Guanylate cyclase domain-containing protein

Overview
NameGuanylate cyclase domain-containing protein
Smed IDSMED30008588
Length (bp)2228
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanylate cyclase domain-containing protein (SMED30008588) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanylate cyclase domain-containing protein (SMED30008588) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008588

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30008588 SmedASXL_007752SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008588 SmedASXL_000341SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008588 dd_Smed_v6_29743_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30008588 SMED30008588smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30008588 OX_Smed_1.0.12193ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 362.459 bits (929), Expect = 3.218e-115
Identity = 228/620 (36.77%), Postives = 345/620 (55.65%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFS-IDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            M G ++  ++ LV+   G E WE I + A  D    FLV   Y DS  ++L+ A +  LNL   E L+ FGK FF + +  GY  ++  LG ++R FL+NLDALH++ A     M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I      N E    Q ++   +SK E  Y    +LD+     F      +S ++        P+HIIFD  L V Q G  + ++   L  +  +  LLS + SL+ P +      I   IN+ F       LL          LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN LY+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  E RG V +KGK   M+ +FL
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQ---RNEECDHTQFLIEEKESKEEDFY---EDLDR-----FEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQL--QPGNCSLLS-VFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFL 604          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 348.977 bits (894), Expect = 7.033e-110
Identity = 224/642 (34.89%), Postives = 344/642 (53.58%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLE----------------------NLDALHEYFAVTQKSMIAPSF-SIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            M G ++  ++ LV+   G E WE I + A  D    FLV   Y DS  ++L+ A +  LNL   E L+ FGK FF + +  GY  ++  LG ++R FL+                      NLDALH++ A     M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I    +    ++F      +I+ K   +     +LD+     F      +S ++        P+HIIFD  L V Q G  + ++   L  +  +  LLS + SL+ P +      I   IN+ F       LL          LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN LY+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  E RG V +KGK   M+ +FL
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQKNESKHISDLHHCFLGIYLCCNNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQF------LIEEKESKEEDFYEDLDR-----FEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQL--QPGNCSLLS-VFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFL 626          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 345.895 bits (886), Expect = 3.595e-109
Identity = 219/595 (36.81%), Postives = 332/595 (55.80%), Query Frame = 2
Query:  242 LEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSF-SIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            ++ A  D    FLV   Y DS  ++L+ A +  LNL   E L+ FGK FF + +  GY  ++  LG ++R FL+NLDALH++ A     M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I      N E    Q ++   +SK E  Y    +LD+     F      +S ++        P+HIIFD  L V Q G  + ++   L  +  +  LLS + SL+ P +      I   IN+ F       LL          LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN LY+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  E RG V +KGK   M+ +FL
Sbjct:    6 IKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQ---RNEECDHTQFLIEEKESKEEDFY---EDLDR-----FEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQL--QPGNCSLLS-VFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFL 584          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 345.895 bits (886), Expect = 1.429e-108
Identity = 221/601 (36.77%), Postives = 334/601 (55.57%), Query Frame = 2
Query:  224 EAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSF-SIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            + W+   EA   D    FLV   Y DS  ++L+ A +  LNL   E L+ FGK FF + +  GY  ++  LG ++R FL+NLDALH++ A     M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I      N E    Q ++   +SK E  Y    +LD+     F      +S ++        P+HIIFD  L V Q G  + ++   L  +  +  LLS + SL+ P +      I   IN+ F       LL          LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN LY+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  E RG V +KGK   M+ +FL
Sbjct:   53 KCWDNRKEA-QLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQ---RNEECDHTQFLIEEKESKEEDFY---EDLDR-----FEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQL--QPGNCSLLS-VFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFL 636          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:4687])

HSP 1 Score: 325.479 bits (833), Expect = 6.440e-102
Identity = 204/551 (37.02%), Postives = 310/551 (56.26%), Query Frame = 2
Query:  374 FGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSF-SIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            FGK FF + +  GY  ++  LG ++R FL+NLDALH++ A     M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I      N E    Q ++   +SK E  Y    +LD+     F      +S ++        P+HIIFD  L V Q G  + ++   L  +  +  LLS + SL+ P +      I   IN+ F       LL          LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN LY+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  E RG V +KGK   M+ +FL
Sbjct:    2 FGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQ---RNEECDHTQFLIEEKESKEEDFY---EDLDR-----FEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQL--QPGNCSLLS-VFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFL 536          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-35 (Soluble guanylate cyclase gcy-35 [Source:UniProtKB/Swiss-Prot;Acc:O02298])

HSP 1 Score: 397.897 bits (1021), Expect = 2.027e-128
Identity = 224/608 (36.84%), Postives = 361/608 (59.38%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYF---AVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNF---LPYHIIFDSMLYVRQSGYMLQK-LCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLL--FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL--EYVFEGRGEVEIKGKGLMKTYFL 1957
            M G IH   ++LV  K G++ WE+I+  +  +   +  + H Y D     L+ ++A+ + +  +E  EA+G    ++T   G+ +++  +  D+  FL++LD+LH YF    V +  +  PSF  D +++  ++LHY S R GLYP +KG++  +A+  + TE+  K+       + ++   +H+V +I ++IE    +     KSIS+    +    + +      +F    PYHI FD  L+V   G  ++K   + ++ E      ++ +  L+ P VPF   SI+ + NS F F L    +  +  N+    +LL+G + F+D+    L++ S  + T+ E+ E+NL LSD+  +D TR+++++NQ R++++E+++ L E T +L+K    LE EK + + LLC+++P  VA  L +GK + A++F  CT+LF+DIVTFT+I + C P DVV +LN LY  FD+    + AYKVETIGDAYM+V GVPE    HAE +   ++ M+  S  V SP++ K ++IR+G+H GPVVAGVVG KMPR+CLFGD VNVA++MES+G+  +IH S++     L     YVF  RG  EI+GKG+M TYFL
Sbjct:    1 MFGWIHESFRQLVTRKYGKDIWEKIVHMSKFELGTESEIAHYYNDDETLRLVNSMANVIGIPIEEIWEAYGGFLIQFTMETGWDELLRAMAPDLEGFLDSLDSLH-YFIDHVVYKTKLRGPSFRCDVQADGTLLLHYYSKRSGLYPIVKGVVREVARRIYDTEVVMKV-QERKQEHLDAFVTEHVVFVI-TQIENANSTQP---KSISSKADSQIDLSTGIYEISSSDFSLAFPYHICFDPDLFVEHFGNFIKKTFPNAMRQETR----VTDLLELVHPEVPFSYESIKYYKNSLFVFRLKGLGDIVHNANDEAKTVLLKGSMVFIDEGKYILYMCSVNVTTVRELIERNLHLSDMQRHDGTRDVIMLNQSRMSQVELNRTLEETTKKLKKMAQELEIEKQKTDELLCELMPASVADSLRSGKAMDAKEFADCTLLFTDIVTFTNICAMCTPYDVVTLLNDLYLRFDRLVGLHDAYKVETIGDAYMIVGGVPERCENHAERVLNISIGMLMESKLVLSPITHKPIKIRLGVHCGPVVAGVVGIKMPRYCLFGDTVNVANKMESNGIQCKIHVSETGKLNGLKANPSYVFIDRGNTEIRGKGMMYTYFL 598          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-36 (Soluble guanylate cyclase gcy-36 [Source:UniProtKB/Swiss-Prot;Acc:Q6DNF4])

HSP 1 Score: 381.719 bits (979), Expect = 2.165e-122
Identity = 223/635 (35.12%), Postives = 350/635 (55.12%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYF---AVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPE----SRFRQHMVIIIQSKIEAQYGSLAELDKSI---STNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAF------TFLLFRNYKNLTN-----------ETDSGIL---------LRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL-EYVFEGRGEVEIKGKGLMKTYFLL 1960
            M G IH  +++L++   GE  W ++LE A  +  ++ ++ H Y D+  F+L++AV+  L +T ++  E +G    +YT   G+  +I ++  +++ FL+NLD+LH YF    V + ++  PSF  +   +  + LHY + R GLYP +KG+L   AK  FK ++    IT  T  + +     R  +H++ ++++    Q    A L  ++   S N++ +  H   ++        PYH++ D    + Q G  L       KD       L +I  +  P +P D  SI  FIN+ F      T + F+   N              E ++G L         L+GQ+  +      +++ SP + ++ E+ +  L L+ +P++D TR+L+L+NQQRL+++E++  L     QL+     LE EK + + LL +MLPP VAQQL  G  V+A +++  T++F+D+ TF  I   C P D+V +LN L++ FD+      AYKVET+GD+YM V G+P++   H E+I   A+ MV  +  V  P++   L IR GIHSGPVVAGVVG KMPR+CLFGD VN +SRMESH   GRIHCS++  +   +   + FE RG V+IKGKG M TYFLL
Sbjct:    1 MFGFIHESIRQLMIRTYGEAFWSKVLERAGFEAGKENIINHYYSDADTFSLVDAVSVILKVTREQVWEMYGCFLIQYTMETGWDDLIRSMSPNLKGFLDNLDSLH-YFIDHVVYKANLRGPSFRCEDNPDGTITLHYYTGRPGLYPIVKGVLREAAKRVFKLDVSM-TITGRTQRSVQMATGERIEEHVIFLVKTLNTDQSNEEA-LGTAVVQHSNNYKIRLTHMDFIST------FPYHMVVDQDCKIVQVGRELYNHIP--KDLLSVGTPLMRIFEVTRPQIPLDFDSICNFINAVFVLQVKTTPMEFQRNANKRAAQAIEASENLYEDNNGALALSQSQHLKLKGQMMLMSSGGHIMYLCSPYVTSIPELLQYGLRLTAMPIHDPTRDLILLNQQRLSDVEMNLQLEANNEQLENMAKDLEVEKGKTDALLREMLPPSVAQQLKQGLSVEAREYEEATVMFTDVPTFQQIVPLCTPKDIVHLLNELFTKFDRLIGIQKAYKVETVGDSYMSVGGIPDLVDDHCEVICHLALGMVMEARTVCDPITNTPLHIRAGIHSGPVVAGVVGAKMPRYCLFGDTVNTSSRMESHSPIGRIHCSENAKKCAESTGRFEFEPRGRVQIKGKGEMNTYFLL 624          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-32 (Soluble guanylate cyclase gcy-32 [Source:UniProtKB/Swiss-Prot;Acc:Q6DNF7])

HSP 1 Score: 342.428 bits (877), Expect = 3.287e-107
Identity = 207/633 (32.70%), Postives = 350/633 (55.29%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYF---AVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEI----QFKIITSATDNNPESRFRQHMVIIIQSKIEAQY---GSLAELDKSISTNFRPKYPHKSL-VNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAF-----TFLLFRNY-----------------KNLTNETDSG--ILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL-EYVFEGRGEVEIKGKGLMKTYFL 1957
            M G IH  +++LV+   GE+ W ++LE +  ++ ++ ++ H Y D+  + L+++V+  L +T D+  E +G     Y+   G+ +++ ++  +++ FL+NLD+LH YF    V + ++  PSF  ++  +  ++LHY + R GLY  +KG++  +AK  F  +I    Q +   S   NN E R  +H+V +I +  E +    GS   L  S + NF P     +L ++       LPYH + D    + Q G  L     P +  Q    +L +I  +  P +P D  +I  FIN+ F     T  L + +                 ++ TNE   G  + L+GQ+  L      +++ SP + +++E+ +  + L+ +PL+D TR+L+L+NQQRL+++E++  L     QL+  T  LE E+ + + +L  MLP ++AQQLL+G+ ++A + +  T++F D+  F     QC+P D+V+MLN ++   D+     G YKVET+ D+YM V+G+P+ T  HAE +   A+ M+  +  V  PVS     +R+GIHSG + AGVVG   P++CLFG+ V +AS+MES GM G+I CS   YQ  +    + F  RG +++K +GL +TYFL
Sbjct:    1 MFGFIHESIRQLVIRNYGEDTWTQVLERSGFESGKENIMNHYYSDTDTYVLVDSVSLVLKVTKDQVWEMYGGFLITYSMEIGWDELVRSMSPNLKGFLDNLDSLH-YFIDHVVYKANLRGPSFRCEETPDGTLLLHYFTGRPGLYHIVKGVVKEVAKRVFDLDITLVVQGRTQRSVHMNNGE-RVEEHVVFLINNLSEPRRDSEGSEVSLLTSTNANF-PTIVDDTLGISLDDFSKALPYHFVIDESCKLVQCGSELHNHI-PNELLQPGTPIL-RIFEINRPQIPLDFENICNFINAVFVLQVKTSPLKKKHMDAMSQEELKQEMETLDEDATNELTQGHHLKLKGQMMLLASKKHIIYLCSPYVTSINELMQYGMRLTAMPLHDATRDLILLNQQRLSDVEVNLQLEANNEQLETMTRELELERQKTDSILKDMLPRRIAQQLLSGEHIEACEHE-ATVMFCDLPAFQQAIPQCSPKDIVNMLNEIFRKLDRIVVIRGVYKVETVSDSYMAVSGIPDYTPEHAENMCHVALGMMWEARSVIDPVSKTPFLLRIGIHSGTITAGVVGTVHPKYCLFGETVTLASQMESLGMAGKIQCSKWAYQKAMETGRFEFSPRGRIDVKQRGLTETYFL 627          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-34 (Soluble guanylate cyclase gcy-34 [Source:UniProtKB/Swiss-Prot;Acc:P92006])

HSP 1 Score: 339.347 bits (869), Expect = 4.260e-106
Identity = 203/636 (31.92%), Postives = 353/636 (55.50%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYF---AVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEI----QFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDK---SISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDE--QHDVILLSKIASLIVPAVPFDAVSIRRFINSAF-----TFLLFRNYKN------------------LTNETDSG--ILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL-EYVFEGRGEVEIKGKGLMKTYFLL 1960
            M G IH  +++LV+ K GE+ W ++LE +  +N ++ +V H Y D+  + L+++V+  L +T D+  E +G     Y+   G+ +++ ++  +++ FL+NLD+LH YF    V + ++  PSF  ++  +  ++LHY + R GLY  +KG++  +AK  F  +I    Q +   S   NN E R  +H++ +I++  E +  S         S+  +F         V+ +     LPYH + D    + Q G    +L + + +E  Q    +L +I  +  P +P D  +I  FIN+ F     T  L + + N                   +NE   G  + L+GQ+  L      +++ SP + +++E+ +  + L+ +PL+D TR+L+L+NQQRL+++E++  L     QL+  T  LE E+ + + +L  MLP K+A+QLL+G+ ++  +++  T++F D+  F  I   C P ++V +LN ++   D+     G YKVET+ D+YM V+G+P+ TS HAE +   A+ M+  +  V  PV+     +R+G+HSG ++AGVVG KMPR+CLFG+ V +AS+MES G+ G+I CS  TY   +    + F  RG + +KG+G ++TYFL+
Sbjct:    1 MFGFIHESIRQLVIRKYGEDVWLQVLERSGFENGKENIVNHYYSDTDTYVLVDSVSIVLKVTKDQIWEMYGGFLITYSMEIGWDELVRSMSPNLKGFLDNLDSLH-YFIDHVVYKANLRGPSFRCEENPDGTLMLHYFTGRPGLYHIVKGVVKEVAKLVFNLDISLVVQGRTQRSVHMNNGE-RVEEHVIFLIKNVEEPRRDSDTSTTSALTSVEPDFGEIIDDNLKVSLQDFSRALPYHFVLDESCRLVQCG---DELYNHIPNELLQPGTPIL-RIFEINRPQIPLDFENICNFINAVFVLQVKTSPLRKKHMNAMTKEEREQEVEAMEEEVESNELTQGCHLKLKGQMMMLSTKKHIIYLCSPYVTSINELMQFGMRLTAMPLHDATRDLILLNQQRLSDVEVNLQLEANNEQLETMTHELEVERQKTDSILKDMLPRKIAKQLLSGEHLEPCEYE-ATVMFCDLPAFQQIIPVCQPKNIVKLLNEVFFKLDRIVVLRGVYKVETVSDSYMTVSGIPDYTSEHAENMCHVALGMMWEARSVMDPVNKTPFLLRIGLHSGTIIAGVVGTKMPRYCLFGETVTLASQMESLGVAGKIQCSSWTYSKAMETGRFEFSPRGRINVKGRGDVETYFLM 629          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Match: gcy-37 (Soluble guanylate cyclase gcy-37 [Source:UniProtKB/Swiss-Prot;Acc:Q6DNF3])

