Postives = 210/509 (41.26%), Query Frame = 1
Query: 1216 CVDNTGRNNIFIQLAIVLRYVSNDGAILERFIKFIDVSLTRDAKALSDIILTFLENETLNHKLVAQSYDGAAVMSGESGGLQALLKNVIKLANFVHYLAHRLSLVLQKSCEKE--------NQCKVFYHFIWSCKIFQPIIKTCSCI*SIFFSATTKSFS-CEWEYNGRLVKTVTRLQN--LKLYFS--SIKNQTSDFDWDKDSLILAIGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDILQKKIYDISYCIRKITE-------------FKNMI---DELMIQ-KFEEHFXX---XXXXXXXXQLTSQKRELSRKNISQHYKV-LINKIGQKMISEMENRFDSLKQI--------KFIELTDTSQYENFQKQFPVDLINNLKINCMRYFDIQKLETEIKVIFWDSDIKNK*YADEILSFMSNCDLDNCFIEYTKLCKLVLTIPPTTATAERVFSSMKRIKNYARNKRGSERLSSLALISIEKELLKTLKSTENFYDAVINIFSQKDRR 2616
            C  +TG      Q+ +V+RYV         +IK  +V L      +SD              +  Q YD  + MSG+  GLQ  + +    A F+   AH L+L +  +            N   V+  F  S   +Q + K          S T K  S   WE     +K +  L+N   ++Y S   I  ++S      ++  LA     +     F+  +  + EI  + + +  ++QK  ++IS C   I E             F+N +   +EL +  + E  F     +    +  Q + ++ E  +    +H+++   N I    IS +  RF++L           KFI++    ++E  +K    DL N  K       DI  +E   +++     IK++   +E++ F+   +L+  F       KL+LT+P   A+ ER FS +K IKN+ R     E LS++++I+IE E    +  + N   AV    S+K RR
Sbjct:  355 CTPDTGHVE---QITMVIRYV---------YIKNYEVELNYLELNISD--------------MRGQGYDNGSNMSGKHRGLQKRILDNYPRALFMPCNAHTLNLAINDAANVSFSTVDFFSNVSAVYNFFSASPFRWQVLKKNVK-------SLTLKQVSETRWEAR---IKAIRPLRNELGEIYDSLIEIAEESSMPTVRHEAECLANKLKSY----KFISSIIIWYEILEKVDFISKMMQKVSWNISSCAESIKEVLKFFKSIRNDESFENYLQISNELCVALETEPDFPAEISVRSRHHRKQFSYERDEDIQFTPKEHFQISFFNVILDTAISSLTTRFETLSGFERCFGFLYKFIDM----EHEEIKKSC-FDLHNKFKDG--ESCDISGVELYQELVSLKIIIKDRKQPEELIKFLYKYNLETSFPNVATSLKLLLTVPVFVASGERSFSKLKIIKNHLRTSMTQECLSNISIIAIENE----IADSTNIEGAVEEFASKKSRR 812          

HSP 2 Score: 48.521 bits (114), Expect = 4.600e-18
Identity = 29/108 (26.85%), Postives = 57/108 (52.78%), Query Frame = 2
Query:  944 QILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEHNPLLKEHLDNATVVSGLSSNV--------QNDLINAISNVVTEKILSEIKETDFVSIILDETT 1243
            QI+  +I VV +L  Q LAF G++      N GN+++ I ++ + +  + +H+      +   +++        QN++I  ++  + + IL+ IKE  + S+ILD T 
Sbjct:  250 QIVKRMISVVQFLAGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDTMADHIKRVQEPNAPKNHMPHYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTP 357          
The following BLAST results are available for this feature:
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PACSIN24.967e-1568.42protein kinase C and casein kinase substrate in ne... [more]
PACSIN24.967e-1568.42protein kinase C and casein kinase substrate in ne... [more]
PACSIN24.967e-1568.42protein kinase C and casein kinase substrate in ne... [more]
PACSIN25.470e-1568.42protein kinase C and casein kinase substrate in ne... [more]
PACSIN25.470e-1568.42protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sdpn-14.027e-744.90SynDaPiN (Synaptic dynamin binding protein) homolo... [more]
sdpn-14.162e-744.90SynDaPiN (Synaptic dynamin binding protein) homolo... [more]