HSP 1 Score: 300.056 bits (767), Expect = 5.369e-91
Identity = 174/619 (28.11%), Postives = 331/619 (53.47%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYF--AVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESR---FRQHMVIIIQSKIEAQYGS--LAELDKSISTNFRPKYPHKS--LVNARHMVNFLPYHIIFDSMLYVRQSG-YMLQKLCDPLKDEQHDVILLSKIASLIVPA-VPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSG--------ILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFL---LALEYVFEGRGEVEIKGKGLMKTYFL 1957
            M+G  H+C+  L+L K G E  E IL  A       F +   Y D+    +    A+ L L+ D+  E +G+    +    G+ KM+  +  +++ FL+NL+++H +      +  M  P+F  +      + LHY S R+GL+P +KG++   A+  F+ +++  ++    + N E R     +H++  ++     + G     +   + +T   P +   S  LV  R   N  PYH+ F+  + +   G Y+L++       E    + +S +  L+ P+ +     ++  ++N+ F F L  + K   NE   G        ++L+G++  ++D +  +FI SP + T+ ++    L++SD+P++D TR+L+++NQ R+ +ME++K L E   +++K T  LE +K++ + LL + +PP +A+ L   K V A++F  C+++F+DI  F +I+  C+P +++ ++  L+  FD+  E +  YKV ++ D+Y++V GVP     H E     A+ ++  + +V  P   +S+++R+G+H GPVVAG+V ++ PRFC+ G+ VNV   + SH  PG++  S++    +   L   +VF   G +E++  G + T+FL
Sbjct:    1 MIGWTHVCVSALILRKYGPEVLEEILRKAGYQEDIKFDIQCYYDDTETMRIFRVAATVLGLSVDDMWEMYGEFLITHACETGWQKMLFCMANNLQEFLDNLNSMHYFIDQIAFKSEMKGPTFQCEPFGESGLKLHYFSFRQGLFPIVKGLVRKTARTLFEMDVKVCML----ERNQERRKSGMVEHVIFSVEPDDNHRKGKRLFHKFRNTKTTENAPSFTLSSTILVGLRDFKNIFPYHVCFNKQMIIEHIGIYLLREY----GLENKKTLKVSDLMQLVQPSDIQLTYKNVLSYLNTLFIFQLKHHSKR--NEVQEGSSEAFQQPLVLKGEMMPINDGNSIIFICSPHVTTVRDILNLKLYISDMPMHDATRDLVMLNQSRICQMELNKKLEETMKKMKKMTEELEVKKSQTDRLLFEFVPPVIAEALRAAKTVPAQEFSDCSVIFTDIPDFFTISVNCSPTEIITVVTDLFHRFDRIIEKHKGYKVLSLMDSYLIVGGVPNANQYHCEDSLNLALGLLFEAKQVVVPKLERSVRLRIGVHCGPVVAGIVSQQKPRFCVLGNTVNVTKSICSHSSPGKVLVSNAVRTMVTKHLKSIFVFNANGYLELQS-GKVLTHFL 608          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0334926)

HSP 1 Score: 344.739 bits (883), Expect = 2.262e-104
Identity = 206/622 (33.12%), Postives = 337/622 (54.18%), Query Frame = 2
Query:  191 MKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLF---------RNYKNLTNETDS----GILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEIS-KHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLGRGVTHKNGERKIPVE 2008
            + E +    GEE WE I   A  D S  F V   YP+++   L +     L ++  + ++  G  F  +  ++GY +++  LG  MR FL  LD LHEY   +   M APSF  + ++   + LHY S R+G   +  G +  +A+ F+  E+  +++        E      + +  Q   + +  +LA L  +      P       ++A  +    P+ ++F + + VR  G  L  +   L  ++     ++    L+ P + F   +I    N+ F  +           +N   L +E  S     + L+GQ+ ++++    +F+G+P +  L+ +    L+++D+ ++D +R+L+L   Q+  E++++     + + +L+++  LL+ E  R + LL QM+P +VA +L  G+      E F   +ILFSDIVTFT I S+  PM+VV MLNA+YS+FDK +E N  YKVETIGDAYMVVAG P+  + HAE + + A+DMV+A   ++ P +G+ L+IRVG+HSG VVAG+VG KMPR+CLFGD VN ASRMES  +  ++H S+ST + L+   Y    RGE+++KGKG M TY+L  R       E ++P++
Sbjct:    9 LSEYIKSVYGEEKWEDIRRQAGID-SPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVR-------EEILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLP-------ISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKK-----ITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISEST-KVLIGPNYKIIERGEIDVKGKGTMGTYWLEER-------ENRLPLQ 602          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0110961)

HSP 1 Score: 344.354 bits (882), Expect = 3.366e-104
Identity = 206/622 (33.12%), Postives = 337/622 (54.18%), Query Frame = 2
Query:  191 MKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLF---------RNYKNLTNETDS----GILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEIS-KHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLGRGVTHKNGERKIPVE 2008
            + E +    GEE WE I   A  D S  F V   YP+++   L +     L ++  + ++  G  F  +  ++GY +++  LG  MR FL  LD LHEY   +   M APSF  + ++   + LHY S R+G   +  G +  +A+ F+  E+  +++        E      + +  Q   + +  +LA L  +      P       ++A  +    P+ ++F + + VR  G  L  +   L  ++     ++    L+ P + F   +I    N+ F  +           +N   L +E  S     + L+GQ+ ++++    +F+G+P +  L+ +    L+++D+ ++D +R+L+L   Q+  E++++     + + +L+++  LL+ E  R + LL QM+P +VA +L  G+      E F   +ILFSDIVTFT I S+  PM+VV MLNA+YS+FDK +E N  YKVETIGDAYMVVAG P+  + HAE + + A+DMV+A   ++ P +G+ L+IRVG+HSG VVAG+VG KMPR+CLFGD VN ASRMES  +  ++H S+ST + L+   Y    RGE+++KGKG M TY+L  R       E ++P++
Sbjct:    9 LSEYIKSVYGEEKWEDIRRQAGID-SPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVR-------EEILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLP-------ISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKK-----ITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISEST-KVLIGPNYKIIERGEIDVKGKGTMGTYWLEER-------ENRLPLQ 602          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0306245)

HSP 1 Score: 344.354 bits (882), Expect = 3.366e-104
Identity = 206/622 (33.12%), Postives = 337/622 (54.18%), Query Frame = 2
Query:  191 MKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLF---------RNYKNLTNETDS----GILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEIS-KHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLGRGVTHKNGERKIPVE 2008
            + E +    GEE WE I   A  D S  F V   YP+++   L +     L ++  + ++  G  F  +  ++GY +++  LG  MR FL  LD LHEY   +   M APSF  + ++   + LHY S R+G   +  G +  +A+ F+  E+  +++        E      + +  Q   + +  +LA L  +      P       ++A  +    P+ ++F + + VR  G  L  +   L  ++     ++    L+ P + F   +I    N+ F  +           +N   L +E  S     + L+GQ+ ++++    +F+G+P +  L+ +    L+++D+ ++D +R+L+L   Q+  E++++     + + +L+++  LL+ E  R + LL QM+P +VA +L  G+      E F   +ILFSDIVTFT I S+  PM+VV MLNA+YS+FDK +E N  YKVETIGDAYMVVAG P+  + HAE + + A+DMV+A   ++ P +G+ L+IRVG+HSG VVAG+VG KMPR+CLFGD VN ASRMES  +  ++H S+ST + L+   Y    RGE+++KGKG M TY+L  R       E ++P++
Sbjct:    9 LSEYIKSVYGEEKWEDIRRQAGID-SPSFSVHQVYPENLLQKLAKKAQQVLGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVR-------EEILFDTVHVTFQLTFDNRAFTLASLAMTREEKHLP-------ISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLGKK-----ITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISEST-KVLIGPNYKIIERGEIDVKGKGTMGTYWLEER-------ENRLPLQ 602          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: Gycbeta100B (gene:FBgn0013973 transcript:FBtr0085753)

HSP 1 Score: 234.187 bits (596), Expect = 5.661e-66
Identity = 134/394 (34.01%), Postives = 233/394 (59.14%), Query Frame = 2
Query:  815 LVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTS-IASQCNP---MDVVDMLNALYSLFDKASEDN---GAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFL-LAL----EYVFEGRGEVEIKGKGL-MKTYFL 1957
            L++        P+H++FD  + + Q+G  + ++   + +E   +I   ++   I P +  +  +I   IN+ +  L  R     +      + L+GQ+ ++ + D  LF   P +M L ++ +K L++SD+PL+D  R+L+L++++  AE +++K+L  +T++LQ+T   LE+EK + + LL  +LP  VA +L + + V  +++   T++FS IV F    A+  +P   M +V MLN LY++FD  ++       YKVET+GD YM V+G+P+    HA+ +A  A+DM++ +  V+  +    +QI +GIHSG VV GV+G ++PR+CLFG+ VN+ SR E+ G+PGRI+ S+ TY+ L +A+     +  E RG V +KGK   M  +FL
Sbjct:  327 LISPATFCKVFPFHLMFDRQMKIVQAGKAVSRVIPRVAEENCSLI---EVVEAIRPHLQLNFENILSHINTIYV-LQTRQGAMSSRHEQRFLRLKGQMMYIPETDRILFQCYPSVMNLDDLTKKGLYISDVPLHDAARDLVLLSEKFEAEYKLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLPDHCEDHAKCMARVALDMMDMAKNVK--MGSNPVQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPMDCWFL 714          

HSP 2 Score: 122.094 bits (305), Expect = 2.913e-28
Identity = 63/166 (37.95%), Postives = 93/166 (56.02%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKII 664
            M G ++  ++ LVL   GEE WE+I + A       FLV   Y D I +NL+ A    LN+  D+ LE FGK FF++ +  GY K+++ LG   R FL+NLDALH++       M APSF   +K   E++LHY S R GL   + G++  +A +    E++  I+
Sbjct:    1 MYGFVNYALELLVLKHFGEEIWEKIKKKAMVSMEGQFLVRQIYDDEITYNLIGAAVEILNIPADDILELFGKTFFEFCQDSGYDKILQVLGATPRDFLQNLDALHDHLGTLYPGMRAPSFRCTEKDG-ELLLHYYSERPGLEHIVIGIVKAVASKLHGVEVEIDIV 165          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Match: CG34357 (gene:FBgn0085386 transcript:FBtr0335239)

HSP 1 Score: 218.394 bits (555), Expect = 4.286e-59
Identity = 113/234 (48.29%), Postives = 151/234 (64.53%), Query Frame = 2
Query: 1271 ISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVR-SPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL-EYVFEGRGEVEIKGKGLMKTYFLLGR 1966
            + K+ N +   +++ T  L+ E+ +   LL +MLP  VA++L  G  V  E+F   TI FSDIV FT+IA+ C+P+ VVD+LN LY++FD        YKVETIGDAYMVV+G+P     HAE IA  A+D++  S +     + G  LQ+R+G+H+GP  AGVVG  MPR+CLFGD VN ASRMES G   RIH S  T   L A   Y  E RG ++IKGKG+M T++LLG+
Sbjct: 1054 LEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGK 1287          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 484.952 bits (1247), Expect = 5.144e-161
Identity = 259/649 (39.91%), Postives = 393/649 (60.55%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVI-IIQS-------------------------------KIEAQYGSLA---------ELDKSI--------STNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFE--GRGEVEIKGKGLMKTYFLL 1960
            M G I+ C+K LV+++ GEE WE +   A    +  F+ +  Y D I   L++     L+++++  L+ FG+ FF + K  GY  M+  LGG++  F+ENLDALH Y A++ ++M APSF +++  +  ++LHY S RKGLY  + G++  +AK+FF +E+   I+  + ++    + ++H+V  ++Q                                +++A+Y +L          EL +SI          +F P YP    +  +   N  P+HI+FDS L V+ +G  +QK    L   Q   I L +  +++ P V F+  SI++FINS F     R       +    + LRGQ+ +++  +C +++ SP++ +L E+EE+ L L+DI  +D TR+L+L+NQQRLAE+E+S  L     +L+  +  LE EK +   LL  MLP  VA QL  GKRV+A +F++CTILFSD+VTFT+I + C P+ +V+MLNA+YS FD+ +  +  YKVETIGDAYMVV GVP  T+ HAE +A  A+ M  A+ +V +P++G+ +QIRVG+H+GPV+AGVVGEKMPR+CLFGD VN ASRMESHG+P  IH S  T+  ++  + +FE   RGE+E+KGKGLM+TYFLL
Sbjct:    1 MYGFINTCLKSLVIERFGEETWENLRLMAGVQET--FMTYEIYDDIITLRLVQEACKMLDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEAMNAPSFRVERMDDGRILLHYYSDRKGLYHIVPGIIEAVAKDFFDSEVTMTILNQSEEDERTGK-KEHVVFHMVQKEKVTKRKAQTRQNNSEEEILEVKKDKEETMRRMKARYANLQLCPRKRSPWELVRSIVMLGQGNLRQSFTPSYPKTLWIEEQAFCNAFPFHIVFDSDLVVKHTGVNIQKFVPGL---QTAGIRLDEYFTIVHPEVIFNIQSIKKFINSQFVLKTRREMLPEVQQNQPTLKLRGQMMWMESLNCMIYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQLERKKEELRILSRNLEIEKQKSEKLLYAMLPTHVANQLKEGKRVEAGEFKVCTILFSDVVTFTNICAACEPIQIVNMLNAMYSRFDRLTSIHNVYKVETIGDAYMVVGGVPVPTNTHAERVANFALGMRIAAREVTNPITGQPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHVSPFTFS-VIKDKGIFEMAERGEIEVKGKGLMRTYFLL 642          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: gucy1b1 (guanylate cyclase 1 soluble subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-090313-160])

HSP 1 Score: 352.058 bits (902), Expect = 1.474e-111
Identity = 216/620 (34.84%), Postives = 342/620 (55.16%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFS-IDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFD---KASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            M G ++  ++ LVL   G + WE I   A  D    FLV   Y D+  ++L+ A +  L +     L+ FGK FF++ +  GY  ++  LG ++R FL+NLDALH++       M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI+ K+I       P+S    H+  +I+ K   +     +LD      F      ++ ++        P+H++FD  L + Q G  + ++   L   Q  V  LS + SL+ P + F    I   IN+ F       LL      N   LT    S + L+GQ+  L + +  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    + +V++LN +Y+ FD    + ++   YKVET+GD YM V+G+PE  + HA+ I   A+DM+E + +V+  V    +QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L ++E     +  E RG V +KGK   MK +FL
Sbjct:    1 MYGFVNHALELLVLRNYGPDVWEDIKREAQVDVEGQFLVRIIYEDAKTYDLVAAASKVLKMDAGGILQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVI------QPKSEECDHIKFLIEEKDSEEEAFYEDLD-----GFEENGTQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQL---QPGVCNLSSVFSLVRPHIDFSFHGILSHINTVFVLRSKEGLLNVETAENEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVK--VDEDPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFHLEYRGPVTMKGKKEPMKVWFL 604          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: gucy1b1 (guanylate cyclase 1 soluble subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-090313-160])

HSP 1 Score: 348.977 bits (894), Expect = 2.055e-110
Identity = 214/609 (35.14%), Postives = 336/609 (55.17%), Query Frame = 2
Query:  200 LVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFS-IDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFD---KASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            LVL   G + WE I   A  D    FLV   Y D+  ++L+ A +  L +     L+ FGK FF++ +  GY  ++  LG ++R FL+NLDALH++       M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI+ K+I       P+S    H+  +I+ K   +     +LD      F      ++ ++        P+H++FD  L + Q G  + ++   L   Q  V  LS + SL+ P + F    I   IN+ F       LL      N   LT    S + L+GQ+  L + +  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    + +V++LN +Y+ FD    + ++   YKVET+GD YM V+G+PE  + HA+ I   A+DM+E + +V+  V    +QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L ++E     +  E RG V +KGK   MK +FL
Sbjct:    6 LVLRNYGPDVWEDIKREAQVDVEGQFLVRIIYEDAKTYDLVAAASKVLKMDAGGILQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVI------QPKSEECDHIKFLIEEKDSEEEAFYEDLD-----GFEENGTQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQL---QPGVCNLSSVFSLVRPHIDFSFHGILSHINTVFVLRSKEGLLNVETAENEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVK--VDEDPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFHLEYRGPVTMKGKKEPMKVWFL 598          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: GUCY1A2 (guanylate cyclase 1, soluble, alpha 2 [Source:NCBI gene;Acc:100330875])

HSP 1 Score: 252.292 bits (643), Expect = 1.148e-73
Identity = 182/587 (31.01%), Postives = 294/587 (50.09%), Query Frame = 2
Query:  374 FGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVT---QKSMIAPSFSI------DKKSNCE------MILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFK----IITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSIST--------NFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFL---LALEYVFEGRGEV------EIKGKGLMKTYFL-LGRGVTHKN--GERKIPVENVS 2017
            FG++FF         +++  LGG+++ F    DAL E+   +   + S  APSF        ++++N E      +ILH  +    +   + G++   A+  +++E+  +          + + E                +    L+ L + + T            + P    +         P+H++  S + V Q G  L+K     K + H  +  S    L+ P +P    +I   +++ FT     +  +L +  +  + L+GQ+  L +++  +F+GSPR+  L E+  + L LSDIP++D TR+++LV +Q  A+  + K ++++   L+KT   LE EK R   LL  + P  VAQ+L  G  V+A+KF   T+LFSDIV FT++ +QC PM V+ MLN LY+ FD        YK+ETIGDAY V  G+      HA+ IA  A+ M+E S +V +P  GK +++R+GIHSG V+AGVVG  MPR+CLFG+ V +AS+ ES   P  I+ S +TYQ L    +  ++   R E+      EI G      YFL  G+  +H +    R  P+  VS
Sbjct:   42 FGEEFFGLCLEEN-ERVLRALGGNLQDFFNGFDALLEHIRTSCGRRASSEAPSFLCKDAPQENEETNAESGAGRTLILHCFNPDPTVGVAMPGLIRAAARRIYQSEVSVEEAPPTWLHTANEDGELSADSSPSSSPSPPSSSAPACLSFLIREVHTPPTSSSRSRQLSRSPLDLRIGLSTFCRAFPFHLVLGSNMEVLQVGEGLRKQA---KTDPHRTLTFSNSFELVSPRIPCSFQNILLRLSTPFTIRTRPDGSSL-DCREKVMELKGQMLHLPESNSIMFLGSPRVDRLEELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLEKTHQALEEEKRRTVDLLYSIFPGDVAQRLWQGLPVQAKKFDDVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGILDVYKIETIGDAYCVAGGLHRKIDSHAKPIALMALKMMELSEEVLTP-DGKPIKLRIGIHSGSVLAGVVGVMMPRYCLFGNNVTLASKFESGSHPRCINVSPTTYQLLRDDRSFTFIPRSRQELPDNFPKEIPG----ICYFLEAGKSQSHASLTSTRSAPIRKVS 618          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Match: gucy1a1 (guanylate cyclase 1 soluble subunit alpha 1 [Source:ZFIN;Acc:ZDB-GENE-050417-230])