sdpn-14.162e-744.90SynDaPiN (Synaptic dynamin binding protein) homolo... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Synd5.449e-1975.00gene:FBgn0053094 transcript:FBtr0083966[more]
Synd5.533e-1975.00gene:FBgn0053094 transcript:FBtr0334725[more]
Synd5.533e-1975.00gene:FBgn0053094 transcript:FBtr0334724[more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR762475.11.621e-2641.67pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
pacsin1b2.631e-1665.15protein kinase C and casein kinase substrate in ne... [more]
pacsin1b2.631e-1665.15protein kinase C and casein kinase substrate in ne... [more]
pacsin1b2.631e-1665.15protein kinase C and casein kinase substrate in ne... [more]
pacsin23.056e-1563.33protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000043220.11.124e-3025.90pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
cdk44.944e-1566.67cyclin-dependent kinase 4 [Source:Xenbase;Acc:XB-G... [more]
PACSIN13.442e-1466.67protein kinase C and casein kinase substrate in ne... [more]
PACSIN14.114e-1466.67protein kinase C and casein kinase substrate in ne... [more]
PACSIN14.153e-1466.67protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pacsin29.122e-1768.42protein kinase C and casein kinase substrate in ne... [more]
Pacsin26.833e-1668.42protein kinase C and casein kinase substrate in ne... [more]
Pacsin23.959e-1568.42protein kinase C and casein kinase substrate in ne... [more]
Pacsin23.959e-1568.42protein kinase C and casein kinase substrate in ne... [more]
Pacsin23.959e-1568.42protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07839|EG13_ECHGR5.944e-1779.59Antigen EG13 OS=Echinococcus granulosus OX=6210 GN... [more]
sp|Q07840|EM13_ECHMU6.562e-1779.59Antigen EM13 OS=Echinococcus multilocularis OX=621... [more]
sp|Q4V920|PACN1_DANRE1.986e-1565.15Protein kinase C and casein kinase substrate in ne... [more]
sp|Q9UNF0|PACN2_HUMAN2.386e-1468.42Protein kinase C and casein kinase substrate in ne... [more]
sp|Q9WVE8|PACN2_MOUSE2.769e-1468.42Protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
X1WND41.021e-11935.08Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A2S2NR696.886e-11036.96Zinc finger MYM-type protein 1 OS=Schizaphis grami... [more]
A0A067R6331.008e-10834.60Zinc finger MYM-type protein 1 OS=Zootermopsis nev... [more]
A0A2J7PE474.592e-10835.71Uncharacterized protein OS=Cryptotermes secundus O... [more]
A0A2J7Q0R25.696e-10835.71Uncharacterized protein OS=Cryptotermes secundus O... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034915.15.111e-7233.33pep primary_assembly:Astyanax_mexicanus-2.0:4:2476... [more]
ENSAMXT00000040045.13.233e-3125.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000040801.16.780e-3124.70pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042930.11.881e-2540.82pep primary_assembly:Astyanax_mexicanus-2.0:12:254... [more]
ENSAMXT00000032220.12.180e-2528.81pep primary_assembly:Astyanax_mexicanus-2.0:24:134... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABI12.028e-636.92abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:1132... [more]