HSP 1 Score: 233.417 bits (594), Expect = 2.214e-66
Identity = 131/345 (37.97%), Postives = 206/345 (59.71%), Query Frame = 2
Query:  845 LPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFL 1879
             P+HI+ D  + + Q G  L++     +D Q         A ++ P +      I   +N+ F   + ++  +  +     + L+GQ+ F+ +    LF+GSP +  L E+  + L+LSDIP+++  R+++LV +Q  A+  + K L +    L++    LE EK R   LL  + P  VAQ+L  G  V+A+KF   T+LFSDIV FT+I S+C PM VV+ML+ LY+ FD    +   YKVETIGDAY V  G+ + +  HA  IA  A+ M+E S++V +P+ G+ +++R+GIHSG V+AGVVG KMPR+CLFG+ V +A++ ES  +P +I+ S +TY+ L
Sbjct:  288 FPFHILLDQEMGLLQIGDGLRRRLGRCRDGQRRPAFNEHFA-IVSPEIRASFQDILTMLNTQFLLRVKQHGASSADSPGKHMDLKGQMIFMSEMSALLFLGSPCVDKLEELTGRGLYLSDIPIHNALRDVVLVGEQTKAQDGLKKRLGKAKAALEQAHQALEEEKRRTVELLFTIFPGNVAQRLWQGLPVQAKKFDHVTVLFSDIVGFTAICSRCTPMQVVNMLSELYTRFDHHCGELDVYKVETIGDAYCVAGGLHKESPTHAVQIALMALKMMELSDEVTTPM-GEVIRMRIGIHSGSVLAGVVGVKMPRYCLFGNNVTLANKFESCSLPRKINVSPTTYRLL 630          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: ank1 (ankyrin 1 [Source:Xenbase;Acc:XB-GENE-5838516])

HSP 1 Score: 431.024 bits (1107), Expect = 8.296e-142
Identity = 240/612 (39.22%), Postives = 350/612 (57.19%), Query Frame = 2
Query:  404 RHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSK----------------------IEAQYGSLAELDKSIST------------------------NFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLGRGVTHKNGERKIPVENVSQCNAAVKCNAKEKSRTAEISNNHNDSPI 2101
            + GY  M+  LGGD+  F+ NLDALH Y +++ + M APSF ++   +  M LHY S R+GL   + G++G +A +FFKTEI  +II S +D    +  ++H+V ++  K                       E  Y    +    +S                          FRP YP    V+       LP+HI+FD  L ++Q+G  +QK+   L   Q   I L +  S + P V     ++R+FINS F F   R     +      + LRGQ+ +++  +C L++ SP + TL E+EE+ + +SDI  +DVTR+L+L+NQQRLAEME+S  L     +L+  +  LE EK +  +LL  MLP  VA QL  GKRV+A +F+ CTILFSD+VTFT+I +QC P+ +V MLN++Y  FD+ +  +  YKVETIGDAYMVV GVP   S HAE +A  A+ M+  + +V++PV+G  +QIRVG+HSGPV+AGVVGEKMPR+CLFGD VN ASRMESHG+P +IH S + Y++L    +    RGE+++KGKG M+TYFL+      +N      ++      A+ +    + S+     N+  D+P+
Sbjct:    1 KSGYDHMLRTLGGDLYEFIANLDALHSYLSLSYQEMNAPSFRVEMNGDGSMHLHYYSDRRGLCHIVPGIMGAVAMDFFKTEISMEII-SQSDEEERTGKKEHIVFLVTQKPAFPPKCPTKPPLVSRGIKNKSFENPYNKYRDRKNQVSVCPVKKNHWAMIRGIVQLGKGRMLRGFRPVYPKDLCVDVETFCKGLPFHIVFDEELRIKQAGVSIQKIVPGL---QTTGIRLDQYFSTVHPEVTLTISNVRKFINSQFVFRTKREMMPESWRDRPMLELRGQMIWMEKLECMLYLCSPLLRTLHELEERQMHISDIAPHDVTRDLILLNQQRLAEMELSNQLERKKEELRILSKHLEEEKKKTELLLYAMLPKHVANQLKEGKRVEAGEFKECTILFSDVVTFTNICAQCEPIQIVFMLNSMYLRFDRLTTVHDVYKVETIGDAYMVVGGVPVPVSSHAERVANFALGMILMAKQVKNPVNGNPIQIRVGLHSGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPNKIHISPTVYRYLKGKNFEMTERGEIDVKGKGRMRTYFLIRNSSAKENEILGQAIKETDSGRASSQSLLDDTSKRNVQRNSPGDAPV 608          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 353.214 bits (905), Expect = 9.984e-112
Identity = 215/629 (34.18%), Postives = 344/629 (54.69%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFS-IDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGK-GLMKTYFLLGRGVTHKN 1984
            M G ++  ++ LV+   G E WE I + A  D    FLV   Y DS  ++L+ A    LNL   + L+ FG  FF + +  GY  ++  LG ++R FL+NLDALH++       M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I    +    ++F      +I+ K   +     + D+     F      +S ++        P+HI+FD  L+V Q G  + ++   L+    +++    + SL+ P +      I   IN+ F       LL      +   LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN +Y+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  + RG V +KGK   M+ +FL  +    +N
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQF------LIEEKDTREEDFYEDQDR-----FEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLL---SVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQYRGPVSMKGKTDPMQVWFLSRKAAETEN 613          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 352.829 bits (904), Expect = 1.366e-111
Identity = 214/620 (34.52%), Postives = 341/620 (55.00%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFS-IDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGK-GLMKTYFL 1957
            M G ++  ++ LV+   G E WE I + A  D    FLV   Y DS  ++L+ A    LNL   + L+ FG  FF + +  GY  ++  LG ++R FL+NLDALH++       M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I    +    ++F      +I+ K   +     + D+     F      +S ++        P+HI+FD  L+V Q G  + ++   L+    +++    + SL+ P +      I   IN+ F       LL      +   LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN +Y+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  + RG V +KGK   M+ +FL
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQF------LIEEKDTREEDFYEDQDR-----FEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLL---SVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQYRGPVSMKGKTDPMQVWFL 604          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 352.829 bits (904), Expect = 1.469e-111
Identity = 214/620 (34.52%), Postives = 341/620 (55.00%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFS-IDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGK-GLMKTYFL 1957
            M G ++  ++ LV+   G E WE I + A  D    FLV   Y DS  ++L+ A    LNL   + L+ FG  FF + +  GY  ++  LG ++R FL+NLDALH++       M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I    +    ++F      +I+ K   +     + D+     F      +S ++        P+HI+FD  L+V Q G  + ++   L+    +++    + SL+ P +      I   IN+ F       LL      +   LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN +Y+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  + RG V +KGK   M+ +FL
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQF------LIEEKDTREEDFYEDQDR-----FEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLL---SVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQYRGPVSMKGKTDPMQVWFL 604          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 341.273 bits (874), Expect = 5.198e-107
Identity = 214/638 (33.54%), Postives = 341/638 (53.45%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLE------------------NLDALHEYFAVTQKSMIAPSFS-IDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGK-GLMKTYFL 1957
            M G ++  ++ LV+   G E WE I + A  D    FLV   Y DS  ++L+ A    LNL   + L+ FG  FF + +  GY  ++  LG ++R FL+                  NLDALH++       M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I    +    ++F      +I+ K   +     + D+     F      +S ++        P+HI+FD  L+V Q G  + ++   L+    +++    + SL+ P +      I   IN+ F       LL      +   LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN +Y+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  + RG V +KGK   M+ +FL
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVSAATKVLNLNAGDILQMFGNMFFVFCQESGYDTILRVLGSNVREFLQHFIYIIDKKACFLLFPINNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKVIQQRNEECDHTQF------LIEEKDTREEDFYEDQDR-----FEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLL---SVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQYRGPVSMKGKTDPMQVWFL 622          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:MGI Symbol;Acc:MGI:2660873])

HSP 1 Score: 457.603 bits (1176), Expect = 9.010e-150
Identity = 245/636 (38.52%), Postives = 376/636 (59.12%), Query Frame = 2
Query:  164 SMLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPE---SRFRQHMVIIIQSKIEAQYGSLAELDKSI----------------------------------STNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLL 1960
            +M G I+ C++ LV +K GEE WE++  +A   +   F+ +  Y D+I   L++     L+++ +  L+ FG+ FFK+ K  GY +M+  LGG++  F+ENLDALH Y A++ + M APSF ++  ++  M LHY S R+GL   + G++  +AK+FF T++   I+    D N E   +  ++H+V ++  K   Q      L  ++                                     F+P +P +  +      N  P+H++FD  L V+Q+G  +QK    +  ++     L +  S++ P V F+  SI +FINS F     R       ++   + LRGQ+ +++   C +F+ SP++ +L E+EE  + LSDI  +D TR+L+L+NQQRLAEME+S  L +   +L+  ++ L  EK +   LL  MLP  VA QL  GK+V A +F+ CTILFSD+VTFT+I + C P+ +V+MLN++YS FD+ +  +  YKVETIGDAYMVV GVP     HA+ +A  A+ M  ++ +V +PV+G+ +QIRVGIH+GPV+AGVVG+KMPR+CLFGD VN ASRMESHG+P ++H S + ++ L    +    RGE+E+KGKG M TYFL+
Sbjct:   81 TMYGFINTCLQSLVTEKFGEETWEKLKASAEVQDV--FMTYTVYDDTITVKLIQEACKALDVSMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEGGADGAMRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDVAMSIL----DMNEEVERTGKKEHVVFLVVQKARRQIRGAKSLQGTLLRKKERYLSIPVCPGEKSHSAVVRASVLLGKGPLGDTFQPVFPERLWIEEEVFCNAFPFHVVFDEALRVKQAGVNIQKYVPGILTQKFG---LDEYFSIVHPQVTFNISSICKFINSQFILKTRREMMPEAWKSQPTLKLRGQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGKKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVTGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAHRALENKGFEIVTRGEIEVKGKGKMTTYFLI 707          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:MGI Symbol;Acc:MGI:2660873])

HSP 1 Score: 454.521 bits (1168), Expect = 2.424e-148
Identity = 251/651 (38.56%), Postives = 383/651 (58.83%), Query Frame = 2
Query:  164 SMLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPE---SRFRQHMVII----------------------IQSKIEAQYGSLAEL------------DKSIST---------------NFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLL 1960
            +M G I+ C++ LV +K GEE WE++  +A   +   F+ +  Y D+I   L++     L+++ +  L+ FG+ FFK+ K  GY +M+  LGG++  F+ENLDALH Y A++ + M APSF ++  ++  M LHY S R+GL   + G++  +AK+FF T++   I+    D N E   +  ++H+V +                      IQ+K E+  G+L               +KS S                 F+P +P +  +      N  P+H++FD  L V+Q+G  +QK    +  ++     L +  S++ P V F+  SI +FINS F     R       ++   + LRGQ+ +++   C +F+ SP++ +L E+EE  + LSDI  +D TR+L+L+NQQRLAEME+S  L +   +L+  ++ L  EK +   LL  MLP  VA QL  GK+V A +F+ CTILFSD+VTFT+I + C P+ +V+MLN++YS FD+ +  +  YKVETIGDAYMVV GVP     HA+ +A  A+ M  ++ +V +PV+G+ +QIRVGIH+GPV+AGVVG+KMPR+CLFGD VN ASRMESHG+P ++H S + ++ L    +    RGE+E+KGKG M TYFL+
Sbjct:   81 TMYGFINTCLQSLVTEKFGEETWEKLKASAEVQDV--FMTYTVYDDTITVKLIQEACKALDVSMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEGGADGAMRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDVAMSIL----DMNEEVERTGKKEHVVFLVVQKARRQIRGAKVNRPRDSENIQAKQESLQGTLLRKKERYLSIPVCPGEKSHSAVVRASVLLGKGPLGDTFQPVFPERLWIEEEVFCNAFPFHVVFDEALRVKQAGVNIQKYVPGILTQKFG---LDEYFSIVHPQVTFNISSICKFINSQFILKTRREMMPEAWKSQPTLKLRGQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGKKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVTGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAHRALENKGFEIVTRGEIEVKGKGKMTTYFLI 722          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b1 (guanylate cyclase 1, soluble, beta 1 [Source:MGI Symbol;Acc:MGI:1860604])

HSP 1 Score: 362.073 bits (928), Expect = 2.811e-115
Identity = 228/620 (36.77%), Postives = 345/620 (55.65%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSF-SIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            M G ++  ++ LV+   G E WE I + A  D    FLV   Y DS  ++L+ A +  LNL   E L+ FGK FF + +  GY  ++  LG ++R FL+NLDALH++ A     M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I      N E    Q ++   +SK E  Y    +LD+     F      +S ++        P+HIIFD  L V Q G  + ++   L  +  +  LLS + SL+ P +      I   IN+ F       LL          LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN LY+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  E RG V +KGK   M+ +FL
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQ---RNEECDHTQFLIEEKESKEEDFY---EDLDR-----FEENGTQESRISPYTFCKAFPFHIIFDRNLVVTQCGNAIYRVLPQL--QPGNCSLLS-VFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPLFHLEHRGPVSMKGKKEPMQVWFL 604          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1b1 (guanylate cyclase 1, soluble, beta 1 [Source:MGI Symbol;Acc:MGI:1860604])

HSP 1 Score: 352.058 bits (902), Expect = 1.487e-111
Identity = 217/588 (36.90%), Postives = 328/588 (55.78%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFS-IDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFL 1879
            M G ++  ++ LV+   G E WE I + A  D    FLV   Y DS  ++L+ A +  LNL   E L+ FGK FF + +  GY  ++  LG ++R FL+NLDALH++ A     M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I      N E    Q ++   +SK E  Y    +LD+     F      +S ++        P+HIIFD  L V Q G  + ++   L  +  +  LLS + SL+ P +      I   IN+ F       LL          LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN LY+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQ---RNEECDHTQFLIEEKESKEEDFY---EDLDR-----FEENGTQESRISPYTFCKAFPFHIIFDRNLVVTQCGNAIYRVLPQL--QPGNCSLLS-VFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRKL 572          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Match: Gucy1a2 (guanylate cyclase 1, soluble, alpha 2 [Source:MGI Symbol;Acc:MGI:2660877])

HSP 1 Score: 253.832 bits (647), Expect = 2.178e-73
Identity = 177/535 (33.08%), Postives = 282/535 (52.71%), Query Frame = 2
Query:  314 NLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVT---QKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSAT----DNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFL----PYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAV--PFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFL 1879
             +L+  A+ L L   E  E FG++FFK        +++  +G  ++ F    DAL E+   +   Q ++ + SF   +     ++LHY      +   + GM+    K  +   ++ + I +       +NP             S        + E + +  T   P+   +   + R  +N      P+H++FDS + V Q G  L+K    L+ + H  +       ++ P +   FD V +R  +++ F            NE D  + ++GQ+  + ++   LF+GSP +  L E+  + L LSDIP++D TR+++LV +Q  A+  + K ++++   L++T   LE EK +   LL  + P  VAQQL  G++V+A KF   T+LFSDIV FT+I +QC PM V+ MLN LY+ FD        YKVETIGDAY V +G+   +  HA+ IA  A+ M+E S +V +P  GK++Q+R+GIHSG V+AGVVG +MPR+CLFG+ V +AS+ ES   P RI+ S +TYQ L
Sbjct:  151 GILQCTANVLGLQFQEIQERFGEEFFKICFDEN-ERVLRAVGSTLQDFFNGFDALLEHIRTSFGKQATLESSSFLCKELPEGTLMLHYFHPHHTVGFAMLGMIKAAGKRIYHLNVEVEQIENEKLCFDGSNP-------------SNCSCLTFLIKECETTQITKDNPQGTSQVPADLRISINTFCRAFPFHLMFDSNMVVLQLGEGLRK---QLRYDTHRALKFEDCFEIVSPMINATFDRVLLR--LSTPFVIRTKPEASGTENE-DKVMEIKGQMIHVPESSAILFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGLLDIYKVETIGDAYCVASGLHRKSLCHAKPIALMALKMMELSEEVLTP-DGKAIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLL 664          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|O75343|GCYB2_HUMAN (Guanylate cyclase soluble subunit beta-2 OS=Homo sapiens OX=9606 GN=GUCY1B2 PE=5 SV=2)