ABI15.272e-635.38abl interactor 1 [Source:HGNC Symbol;Acc:HGNC:1132... [more]
crkl7.022e-637.93v-crk avian sarcoma virus CT10 oncogene homolog-li... [more]
stam7.106e-641.18signal transducing adaptor molecule (SH3 domain an... [more]
DBNL7.276e-640.74drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LSB31.374e-634.85Protein containing a C-terminal SH3 domain; binds ... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO426894.714e-1146.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405964.285e-738.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406624.865e-738.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387102.432e-639.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312904.493e-641.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041223.12.814e-9630.83zinc finger MYM-type protein 1 [Source:NCBI gene;A... [more]
ENSORLT00000027735.12.664e-2142.06pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
pacsin1b2.219e-1568.42protein kinase C and casein kinase substrate in ne... [more]
pacsin1b2.219e-1568.42protein kinase C and casein kinase substrate in ne... [more]
si:ch211-51c14.13.376e-1566.67protein kinase C and casein kinase substrate in ne... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054559.11.029e-35100.00SMESG000054559.1[more]
SMESG000054559.15.086e-3598.51SMESG000054559.1[more]
SMESG000069312.11.186e-2137.61SMESG000069312.1[more]
SMESG000061124.13.564e-1824.17SMESG000061124.1[more]
SMESG000061124.14.600e-1824.17SMESG000061124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008591 ID=SMED30008591|Name=Zinc finger MYM-type protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5596bp
AGGCACCTTAATTTTGTACGGTTTAAACCGTACAAAATTACCTTTTTTTC
ATACGATATGATTAATTCCATTATGGTTGTGTTCAATTTGCATGAGTTTT
GACAGTAATTAATCAAAATTAAATGAAATGAACGGAAAAAAAACAAAAAA
AACGTTAGTTGTTAATTTTGTTTAAGGCTATTGTGGTCACCGCTAAAGTG
ATACAATTTATTCTAATAAGTATATTTTGGTTTTCTCATATGCAAGGAAT
CAATTTTAAAATTACTTCCAGTTTTGAGTTAATAGGAAAAATAAATTTCG
CAGGGTAGTTTTATTTTAATTTTTTGTAGCAATCGTGATTCATGTCGGTT
TATGTTTTAATTGTTATTTATTGTTATTCATATTTTAAAAGTTAAATTGA
TTTTGGTAAGCATTTTGAATATTCTGCAAATAATATTATAAACTAAATAT
CATCCCTTATTTAACAGAACTTTATTGAATAAAAGTAATATGGAGGCTGA
TAACTGCAACTGCATAATAGAAAAGTTATTTGAGCAATCATTTAGTTCAA
GATTGTTTGATGATAAAATGGAAATAATTAAGAATGGCAAGTCAACACCA
TTTTTGGAAAATTTAAGAACCAGAACAAAAAAATGTGTCCGACATTTTTC
AACAGATAAGTATCAAAAAATTGAATGGTTAACAGGGTGCAAATCATTTT
GTGCCATATATTGTTGGTCATGTTTGTTATATAAACATGAGAAAAATGTA
TGGAATGGCAAAGTTGGGTTTTCTGATTTAAATAATTTTGAAAAGGCGGA
AAAAGGCACGCAGCTTCAGCCTCACATCTACTGTGTATGATTGCTTTGAA
AAAATTTGGCACACGACAGAAAATTGAGAATCAAATGGATGCAATGAGAA
AAATTTCTGTGCATCAGTTTAATGAAAAAGTTTAAAAAATAGACAGATCC
TTAGTTGGTTAATTGATGTCGTGTGCTATCTAGGACAACAGGAATTGGCC
TTTTGTGGAAATAATGAATCAGCAGCTTCAATTAACAGAGGAAATTACAT
TGAAATCATAAATTTACTTTCTGAACATAATCCGCTTTTAAAAGAACATT
TAGATAATGCCACTGTTGTTTCCGGATTATCAAGTAATGTTCAGAATGAT
CTAATCAATGCTATTTCTAACGTAGTGACTGAAAAAATATTGAGTGAGAT
TAAAGAAACCGATTTTGTGTCGATAATACTGGACGAAACAACATATTCAT
TCAGTTAGCAATTGTTTTAAGATATGTTTCAAATGACGGTGCCATTTTAG
AACGATTCATTAAATTTATAGATGTGTCATTAACTCGAGATGCTAAAGCT
TTATCGGATATTATTTTGACCTTTTTGGAGAATGAAACATTAAATCACAA
ATTAGTAGCTCAGAGTTACGATGGCGCTGCAGTAATGTCAGGTGAATCAG
GAGGGCTTCAAGCGTTATTAAAAAATGTTATCAAATTAGCCAATTTCGTT
CACTACCTAGCTCACAGGCTAAGTTTGGTATTGCAGAAATCATGCGAAAA
GGAAAATCAATGCAAAGTTTTTTACCACTTTATCTGGTCTTGCAAGATTT
TTCAACCAATCATCAAAACGTGTAGCTGCATCTGATCAATATTCTTCTCA
GCGACTACCAAAAGTTTCTCCTGCGAGTGGGAGTACAATGGAAGGCTTGT
AAAAACTGTTACTCGCTTACAGAATCTCAAATTATATTTCTCATCTATTA
AAAATCAAACATCCGATTTTGATTGGGATAAAGATAGTCTTATTTTAGCT
ATTGGGTTCTCGCAGTTCTTATATGATCCAGATTTTTTAGTGCTACTATA
CTTCTTCAACGAAATTTTTCCACAATCTGAAGTTTTATACGATATATTAC
AAAAAAAGATCTATGACATATCCTACTGTATTCGAAAAATTACAGAGTTT
AAAAATATGATAGATGAGTTAATGATTCAGAAATTCGAAGAACATTTTGA
AATAATTAACTTGGAGCTCAATATTCTACAACTAACATCGCAAAAAAGAG
AACTTTCTAGGAAAAATATTTCACAGCATTATAAAGTATTAATTAATAAA
ATTGGGCAAAAAATGATTTCAGAAATGGAAAATCGCTTTGATTCATTGAA
ACAAATTAAATTCATTGAATTAACTGATACCAGCCAATATGAAAATTTTC
AAAAACAATTTCCTGTGGACCTTATAAACAACTTAAAAATTAATTGTATG
CGATATTTTGATATTCAAAAGCTTGAAACTGAAATCAAAGTTATATTTTG
GGATTCAGACATTAAGAACAAATAATATGCTGATGAAATTCTTAGCTTTA
TGTCGAATTGTGACTTAGACAATTGTTTTATTGAATATACAAAACTTTGT
AAGCTCGTGTTAACAATTCCACCAACAACAGCAACAGCAGAACGCGTTTT
CTCAAGTATGAAAAGAATTAAAAATTACGCTCGCAACAAAAGGGGATCGG
AAAGATTAAGTTCATTGGCCTTAATTTCAATAGAAAAGGAACTACTTAAG
ACACTTAAATCCACAGAAAATTTTTATGATGCCGTAATTAATATATTTTC
CCAAAAGGACAGAAGAATTTTTTTTAAATATAAGTACTAGTTATTAACTA
AAAAAATGCAATAAAATTTCATTTGTTTAAAAAAACTTTAAATATTATTT
TCAACTCCTAGGTCCTACATTTTCAGTAACTTGGTCTGTGAATTCTTTTT
TCCAAAATGATTTAATAGGTTGCTTCCCAAAAATAAAATTTCACGCCTCG
TCACTGATATATATGTATGTGTTTGAATGGCGCCTCGATGATAATTTTAT
GTAGAATGGATAAATTTATTTTTTCTCGCTATTATTCATTGTTTTTTGAG
TTGAAAGTTATTTTCATTTATTTTTGAGAATTTTAGAGAATATGAGCGTT
TCATAAGATCTAAAGTTTTCTTTTTGCAAATTGGTGTGTTTATTTTACCT
ATATTCAAAATCAGTATATTTTATTTGAATCGTTGAAAATTATTAAAAAC
AATTATTAGTAAATTTTTTAGTGAAGGTTTTATATAACAATCAGCTCGCA
GAGAAAATTAGAATTCTAAATTGACAAAACGTTTATAATAATTTTTTTTC
TACTTTTATTAATAATTCAGCTTATACATGTAGAAATAGTATTTTCAAAT
ATTAATGATTTCTAAAGTATTGAGAAATTGAGATTAAACATAGACACCTT
ATAAGAAGTAAGTTCAGTCAAGGCTTTTTTAAATGTTTAAAGGATGGTAC
ATTATTAAAAAAATAGTCGATATTCAAATAAATGGCTTATCTTCGTTAAC
CCTCTAATACGCGTGTACGCCCACCTCAAGGTGGACTATACGATGGCGCT
AATTTAGTGCTCAAATAATTTGTCTTGCTTTTTAATGCATCAGAGCGACT
ACAGGCAAGATTACCACTATACAACGATGGATGAAAGGTTGTGACAACAT
TCATAGTTTTCCTTTAACAGCCAGTTGAGTTTTAATTTCATATAAATACA
GAAGAAAATTCATATTAAATTAAAAAAAAGATTAGTAAAAATAATCATAA
ACATTACTCAATCCGAAAATTGCATTTGACCAGTGTACTCGCGTTAAGGA
ACTTCGCAAATGAACCATGAACATGTGAAATTGAATAATAACCTTAAAGT
TCCATTTAATTGAGTCTTCATTGCTTGATCTTATTAAGGAAACCCAGAAA
TAGATTTTAAAAACAAAATTCCACGACTAACAGGGGTTAATTTCTTTAGG
AATTTTATTTTCCGTGAATTAAGTATAATAAATTTCACTATAAAACTGTA
TAAAATATTTTGTTATCTAAAAAATCTACCTAAAGCATTGCAGCATGGTA
AATATTGAAGTTGTGATAAAACAGCATAGTATTTCGCCTTTTTTATTGTT
TTTAATATTATGTTTGAGACCTGAGAGATGAAATGTTAAATCAAATGTTT
TCCTGGGCTAAGTAAAAATGATTTTTTTTTTGCAAAGATTTTCTTAAACA