HSP 1 Score: 417.542 bits (1072), Expect = 9.010e-136
Identity = 228/596 (38.26%), Postives = 343/596 (57.55%), Query Frame = 2
Query:  410 GYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPE---SRFRQHMVIII-------------------------QSKIEAQYGSLAELDKSIST------------------------NFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLGRGVTHKN---GERKIPVENVSQCNAA 2032
            GY +M+  LGG++  F+ENLDALH Y A++ + M APSF +++ ++ +M LHY S R GL   + G++  +AK+FF  ++   I+    D N E   +  ++H+V +I                         Q  ++A +  + E   ++S                          F P YP +  +  +   N  P+HI+FD  L V+Q+   +QK    L+ +    I L +  S+I P V F+  SIRRFINS F     R    +  ++ + + L+GQ+ +++   C +++ SP++ +L E+EE N+ LSDI   D TR+L+L+NQQRLAE+E+S  L     +LQ  +  L  EK +   LL  MLP  VA QL  GK+V A +F+ CTILFSD+VTFT+I + C P+ +V++LN++YS FD+ +  +  YKVETIGDAYMVV GVP     HA+ +A  A+ M  ++ +V +PV+G+ +Q+RVGIH+GPV+A VVG+KMPR+CLFGD VN ASRMESHG+P ++H S + Y+ L    +    RGE+E+KGKG M TYFL+      ++   G  K PV++      A
Sbjct:    3 GYDRMLRTLGGNLMEFIENLDALHSYLALSYQEMNAPSFRVERGADGKMFLHYYSDRSGLCHIVPGIIEAVAKDFFDIDVIMDIL----DMNEEVERTGKKEHVVFLIVQKAHRKMRKTKPKRLQDSQGMERDQEALQAAFLKMKEKYLNVSACPVKKSHWDVVRSIVMFGKGHLMNTFEPIYPERLWIEEKTFCNAFPFHIVFDESLQVKQARVNIQKYVPGLQTQN---IQLDEYFSIIHPQVTFNIFSIRRFINSQFVLKTRREMMPVAWQSRTTLKLQGQMIWMESMWCMVYLCSPKLRSLQELEELNMHLSDIAPNDTTRDLILLNQQRLAEIELSNQLERKKEELQVLSKHLAIEKKKTETLLYAMLPKHVANQLREGKKVAAGEFKSCTILFSDVVTFTNICTACEPIQIVNVLNSMYSKFDRLTSVHAVYKVETIGDAYMVVGGVPVPIGNHAQRVANFALGMRISAKEVTNPVTGEPIQLRVGIHTGPVLADVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAYRALKNQGFKIIERGEIEVKGKGRMTTYFLIQNLNATEDEIMGRSKTPVDHKGSTQKA 591          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|P22717|GCYB2_RAT (Guanylate cyclase soluble subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gucy1b2 PE=2 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 2.229e-135
Identity = 233/584 (39.90%), Postives = 347/584 (59.42%), Query Frame = 2
Query:  365 LEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPE---SRFRQHMVIII----------------------QSKIEAQYGSLAEL------------DKSIST---------------NFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLL 1960
            L+ FG+ FFK+ K  GY +M+  LGG++  F+ENLDALH Y A++ + M APSF +++ ++  M+LHY S R GL   + G++  +AK+FF T++   I+    D N E   +  ++H+V ++                      Q+  EA  G+L  +            +KS ST                F+P YP +  V      +  P+HI+FD  L V+Q+G  +QK    +  ++     L +  S+I P V F+  SI +FINS F     +       ++   + LRGQ+ +++   C +F+ SP + +L E+EE  + LSDI  +D TR+L+L+NQQRLAEME+S  L +   +L+  ++ L  EK +   LL  MLP  VA QL  G++V A +F+ CTILFSD+VTFT+I + C P+ +V+MLN++YS FD+ +  +  YKVETIGDAYMVV GVP     HA+ +A  A+ M  ++ +V +PV+G+ +QIRVGIH+GPV+AGVVG+KMPR+CLFGD VN ASRMESHG+P ++H S + ++ L    +    RGE+E+KGKG M TYFL+
Sbjct:    5 LKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEEGADGAMLLHYYSDRHGLCHIVPGIIEAVAKDFFDTDVAMSIL----DMNEEVERTGKKEHVVFLVVQKAHRQIRGAKASRPQGSEDSQADQEALQGTLLRMKERYLNIPVCPGEKSHSTAVRASVLFGKGPLRDTFQPVYPERLWVEEEVFCDAFPFHIVFDEALRVKQAGVNIQKYVPGILTQK---FALDEYFSIIHPQVTFNISSICKFINSQFVLKTRKEMMPKARKSQPMLKLRGQMIWMESLRCMIFMCSPNVRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGRKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTSVHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVTGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPSKVHLSPTAHRALKNKGFEIVRRGEIEVKGKGKMTTYFLI 581          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|O02298|GCY35_CAEEL (Soluble guanylate cyclase gcy-35 OS=Caenorhabditis elegans OX=6239 GN=gcy-35 PE=1 SV=3)

HSP 1 Score: 397.897 bits (1021), Expect = 2.578e-127
Identity = 224/608 (36.84%), Postives = 361/608 (59.38%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYF---AVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNF---LPYHIIFDSMLYVRQSGYMLQK-LCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLL--FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL--EYVFEGRGEVEIKGKGLMKTYFL 1957
            M G IH   ++LV  K G++ WE+I+  +  +   +  + H Y D     L+ ++A+ + +  +E  EA+G    ++T   G+ +++  +  D+  FL++LD+LH YF    V +  +  PSF  D +++  ++LHY S R GLYP +KG++  +A+  + TE+  K+       + ++   +H+V +I ++IE    +     KSIS+    +    + +      +F    PYHI FD  L+V   G  ++K   + ++ E      ++ +  L+ P VPF   SI+ + NS F F L    +  +  N+    +LL+G + F+D+    L++ S  + T+ E+ E+NL LSD+  +D TR+++++NQ R++++E+++ L E T +L+K    LE EK + + LLC+++P  VA  L +GK + A++F  CT+LF+DIVTFT+I + C P DVV +LN LY  FD+    + AYKVETIGDAYM+V GVPE    HAE +   ++ M+  S  V SP++ K ++IR+G+H GPVVAGVVG KMPR+CLFGD VNVA++MES+G+  +IH S++     L     YVF  RG  EI+GKG+M TYFL
Sbjct:    1 MFGWIHESFRQLVTRKYGKDIWEKIVHMSKFELGTESEIAHYYNDDETLRLVNSMANVIGIPIEEIWEAYGGFLIQFTMETGWDELLRAMAPDLEGFLDSLDSLH-YFIDHVVYKTKLRGPSFRCDVQADGTLLLHYYSKRSGLYPIVKGVVREVARRIYDTEVVMKV-QERKQEHLDAFVTEHVVFVI-TQIENANSTQP---KSISSKADSQIDLSTGIYEISSSDFSLAFPYHICFDPDLFVEHFGNFIKKTFPNAMRQETR----VTDLLELVHPEVPFSYESIKYYKNSLFVFRLKGLGDIVHNANDEAKTVLLKGSMVFIDEGKYILYMCSVNVTTVRELIERNLHLSDMQRHDGTRDVIMLNQSRMSQVELNRTLEETTKKLKKMAQELEIEKQKTDELLCELMPASVADSLRSGKAMDAKEFADCTLLFTDIVTFTNICAMCTPYDVVTLLNDLYLRFDRLVGLHDAYKVETIGDAYMIVGGVPERCENHAERVLNISIGMLMESKLVLSPITHKPIKIRLGVHCGPVVAGVVGIKMPRYCLFGDTVNVANKMESNGIQCKIHVSETGKLNGLKANPSYVFIDRGNTEIRGKGMMYTYFL 598          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DNF4|GCY36_CAEEL (Soluble guanylate cyclase gcy-36 OS=Caenorhabditis elegans OX=6239 GN=gcy-36 PE=1 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 2.754e-121
Identity = 223/635 (35.12%), Postives = 350/635 (55.12%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYF---AVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPE----SRFRQHMVIIIQSKIEAQYGSLAELDKSI---STNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAF------TFLLFRNYKNLTN-----------ETDSGIL---------LRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL-EYVFEGRGEVEIKGKGLMKTYFLL 1960
            M G IH  +++L++   GE  W ++LE A  +  ++ ++ H Y D+  F+L++AV+  L +T ++  E +G    +YT   G+  +I ++  +++ FL+NLD+LH YF    V + ++  PSF  +   +  + LHY + R GLYP +KG+L   AK  FK ++    IT  T  + +     R  +H++ ++++    Q    A L  ++   S N++ +  H   ++        PYH++ D    + Q G  L       KD       L +I  +  P +P D  SI  FIN+ F      T + F+   N              E ++G L         L+GQ+  +      +++ SP + ++ E+ +  L L+ +P++D TR+L+L+NQQRL+++E++  L     QL+     LE EK + + LL +MLPP VAQQL  G  V+A +++  T++F+D+ TF  I   C P D+V +LN L++ FD+      AYKVET+GD+YM V G+P++   H E+I   A+ MV  +  V  P++   L IR GIHSGPVVAGVVG KMPR+CLFGD VN +SRMESH   GRIHCS++  +   +   + FE RG V+IKGKG M TYFLL
Sbjct:    1 MFGFIHESIRQLMIRTYGEAFWSKVLERAGFEAGKENIINHYYSDADTFSLVDAVSVILKVTREQVWEMYGCFLIQYTMETGWDDLIRSMSPNLKGFLDNLDSLH-YFIDHVVYKANLRGPSFRCEDNPDGTITLHYYTGRPGLYPIVKGVLREAAKRVFKLDVSM-TITGRTQRSVQMATGERIEEHVIFLVKTLNTDQSNEEA-LGTAVVQHSNNYKIRLTHMDFIST------FPYHMVVDQDCKIVQVGRELYNHIP--KDLLSVGTPLMRIFEVTRPQIPLDFDSICNFINAVFVLQVKTTPMEFQRNANKRAAQAIEASENLYEDNNGALALSQSQHLKLKGQMMLMSSGGHIMYLCSPYVTSIPELLQYGLRLTAMPIHDPTRDLILLNQQRLSDVEMNLQLEANNEQLENMAKDLEVEKGKTDALLREMLPPSVAQQLKQGLSVEAREYEEATVMFTDVPTFQQIVPLCTPKDIVHLLNELFTKFDRLIGIQKAYKVETVGDSYMSVGGIPDLVDDHCEVICHLALGMVMEARTVCDPITNTPLHIRAGIHSGPVVAGVVGAKMPRYCLFGDTVNTSSRMESHSPIGRIHCSENAKKCAESTGRFEFEPRGRVQIKGKGEMNTYFLL 624          
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q02153|GCYB1_HUMAN (Guanylate cyclase soluble subunit beta-1 OS=Homo sapiens OX=9606 GN=GUCY1B1 PE=1 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.545e-114
Identity = 228/620 (36.77%), Postives = 345/620 (55.65%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFS-IDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFDKASEDNG---AYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            M G ++  ++ LV+   G E WE I + A  D    FLV   Y DS  ++L+ A +  LNL   E L+ FGK FF + +  GY  ++  LG ++R FL+NLDALH++ A     M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI  K+I      N E    Q ++   +SK E  Y    +LD+     F      +S ++        P+HIIFD  L V Q G  + ++   L  +  +  LLS + SL+ P +      I   IN+ F       LL          LT    S + L+GQ+ +L + D  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    M +V++LN LY+ FD  ++       YKVET+GD YM V+G+PE    HA  I   A+DM+E + +V+  V G+S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L++ E     +  E RG V +KGK   M+ +FL
Sbjct:    1 MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQ---RNEECDHTQFLIEEKESKEEDFY---EDLDR-----FEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQL--QPGNCSLLS-VFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQ--VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFL 604          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A1I8IZI1 (Guanylate cyclase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 312/565 (55.22%), Postives = 403/565 (71.33%), Query Frame = 2
Query:  368 EAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV---------------------------KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLA----LEYVFEGRGEVEIKGKGLMKTYFLLGRG 1969
            E FG  FFKY K+HGY KMI  LG D++ F++NLD+LH+Y  +  KSM+ PSFS + + + E ILHY S+R GL  WIKGML  +AKE F TEIQ K++   TD  PESR++ H+ I+I       + S + L  S+    +P YP KSL+  +  V + PYHIIFDS+L+++QSG  +Q +C  L+ +   V+ L+++  L+ P V F +  I+RF+NS+FT  L R+ ++  + T+S +L++GQ+ F++D + FLF+ SPR+MTLSEM EKN+F+SD+PLYDVTRELL VNQQRLAE+EISKH++EMTN+++K T+ LE+EK + + LL QMLP KVA+QLL GKRV                            AEK+++CTILFSDIVTFT IASQC PM++VDMLN LYSLFDKA+E N  YKVETIGDAYMVV GVPE T +HA  ++EQAMDM+EAS +V SPV+   LQIRVG+H+GP VAGVVG+KMPRFCLFGD VNVASRMESHG+P RIH S +TY+ L        Y FEGRGE+ IKGKGLM TYFLLG  
Sbjct:    3 EMFGSHFFKYFKKHGYDKMIYTLGQDLKKFIQNLDSLHDYLQIDNKSMVPPSFSCNYEDSGEFILHYYSARAGLESWIKGMLTTVAKEIFSTEIQLKVMDIDTDFPPESRYQTHVRILIS------FASHSSLAASLDDFVQPCYPSKSLITVKSFVRYFPYHIIFDSLLFIKQSGAAIQSVCQTLRFKD-SVVKLTEVCELVNPPVNFSSHYIKRFLNSSFTLRLKRSIED--DCTESSLLIKGQMIFMEDTNLFLFVCSPRVMTLSEMMEKNIFMSDLPLYDVTRELLQVNQQRLAEIEISKHMDEMTNEMKKMTAELEDEKKKTHTLLSQMLPSKVAKQLLEGKRVAAGERTRDIPSVSPFCWTAASGGAILTSAEKYEICTILFSDIVTFTDIASQCTPMNIVDMLNNLYSLFDKATEVNKVYKVETIGDAYMVVGGVPERTDQHAHFVSEQAMDMIEASCRVASPVTNLPLQIRVGMHTGPTVAGVVGDKMPRFCLFGDTVNVASRMESHGVPSRIHVSPTTYKVLTEKCADKGYKFEGRGEINIKGKGLMSTYFLLGHA 558          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A1I8IZT5 (Guanylate cyclase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 312/579 (53.89%), Postives = 402/579 (69.43%), Query Frame = 2
Query:  368 EAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNET----------------DSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV---------------------------KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLA----LEYVFEGRGEVEIKGKGLMKTYFLLG 1963
            E FG  FFKY K+HGY KMI  LG D++ F++NLD+LH+Y  +  KSM+ PSFS + + + E ILHY S+R GL  WIKGML  +AKE F TEIQ K++   TD  PESR++ H+ I+I       + S + L  S+    +P YP KSL+  +  V + PYHIIFDS+L+++QSG  +Q +C  L+ +   V+ L+++  L+ P V F +  I+RF+NS+FT  L R+ ++   E+                +S +L+ GQ+ F++D + FLF+ SPR+MTLSEM EKN+F+SD+PLYDVTRELL VNQQRLAE+EISKH++EMTN+++K T+ LE+EK + + LL QMLP KVA+QLL GKRV                            AEK+++CTILFSDIVTFT IASQC PM++VDMLN LYSLFDKA+E N  YKVETIGDAYMVV GVPE T +HA  ++EQAMDM+EAS +V SPV+   LQIRVG+H+GP VAGVVG+KMPRFCLFGD VNVASRMESHG+P RIH S +TY+ L        Y FEGRGE+ IKGKGLM TYFLLG
Sbjct:    3 EMFGSHFFKYFKKHGYDKMIYTLGQDLKKFIQNLDSLHDYLQIDNKSMVPPSFSCNYEDSGEFILHYYSARAGLESWIKGMLTTVAKEIFSTEIQLKVMDIDTDFPPESRYQTHVRILIS------FASHSSLAASLDDFVQPCYPSKSLITVKSFVRYFPYHIIFDSLLFIKQSGAAIQSVCQTLRFKD-SVVKLTEVCELVNPPVNFSSHYIKRFLNSSFTLRLKRSIEDDCTESSLLIKGKGWGGRCVSRESSLLINGQMIFMEDTNLFLFVCSPRVMTLSEMMEKNIFMSDLPLYDVTRELLQVNQQRLAEIEISKHMDEMTNEMKKMTAELEDEKKKTHTLLSQMLPSKVAKQLLEGKRVAAGERTRDIPSVSPFCWTAASGGAILTSAEKYEICTILFSDIVTFTDIASQCTPMNIVDMLNNLYSLFDKATEVNKVYKVETIGDAYMVVGGVPERTDQHAHFVSEQAMDMIEASCRVASPVTNLPLQIRVGMHTGPTVAGVVGDKMPRFCLFGDTVNVASRMESHGVPSRIHVSPTTYKVLTEKCADKGYKFEGRGEINIKGKGLMSTYFLLG 574          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A1I8GHI0 (Guanylate cyclase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 277/509 (54.42%), Postives = 351/509 (68.96%), Query Frame = 2
Query:  347 LTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQ 1873
            ++ DE  E FG+ FFKY KRHGY KMI  LG D++ F+ NLD+LH+Y  +  K M+ PSFS+    +   + ++ +  +   P   GML  +AKE F TEIQ K++   TD   ESR+R H  ++I       + S   L  S+   F+P  P  S +  R  +   PYHI+FD  L VRQSG  +Q +C  L+     V  L+ +  L+ P V F A  IRRF+NSAFT LL R  +  + ET   +LL+GQ+  +DD   FLF  SPR++TL EM EK L +SD+PLYDVTRELL VNQQRLAE+ IS+ L+EMT Q+++ T+ LE EK +   LL QMLP KVA+QLL+GK+VKAEK+ +CTILFSDIVTFT IASQC PMDVVDMLN+LYSLFD A+E N  YKVETIGDAYMVV GVPE T  HAE++ EQAMDM+EA+ KV SPV+ K LQ+R+GIH+GP VAGVVG+KMPRFCLFGD VNVASRMESHG+P R+H S   ++
Sbjct:    1 MSKDELYEMFGRYFFKYFKRHGYDKMIYTLGQDLKKFIRNLDSLHDYLQIDNKGMVPPSFSVIDMGD---VANFQALGRSPDPDPSGMLSTVAKEIFGTEIQLKVLNIETDFPAESRYRTHAKLLIT------FSSTGSLAVSLEDYFQPWCPAHSHITVRSFIRHFPYHIVFDEQLLVRQSGVGIQTVCHALRSPSEPV-RLTDVCDLVNPPVAFTASFIRRFLNSAFTLLLRRGPEETSPET--SLLLKGQMIHMDDTQLFLFFCSPRVLTLCEMMEKRLCMSDLPLYDVTRELLQVNQQRLAEIGISRQLDEMTYQMRRMTAELEVEKQKTYTLLSQMLPAKVAKQLLDGKKVKAEKYDICTILFSDIVTFTDIASQCTPMDVVDMLNSLYSLFDHATEVNRVYKVETIGDAYMVVGGVPERTVLHAELVCEQAMDMLEAAGKVCSPVTKKPLQVRIGIHTGPTVAGVVGDKMPRFCLFGDTVNVASRMESHGLPNRVHVSPEAHE 497          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A1I8H552 (Guanylate cyclase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 534.258 bits (1375), Expect = 1.042e-180
Identity = 271/493 (54.97%), Postives = 341/493 (69.17%), Query Frame = 2
Query:  347 LTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRME 1825
            ++ DE  E FG+ FFKY KRHGY KMI  LG D++ F+ NLD+LH+Y  +  K M+ PSFS+    +   + +  +  +   P   GML  +AKE F TEIQ K++   TD   ESR+R H  ++I       + S   L  S+   F+P  P  S +  R  +   PYHI+FD  L VRQSG  +Q +C  L+     V  L+ +  L+ P V F A  IRRF+NSAFT LL R  +  + ET   +LL+GQ+  +DD   FLF  SPR++TLSEM EK L +SD+PLYDVTRELL VNQQRLAE+ IS+ L+EMT Q+++ T+ LE EK +   LL QMLP KVA+QLL+GK+VKAEK+ +CTILFSDIVTFT IASQC PMDVVDMLN+LYSLFD A+E N  YKVETIGDAYMVV GVPE T +HAE++ EQAMDM+EA+ KV SPV+ K LQ+R+GIH+GP VAGVVG+KMPRFCLFGD VNVASRME
Sbjct:    1 MSKDELYEMFGRYFFKYFKRHGYDKMIYTLGQDLKKFIRNLDSLHDYLQIDNKGMVPPSFSVIDMGD---VANSQALGRSPDPDPSGMLSTVAKEIFGTEIQLKVLNIETDFPAESRYRTHAKLLIT------FSSTGSLAVSLEDYFQPWCPAHSHITVRSFIRHFPYHIVFDEQLLVRQSGVGIQTVCHALRSPSEPV-RLTDVCDLVNPPVAFTASFIRRFLNSAFTLLLRRGPEETSPET--SLLLKGQMIHMDDTQLFLFFCSPRVLTLSEMMEKRLCMSDLPLYDVTRELLQVNQQRLAEIGISRQLDEMTYQMRRMTAELEVEKQKTYTLLSQMLPAKVAKQLLDGKKVKAEKYDICTILFSDIVTFTDIASQCTPMDVVDMLNSLYSLFDHATEVNRVYKVETIGDAYMVVGGVPERTVQHAELVCEQAMDMLEAAGKVCSPVTKKPLQVRIGIHTGPTVAGVVGDKMPRFCLFGDTVNVASRME 481          
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Match: A0A1S3IRP6 (guanylate cyclase soluble subunit beta-2 OS=Lingula unguis OX=7574 GN=LOC106166546 PE=3 SV=1)