TTAAGGAAAAGTAAATGAAATTCTTTTATCTCTATCTTGAATGCAATCTC
TTCTTTGGAAACCCCTGTTTAGCATGGCCTTATATTCGCCTGTTTATGGA
GGATGGGGAGATAAGTTTTATTTTTTTAACAAAATTTTAGGATATTGGTA
ATGGTGGCATGCTATTGGATTTTGTTGGGTGTAAAAATGGTTTTCCTGAA
TCTCAAACCTCATCACCTTCAATTATAAGTTTTGATTTCTATATAATTTA
CCATGATTTTATCGACAAGAACCATCAATTTCAATAGTTTCAGGTACTAA
AATTAATTTTATTTTTAATCTACCATGGAAACCGAATGATAGTGGTAACT
ATCATGTAGAAAATGATGCCACGGAAATTTAGACTATGTATTAATAAAAA
AGAGATTCGAGTCCATTGAGGTCATAAAAGAGAATGTAACGAAGGAGCTG
AAGGCCCTCTCTCCGATGGCCTATGCAAAGTGCATGGATGACTGGATCAA
GCGTTGGCACATTTAGTATGAAAGAGTTGAAATCGTAAATTTTTTCTAAT
GTCAAAAGGTAATCTTCAAAAACTATGTGTAGATGTACATTTTGGTATAC
AAAATATAATTTAAGCGTATGAGAGAAATTTCGAACATTTATTTTAATTA
TGATATTTGAAATGTAAATATACATAATTTCATAAACACCGCTGAAAAAA
TTTTTTCCTAAATATAAACAAATTTATAATAATAATACTCTTAAGGATTG
GCTGTTATTGACAGGGGAGGTAACTTATGGAAGCAAGGTGGATAGGACTT
GCAAACAAATTACATCGCAAAGAGATTTGTTTAACTTGCATGCTCTATAT
TTATAAGAAGACTTTCTAGCACTCTGCAAATTGGTTGGATAAATCAATTG
GATCCAATCAAATGAAAAAAATTGAATGAAACGAACCGCAGAAAACCGGA
GTTACCTTTGGACAAAATATCATAATTCGCTAATAATATCCCTTACAAGT
TAAGTATAAAAAGATTATTCCGCTATTAGTTTTAAAAAATCTTCATTTAT
CCATCCTCTATTACAAATAAATTCCTTGGGCAGTTTATAATTTTTTTCGA
AAGTTATTTCTAAATTTAACTCTAATATGTTTGGTTTATTTTTTTAATAT
TCTGAAATTTGTTTTAATTTCATTATTCGTTTTTTAGAGAATCTCCCGTG
TTTTCCGATGAAGACTATGTGCAAGTTCGAGCACTTTATGACTATATCGG
TGTTGAAGAAGACGAATTGACTTTGAAACAAGGTGATCTATTCTATAAGC
TTGAAGATGAAGACGAGCAAGGTTGGTGCAAAGGCAAAAAAGACGGTAGG
GTCGGTCTATATCCAGCGAATTATGCGGAAATAGTTTAAATTCTTGTTAA
ACAAGTCATTATTTTTTAGTTTTTGTTATTTAACACATTTTTGTTGAACT
TCTATTACTGAATTGACTCTATCTCTCTCCTTGTATATATATAAAATAGA
GTAGTAAGACGTGTATTATTTAGCTAACAATGTTATAGTGTTGTTT
back to top

protein sequence of SMED30008591-orf-1

>SMED30008591-orf-1 ID=SMED30008591-orf-1|Name=SMED30008591-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MIDELMIQKFEEHFEIINLELNILQLTSQKRELSRKNISQHYKVLINKIG
QKMISEMENRFDSLKQIKFIELTDTSQYENFQKQFPVDLINNLKINCMRY
FDIQKLETEIKVIFWDSDIKNK*
back to top

protein sequence of SMED30008591-orf-2

>SMED30008591-orf-2 ID=SMED30008591-orf-2|Name=SMED30008591-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MEADNCNCIIEKLFEQSFSSRLFDDKMEIIKNGKSTPFLENLRTRTKKCV
RHFSTDKYQKIEWLTGCKSFCAIYCWSCLLYKHEKNVWNGKVGFSDLNNF
EKAEKGTQLQPHIYCV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001452SH3_domain
IPR025398DUF4371
IPR008906HATC_C_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0046983protein dimerization activity
GO:0008289lipid binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005768endosome
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0030054cell junction
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0032587ruffle membrane
GO:0042995cell projection
GO:0043005neuron projection
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0007015actin filament organization
GO:0030100regulation of endocytosis
GO:0048666neuron development
GO:0048812neuron projection morphogenesis
GO:0060088auditory receptor cell stereocilium organization
GO:0097320plasma membrane tubulation