HSP 1 Score: 540.806 bits (1392), Expect = 1.826e-180
Identity = 303/693 (43.72%), Postives = 432/693 (62.34%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCE-MILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYG--------SLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPL---KDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLL-------FRNYKNLTNETDSGILLRGQICFLDDN-DCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLGRGVTHKNGERKIPV--------------ENVSQCNAAVKCNAKEKSRTAEISNNHNDSPIKYSQAHKSALCRIV 2143
            M G IH+C++ LV+ K GEE WE ILE A CD++ DF+VFH Y D     L+ AV+  L++  +  LE FG+ FF+Y   +GY KM+  LG D+ +F++NLD+LH   A++ K++ APSF  +  S  + +ILHY S RKGLYP + G++  + K  F ++   ++I+   DN  E   + H+V  ++   +A+          +L + +KS+ + F PK+P +  ++       LPYH++FD  + + QSG  +QK+C  L     + HD         L+ P +P  + +I RFIN+ F   +         N K +         ++GQ+  LD +    +FI SPR+ +L+E+ E+N+FLSDIPLYDVTREL+L+NQQR+AE+EISK L+E T +L++T + L  EK + + LL QMLP KVA QL  G+ V+AEKF   TILFSDIVTFT+IA+ C P+ +V+MLN LYS FD  +  +G YKVETIGDAYMVVAGVP+    HAE IA  A+DMVEA+ +V SP +G+ LQIRVG+H G VVAGVVG+KMPR+CLFGD VN ASRMESHG+PG+IH S S  + L    Y+FE RG +EIKGKG M T+FL+GR     NGE ++ +               N+++ NA++K     +     +S++ ND     S+ ++S  C I+
Sbjct:    1 MYGQIHVCVRSLVIKKFGEEVWETILEKAQCDDTTDFMVFHRYTDQKTIGLVVAVSQVLDVPLEAVLELFGEYFFEYCLDNGYDKMLRTLGEDLPSFIQNLDSLHSLLAMSYKNIEAPSFRCEANSGEDTLILHYYSRRKGLYPIVIGLVRAVGKHLFNSDCTLEVISKTDDNPMEENSQDHVVFRVKVTDQAEKEDESKCRELALTQKEKSLRS-FVPKFPRRIHIDPSSFCKALPYHVVFDGTMTILQSGVQMQKICPDLMKPGGKLHDYF------ELVHPRMPLTSENIIRFINANFILQIKESMCGEVTNGKAVVPLRSKAFPIKGQMILLDQSVGHIMFICSPRLTSLTELMERNIFLSDIPLYDVTRELILLNQQRIAEIEISKKLDETTAELKRTATALNREKQKTDSLLYQMLPRKVADQLREGRTVEAEKFSEVTILFSDIVTFTNIAAACAPISIVEMLNELYSRFDALTSKHGVYKVETIGDAYMVVAGVPDSVPDHAERIANMALDMVEAAGEVISPATGRPLQIRVGMHLGGVVAGVVGKKMPRYCLFGDTVNTASRMESHGVPGKIHVSPSAREKLDNKPYIFEERGLIEIKGKGEMVTFFLIGR-----NGEVRLELMKDNNTTVRGGTLDTNLAEPNASLKWVDSHR-----MSSDQNDR--TGSRQNESRTCTII 674          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 487.649 bits (1254), Expect = 1.536e-162
Identity = 248/610 (40.66%), Postives = 375/610 (61.48%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKS------------ISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLL 1960
            M G I+ C++ LV++K GEE WE++   A   ++  F+ +  Y D I   L++     L+++++  L+ FG+ FF + K  GY  M+  LGG++  F+ENLDALH Y A++ + M APSF +++ ++   +LHY S RKGL+  + G++  +AK+FF +++   I+    +     + R+H++ ++    E   G  A L+              I  +F P+YP +  +  +   N  P+HI+FD  L V+ +G  +QK    L   Q     L +  S++ P V  +  SI++FINS F     R     + +  + + LRGQ+ +++   C +++ SP++ +L E+EE+ L L+DI  +D TR+L+L+NQQRLAE+E+S  L     +L+  +  LE EK +   LL  MLP  VA QL  GK+V A +F++CTILFSD+VTFT+I + C P+ +V MLN++YS FD+ +  +  YKVETIGDAYMVV GVP     HAE +A  A+ M  A+ +V +P++GK +QIRVG+H+GPV+AGVVGEKMPR+CLFGD VN ASRMESHG+P  IH S  TY  L    +    RGE+++KGKGLM TYFL+
Sbjct:    1 MYGFINTCLRTLVVEKFGEETWEKLRLLAEVQDT--FMTYEIYDDVITLRLVQEACKMLDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEEMNAPSFRVERTNDGRTLLHYYSDRKGLHYIVPGIIEAVAKDFFGSKVTMTILEQPKEQERTGK-REHVIFLMTQTSEGAKGEEAHLNGGDGTVERKVMSDHIQHSFCPRYPKRLWIEEQAFCNAFPFHIVFDQNLVVKHTGVNIQKFVPGL---QKTGCRLDEYFSVVHPEVTLNIHSIKKFINSQFVLKTRREMLPESLQNQTMLKLRGQMVWMESLHCMVYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQLERKKEELRILSRNLEVEKKKTETLLYAMLPRHVANQLKEGKKVDAGEFKVCTILFSDVVTFTNICAACEPIQIVHMLNSMYSRFDRLTNVHDVYKVETIGDAYMVVGGVPIPKDTHAERVANFALGMRIAAREVTNPITGKPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHLSPFTYSALKDKMFEIRERGEIQVKGKGLMDTYFLI 604          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 486.878 bits (1252), Expect = 3.476e-162
Identity = 248/611 (40.59%), Postives = 375/611 (61.37%), Query Frame = 2
Query:  164 SMLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKS------------ISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLL 1960
            S  G I+ C++ LV++K GEE WE++   A   ++  F+ +  Y D I   L++     L+++++  L+ FG+ FF + K  GY  M+  LGG++  F+ENLDALH Y A++ + M APSF +++ ++   +LHY S RKGL+  + G++  +AK+FF +++   I+    +     + R+H++ ++    E   G  A L+              I  +F P+YP +  +  +   N  P+HI+FD  L V+ +G  +QK    L   Q     L +  S++ P V  +  SI++FINS F     R     + +  + + LRGQ+ +++   C +++ SP++ +L E+EE+ L L+DI  +D TR+L+L+NQQRLAE+E+S  L     +L+  +  LE EK +   LL  MLP  VA QL  GK+V A +F++CTILFSD+VTFT+I + C P+ +V MLN++YS FD+ +  +  YKVETIGDAYMVV GVP     HAE +A  A+ M  A+ +V +P++GK +QIRVG+H+GPV+AGVVGEKMPR+CLFGD VN ASRMESHG+P  IH S  TY  L    +    RGE+++KGKGLM TYFL+
Sbjct:    6 SQYGFINTCLRTLVVEKFGEETWEKLRLLAEVQDT--FMTYEIYDDVITLRLVQEACKMLDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEEMNAPSFRVERTNDGRTLLHYYSDRKGLHYIVPGIIEAVAKDFFGSKVTMTILEQPKEQERTGK-REHVIFLMTQTSEGAKGEEAHLNGGDGTVERKVMSDHIQHSFCPRYPKRLWIEEQAFCNAFPFHIVFDQNLVVKHTGVNIQKFVPGL---QKTGCRLDEYFSVVHPEVTLNIHSIKKFINSQFVLKTRREMLPESLQNQTMLKLRGQMVWMESLHCMVYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQLERKKEELRILSRNLEVEKKKTETLLYAMLPRHVANQLKEGKKVDAGEFKVCTILFSDVVTFTNICAACEPIQIVHMLNSMYSRFDRLTNVHDVYKVETIGDAYMVVGGVPIPKDTHAERVANFALGMRIAAREVTNPITGKPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHLSPFTYSALKDKMFEIRERGEIQVKGKGLMDTYFLI 610          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000013658.2 (pep primary_assembly:Astyanax_mexicanus-2.0:17:5336467:5343990:1 gene:ENSAMXG00000013166.2 transcript:ENSAMXT00000013658.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 441.039 bits (1133), Expect = 2.529e-145
Identity = 237/565 (41.95%), Postives = 341/565 (60.35%), Query Frame = 2
Query:  365 LEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSIST-------------------------------NFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNET--DSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLL 1960
            L+ FG+ FF++ KR GY  M+  LG ++  F+ENLDALH Y +++ K M APSF ++K S+  M+LHY S R+GL   + G++G +AK+FF + I+ KI+    +     + ++H+V +I      +  S +    S  T                                F P YP++  ++ +   N  P+HI+FD  L VRQ+G  +QK+   L   Q   I L +  +++ P V F   SIR+FINS F   + +  + +  E+  D+ +L   + C    +       SP + +L E+EE+ ++LSDI  +D TR L+L+NQQRLAEME+S  L     +L++ +  LE EK +   LL  MLP  VA QL  GK+V+A +F+ CTILFSD+VTFT+I SQC P+ +V MLN++Y  FD+ +  +  YKVETIGDAYMVV GVP   S H E +A  A+ M+ AS +V +P++G  +QIRVG+HSGPV+AGVVGEKMPR+CLFGD VN ASRMESHG+P +IH S + Y  L    +  E RGE+++KGKG M+TYFL+
Sbjct:    7 LKLFGEYFFEFCKRSGYDHMMRTLGANLFEFIENLDALHGYLSISYKEMNAPSFRVEKNSDGTMLLHYYSDRRGLCHIVPGIIGAVAKDFFNSRIEMKIVNQMEEVERTGK-KEHVVFLITQHFPDKICSKSTSSPSQQTQKPSGCRHNKVHINKQVGDEYNLFFSGKLLRGFEPVYPNELCIDLKTFCNAFPFHIVFDEELRVRQAGVAVQKIVPGL---QTMGIQLDQYFTILHPEVTFTIASIRKFINSHF---VLQTRREMMPESWKDTPML---ECCGWPLSAACSTRASPLLRSLQELEERRMYLSDIAPHDATRHLILLNQQRLAEMELSSQLERKKEELRQLSQHLEQEKQKTENLLYAMLPKHVANQLKEGKKVEAGEFKECTILFSDVVTFTTICSQCEPIQIVIMLNSMYLKFDRLTTVHNVYKVETIGDAYMVVGGVPIPVSSHGERVANFALGMIIASKEVTNPITGGPIQIRVGLHSGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGLPDKIHVSPNVYYALRDKGFQLEERGEIDVKGKGRMRTYFLV 561          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: gucy1b1 (guanylate cyclase 1 soluble subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-090313-160])

HSP 1 Score: 294.664 bits (753), Expect = 1.100e-90
Identity = 183/551 (33.21%), Postives = 297/551 (53.90%), Query Frame = 2
Query:  374 FGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSF-SIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKN---------LTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFD---KASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            FGK FF++ +  GY  ++  LG ++R FL+NLDALH++       M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI+ K+I   ++         H+  +I+ K   +     +LD      F      ++ ++        P+H++FD  L + Q G  + ++   L   Q  V  LS + SL+ P + F    I   IN+ F         N         LT    S + L+GQ+  L + +  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T+ L             +      +LPP VA +L + + V A+++   TILFS IV F +     AS    + +V++LN +Y+ FD    + ++   YKVET+GD YM V+G+PE  + HA+ I   A+DM+E + +V+  V  + +QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L ++E     +  E RG + +KGK   MK +FL
Sbjct:    2 FGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQQKSEEC------DHIKFLIEEKDSEEEAFYEDLD-----GFEENGTQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIFRV---LPQLQPGVCNLSSVFSLVRPHIDFSFHGILSHINTVFVLRSKEGLLNVEMAECEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDLLPHP----------IITPTTPLLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTKFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAQSICHLALDMMEIAGQVK--VDEEPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFNLEYRGPITMKGKKEPMKVWFL 526          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000045584.1 (soluble guanylate cyclase 88E-like [Source:NCBI gene;Acc:103027224])

HSP 1 Score: 301.212 bits (770), Expect = 2.397e-90
Identity = 204/679 (30.04%), Postives = 347/679 (51.10%), Query Frame = 2
Query:  155 LTLSMLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQF-----KIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQ-HDVILLSK-----IASLIV--PAVPFDAVSIR----------RFINS----------------AFTFLLFRNYK--NLTNETDSG------ILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISK-HLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLGRGVTHKNGERKIP---VENVSQCNAA 2032
            L++SM G +   + + + +  G++ W+ + E A+      F+    Y +S+   + +A +       +E + ++G  F  +  ++GY ++++ LG  +R F+  LD LHEY   +   +  P+F   ++S   + LHY S RKG   +  G L  + K+F+ T+I       +++   +       F       IQ + E +   L      I+++F                   P++I+F   + V   G  L  +   L  ++ +D  LL++       ++I+  P   F+ +S            R  NS                AF  ++  +YK  N  N  +S       + L+GQ+ ++ + +  +F+G+P + +LS M +  L+++D+ ++D +R+L+L   Q+  E++ +     + +++L+++  +L+ E  + + LL +M+P  VA++L  G+      E F   TILFSD+V FT I S   PM VV MLN +Y+LFD  SE +  +KVETIGDAYMVVAG PE T  HA  I + A+DMV + + ++ P +G ++QIRVGIHSG VVAGVVG KMPR+ L GD V+ AS MES+G    I  S +TY+ L    ++FE RG + IKG   ++TY+L G+     N +   P    + +S+  A+
Sbjct:   31 LSVSMYGLLCESLHDFIKESYGDDVWKLVRERADV-RLHSFVTHQVYSESVIPRIAKAASGVTGTPYNELMNSWGVYFLGFVGKYGYDRILKVLGRHVRDFVNGLDNLHEYLRFSYPKVQPPTFFCQEESATGVTLHYRSKRKGYLHYAMGQLRQMGKQFYDTDIHVEVLSEQLVGDYSHVTMRLNFDNSAYRYIQKEDEEEQEILP-----ITSDF--------------FFEVFPFNIVFRQDMVVHNVGSGLATVFPDLDGKKINDAFLLARPLVEFTWNMIISHPNNLFEIMSKEPVKRERNLHNRVQNSDYENANRSADVDVELMAFQSIIGDDYKDGNSANAMESWGDGSRCLKLKGQMRYMPEWESIIFLGTPVMESLSAMFKTGLYINDLSMHDSSRDLVLAGTQQSEELKRALIQEQKKSSKLEESMKMLDYEMKKTDDLLYRMIPKPVAKRLRKGEPAVNTCEVFPDVTILFSDVVGFTRICSHITPMQVVSMLNTMYTLFDTLSEKHRVFKVETIGDAYMVVAGAPEKTKYHAHNICDMALDMVRSIDHLKDPSNGNNIQIRVGIHSGMVVAGVVGHKMPRYGLHGDTVHTASAMESNGKEMHIQLSSATYEHLKGSHFIFERRGTITIKGNVEIETYWLKGKRDKDGNAQAACPQFEAQTISKAAAS 689          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 340.502 bits (872), Expect = 6.342e-111
Identity = 182/363 (50.14%), Postives = 243/363 (66.94%), Query Frame = 2
Query:  875 LYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLG 1963
            L V+Q+G  +QK    L+      I L +  ++  P V F   SIR+FINS F     R        +   + LRGQ+ +++ +   L++ SP + +L E+EE+ L +SDI  +D TR+L+L+NQQRLAEME+S  L     +L+  +  L+ EK +   LL  MLP  VA QL  GK+V+A +F++CTILFSD+VTFT+I + C P+ +V MLNA+Y  FD+ +  +  YKVETIGDAYMVV GVP     HAE +A  A+ MV A+ +V +PV+G ++QIRVGIHSGPV+AGVVGEKMPR+CLFGD VN ASRMESHG+PGRIH S ST + L   E+  E RGE+E+KGKG M TYFLLG
Sbjct:    1 LRVKQAGVNIQKFVPGLQTMD---IRLDEYFTIGHPEVTFTIESIRKFINSQFVLKTRREMLPEARRSQPMLDLRGQMVWMEGSRSMLYLCSPLLRSLEELEERQLHISDIAPHDATRDLILLNQQRLAEMELSTQLERKKEELRVLSKNLQVEKKKTEALLYAMLPHHVANQLKEGKKVEAGEFKVCTILFSDVVTFTNICAVCEPIQIVHMLNAMYMRFDRLTTVHNVYKVETIGDAYMVVGGVPIPVPSHAERVANFALGMVLAAREVTNPVTGSAIQIRVGIHSGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGLPGRIHLSPSTREALQGKEFDVEERGEIEVKGKGRMSTYFLLG 360          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002650.1 (pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 gene:ENSPMAG00000002416.1 transcript:ENSPMAT00000002650.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.601 bits (514), Expect = 1.937e-57
Identity = 112/239 (46.86%), Postives = 145/239 (60.67%), Query Frame = 2
Query: 1274 SKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVP-EVTSRHAEIIAEQAMDMVEASNKVRSPVSGK-SLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL-EYVFEGRGEVEIKGKGLMKTYFLLGRGVTHK 1981
            SKHL  +  +  +   L   EK + + LL  MLP ++A  L  G+  KA+ +   T+ FSDIV FT ++S   P +VVD LN LY+ FD   ++   YKVETIGDAYMVV+GVP E  ++HA   A  A+D+V        P   +  L+IR GIH+GPVVAGVVG KMPR+CLFGD VN ASRMES     +I CS ST   L  +  Y+   RG V +KGKG M T++L GR  + K
Sbjct:  267 SKHLESVVTERTQDLVL---EKQKTDRLLYSMLPKQIADDLRQGRVTKAQSYASATVFFSDIVGFTQLSSSSTPYEVVDFLNKLYTSFDGIIDNYDVYKVETIGDAYMVVSGVPTENHNQHAVETANMALDLVNVCQAFVIPHKPEMQLKIRAGIHTGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSPSTSSILQQIGSYLLSCRGTVTVKGKGEMITWWLEGRDTSTK 502          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.223 bits (526), Expect = 7.119e-57
Identity = 115/240 (47.92%), Postives = 160/240 (66.67%), Query Frame = 2
Query: 1256 LAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSR-HAEIIAEQAMDMVEA--SNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-YVFEGRGEVEIKGKGLMKTYFLLG 1963
            L+ ME  ++ N +   +++ T     EK +   LL Q+LP  VA+QL  G+ V+AE F   TI FSDIV FTS++++  PM VV +LN LY+ FD   ++   YKVETIGDAYMVV+G+P    + +A+ IA  ++ +++A  + K+R     K L++R+GIH+GPV AGVVG KMPRFCLFGD VN ASRMES+G   +IH S +T + L     +  E RG+VE+KGKG M+TY+LLG
Sbjct:  583 LSRME--QYANNLEELVEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLDAVKTFKIRHRQEDK-LKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWLLG 819          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 200.29 bits (508), Expect = 1.472e-56
Identity = 113/244 (46.31%), Postives = 152/244 (62.30%), Query Frame = 2
Query: 1256 LAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVP-EVTSRHAEIIAEQAMDMVEASN--KVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL-EYVFEGRGEVEIKGKGLMKTYFLLGRGVT 1975
            L+ ME  ++ N +   +++ T     EK +   LL Q+LP  VA+QL  G+ V AE F   TI  SDIV FT++++Q  PM VV  LN LY+ FD   ++   YKVETIGDAYMVV+G+P    +RHA  +A  A+ ++ A     +R     + L +R+GIH+GPV AGVVG KMPR+CLFGD VN ASRME+ G   RIH S +T   L     +V +  G+V+IKGKG M+TY+LLG   T
Sbjct:  266 LSRME--QYANNLEELVEERTQAYLEEKGKAEALLYQILPHSVAEQLKRGETVPAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVHNGTRHAIEVARMALALLSAVRCFHIRHR-PAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWLLGENPT 506          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007957.1 (pep scaffold:Pmarinus_7.0:GL476724:304294:325245:1 gene:ENSPMAG00000007197.1 transcript:ENSPMAT00000007957.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.563 bits (449), Expect = 2.180e-51
Identity = 97/223 (43.50%), Postives = 138/223 (61.88%), Query Frame = 2
Query: 1304 LQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE---YVFEGRGEVEIKGKGLMK--TYFL 1957
            L++T   LE EK R   LL  + P  VA+ L  G  + A KF   T+LFSDIV FT+I +QC P+ V+ MLNALY+ FD        YKVETIGDAY V  G+ + ++ HA+ +A  A+ M++ + KV +P  G+ +++R+G+HSGPV+AGVVG  MPR+CLFG+ V +A+R ES   P R++ S +T++ L   E   +    RGE+     G +    YFL
Sbjct:    2 LEQTRRALEEEKKRTVDLLDSIFPGDVARCLWQGLAMPARKFDDVTVLFSDIVGFTAICAQCTPLQVIGMLNALYTRFDHQCGLLDIYKVETIGDAYCVAGGLHKPSAEHAQRVAWMALRMIDLAQKVLTP-DGEPIKMRIGLHSGPVLAGVVGVNMPRYCLFGNNVALANRFESGSHPCRVNVSPTTHRLLSGDEGFRFTPRSRGELPANFPGDVPGICYFL 223          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO47086 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN72])

HSP 1 Score: 386.726 bits (992), Expect = 8.470e-126
Identity = 224/590 (37.97%), Postives = 335/590 (56.78%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCD-NSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQ---------SKIEAQ-YGSLAELDKSISTNFRPKYPH-KSLVNARHMVNFL------PYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTN---ETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIAS--QCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDST 1867
            M G IH  + +LV+ K GEEAW+ I++ A  + +   +L+   Y D     L+ A      L  D  LE FG  FF Y ++ GY ++++ LG ++R FL NLDALH++ A     M APSF   +  N  ++LHY S R GL   + G++  IAK+  +TE+   I     + N       H+   I+         SK+  Q + S  E +K    N R K    KS  + +  +N L      P+H++FD  L+++Q+G  L ++    K + +D +  + +  +  P + F   ++   IN+ F          L +    TD+ + L+GQ+ ++ D+DC LF+ SPR+  +  + EK L+ SDIP++D TR+LL ++  R AE E+ + L E +N L+K  S L   K R + LL  +LP +VA +L   + V AE ++  TILFSDIV FT++ S  +  PMD+V MLN LY+ FD  S  N  YKVETIGDAYMVV G+P     HA+ +A   + M+EA++ V SPV  + L+IR+GIH+GPV+AGVVG+KMPR+CLFG+ V +A++MES   PGRI+ S  T
Sbjct:    1 MYGFIHCALADLVIGKFGEEAWKDIIKKAGVELDGGSYLIHKIYDDEETLRLVGAACEATGLELDTVLEVFGAHFFAYCEKSGYDRILKVLGRNLRDFLCNLDALHDHLATIYPGMEAPSFRCTETDNGTLLLHYYSKRPGLSYIVIGLVKAIAKQLLETEVNVTIHQDIDEEN------DHVTFAIREAENKHSSGSKLGLQTFASGHETEKE--ANKRSKDASVKSETHKKREMNLLSFCKAFPFHVMFDRKLHIKQAGLSLTRIM--TKQKLNDTLKFTDLFRISRPRMEFSFQAVISHINTVFVVTTKAGAVQLPDNIESTDASLRLKGQMLYVPDSDCLLFLCSPRVKNMDSLREKGLYFSDIPVHDATRDLLFLSHARRAERELVEKLEETSNNLKKVESKLIEHKKRTDDLLYSILPKEVAAKLRLNQSVPAESYKTVTILFSDIVGFTALCSNDKIVPMDIVKMLNRLYTYFDMLSGMNDVYKVETIGDAYMVVGGLPHPCEDHADRVASMGLGMMEAADVVLSPVDREPLKIRIGIHTGPVMAGVVGKKMPRYCLFGNTVTLANKMESGTQPGRINISIDT 580          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO47083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN69])

HSP 1 Score: 354.755 bits (909), Expect = 2.659e-111
Identity = 209/625 (33.44%), Postives = 345/625 (55.20%), Query Frame = 2
Query:  173 GHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSI-DKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFL-----LFRNYKNLTNET-------DSGIL-LRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASED--NGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKGLMKTYFLLGRGVTHKN 1984
            G ++  ++ LV+   G   WE I  AA  +    FL    Y D + ++L+ A    L++     LE FG+ FF + +  GY ++++ LGG +R F+ NLDALH++       M APSF + D++S+  +ILHY S R GL P + G++  +A++   TE+  +++     +  + +F    +       ++Q  +   +  S   +  PK    +   A       P+H++F+  L V Q+G  + ++   L     D   +S+I  LI P + F   +I   IN+ F        L +   N+ N+        DS  L L+GQ+ ++ ++D  +F+ SP +  L ++ +  L+LSDIPL+D T++L+L+++Q  AE  +++ L  +T++L++T + L  +K   + LL  +LPP VA +L + + V+AE+ +M T+LFS IV F  I     PM++V +LN +Y+ FD  ++   N  YKVET+GD YM V+G+PE  + HA  I   A+DM   +  +     G  +QI++GIHSG VVAGVVG K PR+CLFG+ VN+ SR E+ G PG+++ ++ TY+ LL  E     +VFE RG V +KG+      +LL R   H++
Sbjct:  101 GFVNHALELLVVRNFGVAKWEEIKRAAELEIEGHFLQRIIYDDVMTYSLVGAATRVLDIETSAILEKFGEMFFDFCQESGYDRILQVLGGTLRDFIGNLDALHDHLGSIYPGMRAPSFRVSDRESDGALILHYYSERDGLEPIVVGIVKTVARKLLNTEVSVEVVKGKEYDGDDVQFVIKEISDRGRDCDSQVKNYDPIKDSFQLSNEPKISPATFCKA------FPFHLMFNRDLKVTQAGESVSRVVPSLTPGDAD---MSEIFELIRPQLRFTYEAIIAHINTVFVLRTREGKLSKPANNMCNKNGCCKLCWDSLPLRLKGQMVYIPESDNMIFLCSPSVGNLEDLADVGLYLSDIPLHDATKDLILLSEQFKAEYVLTQQLEILTDKLRQTHNALAEKKQLTDQLLYSVLPPSVANELRHNRPVQAERAEMVTLLFSGIVDFAQICKNSKPMEIVMLLNNIYTKFDMLTDPSINDVYKVETVGDKYMAVSGLPERCAFHARSICNMALDMKHVTQSIIH--KGDKIQIKIGIHSGEVVAGVVGHKTPRYCLFGNTVNLTSRTETTGAPGQVNITEFTYRCLLEPECQDPSFVFERRGPVAMKGRQEPMVTYLLTRDPRHRS 714          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO47084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN70])

HSP 1 Score: 333.183 bits (853), Expect = 1.348e-104
Identity = 208/619 (33.60%), Postives = 341/619 (55.09%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCD--NSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKS-NCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFR--PKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LLFRNYKNLTNETDSGIL------LRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCN-PMDVVDMLNALYSLFDKASEDN-GAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL---EYVFEGRGEVEIKGKG-LMKTYFL 1957
            M G ++  +++LV+   G + W+ ILE AN D  +SR+F     Y D    +LL      + L+ +  LE FG  FF++    GY  MI +LGG++  F  +LD LHE   +    M  PSF   + + N ++ L Y S R GL   + G++  +A + +  ++  ++ + ++ +   + F     ++ Q + E +Y  +   D ++    +        S +         P+H +FD  + + Q+G     LC  L   +     L+ I   I P +     +I ++IN  +       LL     +  +E D G L       RGQ+ +L + +  +F+ SP ++ L  + EK L++SDIP++D TR+L+L+++Q  AE ++S+ L  +T++LQ+T+  LENE+   + LL  +LP  VA  L   K V A K+++ TI+FS IV FT+  ++   PM++V+MLN +Y+ FD+ ++ N   YKVET+GD YM V+G+P    +HA  IA  A+DM++ S  +++   G  LQ+ +GIHSG VVAGVVG+K PR+CLFG+ VN+ SR E+ G+ G+I+ S+  Y+ LL     ++VF+ RG V +KGK   M TY L
Sbjct:    1 MYGFVNRALQDLVIQGYGPDVWKEILEKANLDLGDSREFNERRIYDDQNTSDLLIVAEDVIGLSKNAILERFGDAFFEHCIGSGYDSMIRSLGGNLMDFFNSLDGLHEQLLLLYPGMRPPSFRAKQHNINMKLELVYTSERSGLEYMVVGLVKTVASKLYGIQVNVELASMSSKDQSWAMF----YVLPQHQDEMKY--ILPTDTTLERTMKELSIMTLSSRIGTAAFCRACPFHAVFDQRMVIYQAGI---SLCRVLPAVRVGKSKLTDIFESIRPPIKLTFDNILQYINKVYVIKTKSGLLDSASLSTVSEDDYGNLESPSMRFRGQMMYLPECNSIMFLASPSVVNLDGLNEKGLYMSDIPIHDATRDLILLSEQHNAEFKLSQRLEILTDKLQQTSRELENEQQLNDRLLYSILPASVANDLRLRKPVNANKYEIVTIMFSGIVDFTNYCNKIKEPMEIVEMLNEVYTEFDQLTDSNDDIYKVETVGDKYMAVSGLPTRCDKHALNIANLALDMIDISKGMKA--KGIQLQVTIGIHSGEVVAGVVGQKKPRYCLFGNTVNLTSRTETTGLKGKINVSEYAYRCLLVQPHEQFVFKKRGPVVMKGKKEPMITYIL 608          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO43095 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZH8])

HSP 1 Score: 313.923 bits (803), Expect = 2.482e-97
Identity = 212/642 (33.02%), Postives = 322/642 (50.16%), Query Frame = 2
Query:  200 LVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVN--------ARHMVNF---LPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLT-----------------------------------NETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLS-----DIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVS-GKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLG 1963
            L+  + GE+ W +I E A       F + + Y DSIF  L+ +         +  LE+ G  F  +  + GY K++  LG  +R FL  LD LHE+   T   + APSF   +++   M LHY SSRKG   ++ G +  + K F+  +I+ +++        +   ++  V ++Q   + +          IS   RPK    S+++        + H+  F    P+H+++D  + +   G  L+ +   L   +     ++   SLI P + F   S+  F+++   F L    K L+                                    E DS I L+GQ+ ++D+     ++ +P  ++   +     FL      D+ L  + +E+ ++  + +  M+ S  L E   +L       +NEK R + LL QM+P  VA +L  G+      E F   TILFSD+V FT+I S   PM VV MLN +Y+ FDK SE +  YKVETIGDAYMVV+G+PE T  HAE +A+ A++M+ A  ++  P      L+IR+GIH+G VVAGVVG KMPR+CLFGD VN ASRMES G+   IH S+ T +FL    Y  + RG ++IKGKG MKTY+LLG
Sbjct:   13 LLTSRYGEDTWHKIRENAGV-QQHTFAIHNIYSDSIFQRLVSSAEEITGEDRNSLLESTGALFVSFIGQFGYDKILRILGRHIRDFLNGLDNLHEFMRFTYPKLKAPSFHCSEETERGMKLHYRSSRKGFLYYVVGQIREVGKMFYDQQIEVEVL-------EQHESKEGFVAVMQLYFDNR--------AFISARKRPK--RHSVISLGGETDSLSIHIDVFYEVFPFHVVYDKSMTITSVGSSLEAVLPNLVGCK-----ITDEFSLIRPFLDFSWESV--FVHTNVVFELQSRSKALSMRKNGKVQNGLLMGCPIMDALGEGVNGNHDNNHNVTEFDSRIHLKGQMMYIDEWKAMAYLATPINISTLMLINFTFFLQTYLDVDVILLFLRKEIRIILSKDVKCMQKSAKLEESMREL-------DNEKLRTDALLYQMIPKTVADRLRKGEPALNTCETFSNVTILFSDVVGFTTICSLIAPMQVVTMLNCMYTTFDKLSEKHNVYKVETIGDAYMVVSGIPERTKYHAEHVADMALNMLSAMPEIEDPAGLNDHLRIRIGIHTGTVVAGVVGLKMPRYCLFGDTVNTASRMESTGLAMAIHVSEDTQKFLAKANYALKQRGSMDIKGKGGMKTYWLLG 622          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Match: EDO40362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7B2])

HSP 1 Score: 279.256 bits (713), Expect = 1.171e-84
Identity = 186/609 (30.54%), Postives = 310/609 (50.90%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASEL-----NLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFK-TEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPH------KSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLF------RNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLN-EMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDA-YMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIK 1927
            M G +   ++  ++ K GEE W  I+  A   +S +F+    Y ++  F +  A  + L     ++T D+ +  FG  F K+   +GY  +I   G   R FL  +D+LHE+       M +P+F  D++++  + LHY S RKG   ++ G +  IA++F+  + I  KI+ + +  +  SR + H+V  ++   E                ++P  P       K  V+     +  P+ ++    + +   G  LQ L   L       +L   I  + +   P    +    +     F L       R  +     +   + LRGQ+ F+ D D FLFI SP I  L  M +  L+++D+ ++D ++E+ L   + L ++E ++    E   +L++    LE E+ R   LL +M+P  +A++L  G       E+F   T+LFS +  FTSI ++ N M  V ++N L+  FD  +E +  YK ET+GDA YM V+GVP  T  HAE +A  A+DM++A   V+ P++ K + I VGIHSGPV AG+VGE+  ++CLFGD VN+ASR+ +  +P RIH S++  + L   +++ E RGE+E+K
Sbjct:    1 MYGLLLESIRHFIVGKYGEELWSEIVNIAGT-SSHEFVTHRLYDENWIFKIANAATTVLGDLDEHITVDDCMRLFGVCFVKFFSFYGYDPIIRVSGRHFRDFLIGIDSLHEHMRFGYPKMKSPTFYCDEETSTGINLHYESRRKGFMFYVVGQVEEIARKFYGISNINVKILKNESSQS--SREQCHIVYRLEFNNEG---------------YKPPPPDFLTVGTKKAVSTEVFFSIFPFSLVISPDMTLSMFGNGLQSLLGKL-------VLGRDIREVFILRRPKTDFTWHTLLTRKVVFELLSKVPLIRRPQPKHQGSTMTLHLRGQMKFMHDWDKFLFICSPLIANLDTMLQSGLYMNDLSMHDTSQEMALSGIKPLPQLEYARDQQFEQGIELEENMRKLEEERQRSEDLLYRMVPKPIAERLKRGGNPIDTCEEFDAATVLFSYMDGFTSICTRLNAMQAVTLINNLFIKFDLLTEKHNVYKFETLGDALYMAVSGVPVRTEHHAEPMAAMALDMLKAVQLVKDPITKKPMTITVGIHSGPVAAGLVGERTLQYCLFGDTVNIASRLRTTALPMRIHISENCRECLEESDFITEFRGEIELK 584          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: gucy1b1 (fatty acid binding protein 2 [Source:NCBI gene;Acc:101170642])

HSP 1 Score: 300.056 bits (767), Expect = 2.946e-92
Identity = 194/578 (33.56%), Postives = 311/578 (53.81%), Query Frame = 2
Query:  296 PDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRT-FLENLDALHEYFAVTQKSMIAPSF-SIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTF-----LL----FRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSI----ASQCNPMDVVDMLNALYSLFD---KASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-----YVFEGRGEVEIKGKG-LMKTYFL 1957
            P  IF  ++      L++ +D   +A  K        HG H    NLG    T + +NLDALH++       M APSF   D +    +ILHY S R+GL   + G++  +A++   TEI+ K+I   ++         H+  +I+ K   +     +LD      F      ++ ++        P+H++FD  L + Q G  + ++   L   Q    +L  + SL+ P + F    I   IN+ F       LL      N   LT    S + L+GQ+ +L + +  LF+ SP +M L ++  + L+LSDIPL+D TR+L+L+ +Q   E ++++ L  +T++LQ T   LE+EK + + LL  +LPP VA +L + + V A+++   TILFS IV F +     AS    + +V++LN +Y+ FD    + ++   YKVET+GD YM V+G+PE  + HA+ I   A+DM+E + +V+  V  +S+QI +GIH+G VV GV+G++MPR+CLFG+ VN+ SR E+ G  G+I+ S+ TY+ L   E     +  E RG + +KGK   MK +FL
Sbjct:    7 PGVIFLEIIWLFGLLLHVVSDNRNQALLKVL------HGVHD--HNLGSVRWTEWFDNLDALHDHLGTIYPGMRAPSFRCTDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQQKSEEC------DHIKFLIEEKDSEEEAFNEDLD-----GFEENGTQETRISPYTFCKAFPFHLMFDKDLMLTQCGNAIYRVLPQL---QPGSCILPSVFSLVRPHIDFSFHGILSHINTVFVLRSKEGLLNVETVENEDELTGVEISCLRLKGQMIYLPEAENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASAEGAIKIVNLLNDVYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVK--VDDESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQCAENADPQFQLEYRGPITMKGKKEPMKVWFL 560          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: gucy1a2 (guanylate cyclase 1 soluble subunit alpha 2 [Source:NCBI gene;Acc:100049248])

HSP 1 Score: 235.343 bits (599), Expect = 2.917e-66
Identity = 136/371 (36.66%), Postives = 210/371 (56.60%), Query Frame = 2
Query:  773 SISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILLSKIASLIVPAV--PFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFL 1879
            S+STN     P    +         P+H++    + + Q G  L++     + E H          ++ P +   F  + +R  + S FT +  R         +  + L+GQ+  + ++   +F+GSPR+  L E+  + L+LSDIP++D TR+++LV +Q  A+  + K ++++   L++T   LE EK R   LL  + P  VAQ+L  G+ V A KF   T+LFSDIV FT++ + C PM V+ MLN LY+ FD        YK+ETIGDAY V  G+ +    HA+ IA  A+ M+E S++V +P  GK +++R+GIH+G V+AGVVG KMPR+CLFG+ V +AS+ ES   P  I+ S +TYQ L
Sbjct:  378 SLSTN-----PSDLRIGLATFCRAFPFHLVLGPHMELLQLGEGLRRQA---RIEPHRSFSFRDCFEIVSPKMEPSFQGILLR--LASPFT-IRTRPDSTQAGTKEKVMELKGQMIHVPESCSLMFLGSPRVDKLEELMGRGLYLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEKRRTVDLLYSIFPGDVAQKLWQGQPVPARKFDDVTMLFSDIVGFTAVCAHCTPMQVISMLNELYTRFDYQCGILDVYKIETIGDAYCVAGGLHKKVDSHAKPIAHMALKMMELSDEVLTP-DGKPIKLRIGIHTGSVLAGVVGVKMPRYCLFGNNVTLASKFESGSHPRCINVSPTTYQLL 736          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: gucy2g (guanylate cyclase 2g [Source:ZFIN;Acc:ZDB-GENE-130531-70])

HSP 1 Score: 218.394 bits (555), Expect = 1.217e-59
Identity = 117/236 (49.58%), Postives = 156/236 (66.10%), Query Frame = 2
Query: 1268 EISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVP-EVTSRHAEIIAEQAMDMVEASNKVRSP-VSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFL-LALEYVFEGRGEVEIKGKGLMKTYFLLGR 1966
            ++ K+ N +   +++ T+ L  EKAR + LL  MLP  +A QL++GK V+ + + M TI FSDIV FTS+ S  + M+VV  LN LYSLFD   +    YKVETIGDAYMV +G+P    ++HA  I+  A+  + A    + P +  + L IR+GIHSGPVVAGVVG  MPR+CLFGD VN ASRMES+ +P +IH S ST   L LA  +  E RGE+E+KGKG  KTY+LL +
Sbjct:  705 KLEKYANHLEEVVEERTNQLTVEKARADKLLSSMLPRYIADQLMSGKSVEPQSYDMVTIFFSDIVGFTSMCSVSSAMEVVTFLNDLYSLFDDIIKMYDVYKVETIGDAYMVASGLPISNGNKHALEISTMALHFLAAIKIFKIPHMPNEGLAIRIGIHSGPVVAGVVGTTMPRYCLFGDTVNTASRMESNSLPLKIHISQSTADILVLAGSFEMEERGEIEMKGKGFQKTYWLLKK 940          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: olgc-r2 (guanylate cyclase OlGC-R2 [Source:NCBI gene;Acc:100216004])

HSP 1 Score: 216.083 bits (549), Expect = 1.977e-58
Identity = 117/238 (49.16%), Postives = 158/238 (66.39%), Query Frame = 2
Query: 1268 EISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTS-RHAEIIAEQAMDMVEA--SNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFL--LALEYVFEGRGEVEIKGKGLMKTYFLLGR 1966
            + S +L E+   +++ T  LE EK +   LL QMLPP VA+ L+ G  VK E F   ++ FSDIV FT+I++   P++VVD+LN LY+LFD    ++  YKVETIGDAYMV +GVP   + RHA  IA  ++D++ A  + K+R  +    ++IR+G+H+GP VAGVVG  MPR+CLFGD V  ASRMES GMP RIH  +S  + L  L L Y  E RG  E+KGKG  +TY+L+GR
Sbjct:  837 QYSSNLEEL---IRERTEELEIEKQKTEKLLTQMLPPSVAEALMVGGTVKPEYFDSVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTLFDAIIGNHDVYKVETIGDAYMVASGVPVPNANRHAAEIANMSLDILSAVGTFKMRH-MPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVTTASRMESSGMPYRIHVHESIVKVLKELNLGYKLELRGRTEVKGKGTEETYWLVGR 1070          
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Match: olgc8 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100049174])

HSP 1 Score: 211.46 bits (537), Expect = 1.614e-57
Identity = 118/237 (49.79%), Postives = 146/237 (61.60%), Query Frame = 2
Query: 1274 SKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTS-RHAEIIAEQAMDMVEASNKVRSP-VSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLAL-EYVFEGRGEVEIKGKGLMKTYFLLGRGVT 1975
            SKHL  +   + + T  L +EK + + LL  MLP +VA  L  GK  +A+ +   T+ FSDIV FT ++S   P  VVD LN LY+ FD   ++   YKVETIGDAYMVV+GVP+     HA  IA  A+D+V      R P      LQIR GIHSGPVVAGVVG KMPR+CLFGD VN ASRMES     +I CS ST+  L  +  YV E RG  ++KGKG M TY+L G+  T
Sbjct:  586 SKHLEVL---VAERTQDLTHEKQKTDRLLYSMLPKQVADDLRQGKPSQAQSYVSATVFFSDIVGFTQLSSSSTPYQVVDFLNKLYTTFDNIIDNYDVYKVETIGDAYMVVSGVPQENGILHASEIASMALDLVGVCQTFRIPHKPSMQLQIRAGIHSGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSTALKIQCSSSTFYLLEEIGGYVLECRGVQQVKGKGDMVTYWLQGKKTT 819          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000035922.1 (SMESG000035922.1)

HSP 1 Score: 337.806 bits (865), Expect = 1.497e-105
Identity = 223/691 (32.27%), Postives = 366/691 (52.97%), Query Frame = 2
Query:  155 LTLSMLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPES-----RFRQHMVIIIQSKIEAQYGSLAEL---DKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILL--SKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEIS-KHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVS-GKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-YVFEGRGEVEIKGKGLMKTYFLLGRGVTHKNG--------ER-KIPVENVSQCNAAVKCNAKE----------KSRTAEI----------SNNHNDS 2095
            + L+M G I   +++ +  K GE+ W  IL +A+ D    F     Y +++  N++E+ +  LN+T DE +   G  F  +  ++GY  ++  LG D+R FL  LD LHEY   +   +  PSF    +S   + L Y + R G   +++G +  IA++F+ TE+  +I++  +++N  +      F     I I+  +        E+   +   +   R     K ++NA   +  LP+ +I +  L  R           PL +   D ++L  + I  LI       +  I R  N +       + K   +  +  + +RGQ+ ++ + D  +F+G+P +  +  M +  LF++D+ ++D +R+L+L  +Q+ AE++++ +  +E + +L+++   L+    + + LL QM+P  VA++L +G       E F   TILFSD+V FT+I S+ NP DVV+MLN LYS+FD+ +E +  YKVETIGDAYM+ +G P VT  HA  I E ++DM+++   +  P    +SLQIRVGIH+G VVAGVVG KMPR+CLFGD VN ASRMES+  P +IH S++T   +  L+ Y    RG ++IKGKG +KTY+L G  + +           ER +I + + +   + +K +  E          +SRT  I          S NH DS
Sbjct:    1 MLLAMYGLILEGVRQFICSKYGEDHWNSILRSADID-VITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLPVPSEVFFEVFPFNIVFNRGMRAINCGKGMLNA---LPDLPHQLITEYFLLTR-----------PLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHS-------SKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGEQQSAELKLALEQESEKSKKLEESLHKLDELMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDGHNLENPKAVASLITQLERERITISDSNLAGSQIKGDGWESLTHSRASSARSRTGSILELSHTKRLASINHGDS 669          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000035922.1 (SMESG000035922.1)

HSP 1 Score: 335.88 bits (860), Expect = 9.702e-105
Identity = 208/614 (33.88%), Postives = 339/614 (55.21%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPES-----RFRQHMVIIIQSKIEAQYGSLAEL---DKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQHDVILL--SKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEIS-KHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVS-GKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-YVFEGRGEVEIKGKGLMKTYFLLG 1963
            M G I   +++ +  K GE+ W  IL +A+ D    F     Y +++  N++E+ +  LN+T DE +   G  F  +  ++GY  ++  LG D+R FL  LD LHEY   +   +  PSF    +S   + L Y + R G   +++G +  IA++F+ TE+  +I++  +++N  +      F     I I+  +        E+   +   +   R     K ++NA   +  LP+ +I +  L  R           PL +   D ++L  + I  LI       +  I R  N +       + K   +  +  + +RGQ+ ++ + D  +F+G+P +  +  M +  LF++D+ ++D +R+L+L  +Q+ AE++++ +  +E + +L+++   L+    + + LL QM+P  VA++L +G       E F   TILFSD+V FT+I S+ NP DVV+MLN LYS+FD+ +E +  YKVETIGDAYM+ +G P VT  HA  I E ++DM+++   +  P    +SLQIRVGIH+G VVAGVVG KMPR+CLFGD VN ASRMES+  P +IH S++T   +  L+ Y    RG ++IKGKG +KTY+L G
Sbjct:    1 MYGLILEGVRQFICSKYGEDHWNSILRSADID-VITFGTHEVYGETLIPNIIESASRFLNMTVDEIMFLNGIFFINFVSQYGYDGILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESKTGITLQYRTRRSGYIHYVRGQITEIARQFYSTEMSIEIVSQTSEDNVSNCIMRLHFNNKNFIQIEDLLPVPSEVFFEVFPFNIVFNRGMRAINCGKGMLNA---LPDLPHQLITEYFLLTR-----------PLIEFTWDAVMLHTNNIFELIHLDPKISSSKILREGNHS-------SKKRTLSRNNPSLKMRGQMKYMPEWDAIVFLGTPIMRDVESMYKAGLFINDLSMHDSSRDLVLAGEQQSAELKLALEQESEKSKKLEESLHKLDELMKKTDELLFQMIPKSVAERLRHGSEAVDTCEHFDEVTILFSDVVGFTTICSKINPFDVVEMLNKLYSVFDELTEKHKVYKVETIGDAYMIASGCPTVTQYHAPFIIEMSLDMIKSIGFLMDPSDHSRSLQIRVGIHTGMVVAGVVGLKMPRYCLFGDTVNTASRMESNSEPQKIHISEATKAKVTDLQSYKISERGHIDIKGKGNIKTYWLDG 592          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000079311.1 (SMESG000079311.1)

HSP 1 Score: 321.627 bits (823), Expect = 8.302e-100
Identity = 199/612 (32.52%), Postives = 325/612 (53.10%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELDKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLC-DPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNLT---------NETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAEMEIS-KHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNKVRSPVSG-KSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALE-YVFEGRGEVEIKGKGLMKTYFL 1957
            M G +   +++ +    G +AW +ILE +  D +  F +   Y + +   ++   A    +T DE +   GK F  +   +GY  ++  LG D+R FL  LD LHEY   +   +  PSF    +S   + L Y + R G   +++G +  IAK F+ T I+ +II                                            K P+K       + N  P++I+F+  L V   G  ++ L  D + D   DV  +++      P +     +I    N+ F  +L    K+            E++  + +RGQ+ ++++ D  +F+G+P +  +  M +  L+++D+ ++D +R+L+L  +Q+ AE+ ++ +  +E + +L+ +   L++E  R + LL QM+P  VA +L NG++     E F   TILFSD+V FT I S   P+DVV+MLN++YS+FD+ +E +  YKVET+GDAYM+ +G P +T+ +A +IAE A++M++    +++P +  +SL+IRVGIH+G VVAGVVG KMPR+CLFGD VN ASRMES G   +I  S ST + L+    Y    RG VE+KGKG + TY+L
Sbjct:    1 MYGLLLEGIRQFICSTYGLQAWTQILEKSKLDVNV-FAIHEVYDEELLKRIVFTAADYCRITKDELMFQNGKYFISFLSHYGYDSILRVLGRDLRDFLNGLDNLHEYLRFSYPKLKPPSFFCVNESRTGITLQYRTQRAGFVHYVRGQIFEIAKTFYNTTIEIEIIGEN-----------------------------------------KMPNK-------VFNCFPFNIVFNRGLRVVNCGRGMRNLIPDIIGDYVGDVFHVNR------PIIQISWDTIILHSNNVFELILLHIKKSRLSDSDSSNSLKESNYRLRMRGQMKYMNEWDAIVFLGTPIMRDVESMWKAGLYINDLSMHDSSRDLVLAGEQQSAELRLALEQESEKSKRLEDSLKRLDDEMRRTDELLYQMIPRAVANRLRNGEKSVNTCETFNEVTILFSDVVGFTKICSNITPLDVVEMLNSMYSVFDQLTERHKVYKVETVGDAYMIASGCPVLTTLNAPLIAEMALEMIDKICTIKNPANEIESLKIRVGIHTGTVVAGVVGIKMPRYCLFGDTVNTASRMESTGETQKIQISSSTQKKLMMHNVYQIVERGVVEVKGKGNVSTYWL 557          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000051217.1 (SMESG000051217.1)

HSP 1 Score: 285.419 bits (729), Expect = 3.731e-84
Identity = 189/629 (30.05%), Postives = 313/629 (49.76%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHS-YPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELD-----KSISTNFRPKYPHKSLVNARHMV-NFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQ-HDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLF----------------RNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAE-MEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNK-VRSPV-SGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLGR 1966
            M G +   ++  V    G + W + L  A  D     +  HS Y ++I   ++ A++S LN   ++ +   G  F +Y    GY K++  LG +   F++ LD LHEY   +   +  PSF+++  +   + LHY + R G   +++G L  IAK F++ +I+                     I + SKIE  Y +    D     K          P+++    R M     P+H++    L ++  G   + +C  L +   +D  +LSK      P +      I R+ NS F  +L                  N K L++     I  +GQ+  +   +  +F+G+P I  + +++E  LFL+D+  +D  ++++L   Q+  E ME+ +   E + QL++    L   + + + LL Q +P  +A++L  G       + FQ  +I FS +V F  I S+ +   +V++LN +Y+ FD  +E    YKVETI D+YM+V+G P  T  H+  I E A+ M+  + K +++P  S  S+++ +G HSG +VAG+VG KMPR+CLFGD VN +SRM SHG P ++H SD  ++ +    Y +  RGE+EIKGKG M TYF+  R
Sbjct:    1 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS--INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIK---------------------IFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSK------PFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKQLEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESR 600          
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Match: SMESG000051217.1 (SMESG000051217.1)

HSP 1 Score: 285.034 bits (728), Expect = 6.011e-84
Identity = 189/629 (30.05%), Postives = 313/629 (49.76%), Query Frame = 2
Query:  167 MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHS-YPDSIFFNLLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLENLDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLGCIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAELD-----KSISTNFRPKYPHKSLVNARHMV-NFLPYHIIFDSMLYVRQSGYMLQKLCDPLKDEQ-HDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLF----------------RNYKNLTNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLYDVTRELLLVNQQRLAE-MEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQMLPPKVAQQLLNGKRV--KAEKFQMCTILFSDIVTFTSIASQCNPMDVVDMLNALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDMVEASNK-VRSPV-SGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVASRMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLGR 1966
            M G +   ++  V    G + W + L  A  D     +  HS Y ++I   ++ A++S LN   ++ +   G  F +Y    GY K++  LG +   F++ LD LHEY   +   +  PSF+++  +   + LHY + R G   +++G L  IAK F++ +I+                     I + SKIE  Y +    D     K          P+++    R M     P+H++    L ++  G   + +C  L +   +D  +LSK      P +      I R+ NS F  +L                  N K L++     I  +GQ+  +   +  +F+G+P I  + +++E  LFL+D+  +D  ++++L   Q+  E ME+ +   E + QL++    L   + + + LL Q +P  +A++L  G       + FQ  +I FS +V F  I S+ +   +V++LN +Y+ FD  +E    YKVETI D+YM+V+G P  T  H+  I E A+ M+  + K +++P  S  S+++ +G HSG +VAG+VG KMPR+CLFGD VN +SRM SHG P ++H SD  ++ +    Y +  RGE+EIKGKG M TYF+  R
Sbjct:    1 MYGLLVGALQHFVESLYGADIWIQALNLAEIDYQS--INTHSVYAETIIPRIVNALSSILNEAEEDIMFHNGCYFVEYLSTCGYDKILRVLGRNFVDFIQGLDNLHEYLRFSYPKIKPPSFNVESVTESTIKLHYRTKRPGFQHYVRGQLVNIAKYFYEKDIK---------------------IFLISKIEDSYQTHYTFDILLDMKGFEKTLEISIPYENFPIRRDMFFEIFPFHLVLSENLTIQHCGVGFKHICPTLLNSNFNDEFILSK------PFIDATYEKIVRYNNSNFEIILMPHTSSGPLNAALKKDKANIKRLSSIVQGRIKFKGQMLDMPLWNGLMFLGTPVIRDVKQLKEAGLFLNDLNKFDTGKDIILAGSQQSDELMELFEKQLEKSKQLEENMRDLNKFRKKTDELLYQCIPKSIAKRLRKGVSSMDTCQVFQSVSICFSKVVDFVQICSEISVDKIVNLLNDMYTHFDNLTELYKVYKVETISDSYMLVSGAPSTTDLHSAHIVEMALSMITCAKKNLKNPAKSSGSIELLIGCHSGMIVAGIVGIKMPRYCLFGDTVNTSSRMMSHGSPNKVHVSDIFFEHISQFPYNYTKRGEMEIKGKGSMTTYFIESR 600          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GUCY1B13.218e-11536.77guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B17.033e-11034.89guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B13.595e-10936.81guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.429e-10836.77guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B16.440e-10237.02guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-352.027e-12836.84Soluble guanylate cyclase gcy-35 [Source:UniProtK... [more]
gcy-362.165e-12235.12Soluble guanylate cyclase gcy-36 [Source:UniProtK... [more]
gcy-323.287e-10732.70Soluble guanylate cyclase gcy-32 [Source:UniProtK... [more]
gcy-344.260e-10631.92Soluble guanylate cyclase gcy-34 [Source:UniProtK... [more]
gcy-375.369e-9128.11Soluble guanylate cyclase gcy-37 [Source:UniProtK... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gyc88E2.262e-10433.12gene:FBgn0038295 transcript:FBtr0334926[more]
Gyc88E3.366e-10433.12gene:FBgn0038295 transcript:FBtr0110961[more]
Gyc88E3.366e-10433.12gene:FBgn0038295 transcript:FBtr0306245[more]
Gycbeta100B5.661e-6634.01gene:FBgn0013973 transcript:FBtr0085753[more]
CG343574.286e-5948.29gene:FBgn0085386 transcript:FBtr0335239[more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b25.144e-16139.91guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
gucy1b11.474e-11134.84guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
gucy1b12.055e-11035.14guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1A21.148e-7331.01guanylate cyclase 1, soluble, alpha 2 [Source:NCBI... [more]
gucy1a12.214e-6637.97guanylate cyclase 1 soluble subunit alpha 1 [Sourc... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank18.296e-14239.22ankyrin 1 [Source:Xenbase;Acc:XB-GENE-5838516][more]
GUCY1B19.984e-11234.18guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.366e-11134.52guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.469e-11134.52guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B15.198e-10733.54guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gucy1b29.010e-15038.52guanylate cyclase 1, soluble, beta 2 [Source:MGI S... [more]
Gucy1b22.424e-14838.56guanylate cyclase 1, soluble, beta 2 [Source:MGI S... [more]
Gucy1b12.811e-11536.77guanylate cyclase 1, soluble, beta 1 [Source:MGI S... [more]
Gucy1b11.487e-11136.90guanylate cyclase 1, soluble, beta 1 [Source:MGI S... [more]
Gucy1a22.178e-7333.08guanylate cyclase 1, soluble, alpha 2 [Source:MGI ... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75343|GCYB2_HUMAN9.010e-13638.26Guanylate cyclase soluble subunit beta-2 OS=Homo s... [more]
sp|P22717|GCYB2_RAT2.229e-13539.90Guanylate cyclase soluble subunit beta-2 OS=Rattus... [more]
sp|O02298|GCY35_CAEEL2.578e-12736.84Soluble guanylate cyclase gcy-35 OS=Caenorhabditis... [more]
sp|Q6DNF4|GCY36_CAEEL2.754e-12135.12Soluble guanylate cyclase gcy-36 OS=Caenorhabditis... [more]
sp|Q02153|GCYB1_HUMAN1.545e-11436.77Guanylate cyclase soluble subunit beta-1 OS=Homo s... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IZI10.000e+055.22Guanylate cyclase domain-containing protein OS=Mac... [more]
A0A1I8IZT50.000e+053.89Guanylate cyclase domain-containing protein OS=Mac... [more]
A0A1I8GHI00.000e+054.42Guanylate cyclase domain-containing protein OS=Mac... [more]
A0A1I8H5521.042e-18054.97Guanylate cyclase domain-containing protein OS=Mac... [more]
A0A1S3IRP61.826e-18043.72guanylate cyclase soluble subunit beta-2 OS=Lingul... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b21.536e-16240.66guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
gucy1b23.476e-16240.59guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
ENSAMXT00000013658.22.529e-14541.95pep primary_assembly:Astyanax_mexicanus-2.0:17:533... [more]
gucy1b11.100e-9033.21guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
ENSAMXT00000045584.12.397e-9030.04soluble guanylate cyclase 88E-like [Source:NCBI ge... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b26.342e-11150.14guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
ENSPMAT00000002650.11.937e-5746.86pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 ge... [more]
ENSPMAT00000006352.17.119e-5747.92pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
NPR11.472e-5646.31natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000007957.12.180e-5143.50pep scaffold:Pmarinus_7.0:GL476724:304294:325245:1... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470868.470e-12637.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470832.659e-11133.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470841.348e-10433.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430952.482e-9733.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403621.171e-8430.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b12.946e-9233.56fatty acid binding protein 2 [Source:NCBI gene;Acc... [more]
gucy1a22.917e-6636.66guanylate cyclase 1 soluble subunit alpha 2 [Sourc... [more]
gucy2g1.217e-5949.58guanylate cyclase 2g [Source:ZFIN;Acc:ZDB-GENE-130... [more]
olgc-r21.977e-5849.16guanylate cyclase OlGC-R2 [Source:NCBI gene;Acc:10... [more]
olgc81.614e-5749.79membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Guanylate cyclase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035922.11.497e-10532.27SMESG000035922.1[more]
SMESG000035922.19.702e-10533.88SMESG000035922.1[more]
SMESG000079311.18.302e-10032.52SMESG000079311.1[more]
SMESG000051217.13.731e-8430.05SMESG000051217.1[more]
SMESG000051217.16.011e-8430.05SMESG000051217.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008588 ID=SMED30008588|Name=Guanylate cyclase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2228bp
TGAACTCGCTCATTTCAGCTGAGCAGATTTATATTATTTAAATAGCAGAT
ATTAAGGGATCTTCAGAATTTTGATTTGCCCCCTATCTAATATACCTCAT
TTTATACTCACTCTTCATAGACCATTCTTTATATTCTCAGATCTCGGGAC
TTTACTAACACTTAGCATGCTGGGACATATCCATTTATGCATGAAGGAGC
TCGTTCTGGACAAGATGGGAGAGGAAGCTTGGGAGCGAATTCTTGAAGCA
GCAAACTGTGATAACTCCAGGGACTTCCTAGTGTTCCACAGCTACCCTGA
TTCAATCTTCTTCAACCTCCTAGAAGCTGTTGCCAGTGAGCTAAATTTGA
CAAATGATGAAACGCTAGAGGCATTCGGGAAGCAATTTTTCAAATACACG
AAGCGTCATGGATACCACAAGATGATAGAGAACCTTGGAGGAGATATGAG
AACGTTTTTGGAGAATTTAGACGCGTTGCATGAATACTTTGCCGTCACTC
AAAAGAGCATGATAGCTCCATCATTTAGCATTGATAAAAAGAGCAATTGC
GAAATGATCCTCCATTACAACAGCAGTAGGAAAGGATTATATCCCTGGAT
TAAAGGAATGCTCGGATGCATCGCAAAAGAATTTTTCAAAACCGAGATCC
AATTCAAAATCATAACTAGCGCAACAGATAATAATCCCGAGTCCAGGTTC
CGACAGCATATGGTTATAATCATACAATCAAAAATAGAAGCACAATATGG
ATCCCTTGCAGAGTTGGACAAGTCCATAAGCACTAATTTCCGTCCAAAAT
ATCCTCACAAAAGCCTTGTCAATGCTCGACATATGGTCAATTTCCTGCCT
TATCATATCATATTTGACTCGATGCTCTACGTAAGACAATCAGGATATAT
GCTCCAGAAGCTCTGCGACCCTTTGAAGGATGAGCAACACGATGTGATAT
TATTATCTAAGATAGCTTCACTTATCGTTCCAGCAGTTCCTTTCGATGCG
GTCTCGATTCGTAGGTTCATCAACTCAGCCTTCACCTTTTTATTGTTCAG
GAATTATAAAAATTTGACAAATGAGACAGATTCCGGGATTCTATTACGAG
GTCAGATATGCTTTCTGGATGACAATGACTGCTTTTTATTCATCGGTAGC
CCAAGGATAATGACCTTATCAGAGATGGAGGAGAAGAATCTGTTTCTATC
CGACATTCCACTTTATGACGTAACACGGGAATTGCTGCTCGTCAATCAAC
AGCGATTAGCAGAGATGGAAATCAGTAAGCATCTGAACGAGATGACCAAC
CAACTACAGAAAACCACCAGTTTATTAGAAAATGAAAAGGCAAGAGTCAA
CATGCTTCTCTGTCAGATGTTGCCTCCAAAGGTCGCTCAACAGCTGCTAA
ACGGGAAACGAGTAAAGGCAGAAAAGTTCCAAATGTGTACAATACTGTTC
AGTGACATCGTTACGTTCACCAGTATCGCTTCCCAATGTAATCCGATGGA
CGTCGTTGATATGCTGAACGCCCTATACTCACTGTTTGACAAAGCGTCGG
AGGATAATGGAGCTTATAAAGTTGAGACAATTGGTGATGCGTACATGGTC
GTAGCTGGAGTTCCGGAAGTTACCAGTCGACACGCTGAAATTATCGCCGA
ACAGGCAATGGACATGGTGGAGGCATCGAATAAGGTCCGTTCTCCGGTCA
GCGGGAAATCACTACAGATTCGAGTCGGAATTCATTCTGGTCCTGTCGTT
GCTGGAGTTGTCGGAGAGAAAATGCCAAGATTTTGTTTATTTGGAGACGC
AGTGAATGTCGCCAGCAGAATGGAAAGCCATGGAATGCCAGGAAGGATCC
ATTGCAGTGATTCCACATATCAGTTTTTGCTGGCTCTAGAATACGTTTTT
GAAGGCCGAGGAGAAGTTGAAATCAAGGGGAAAGGCCTGATGAAAACGTA
CTTTCTATTGGGTCGGGGAGTGACTCACAAAAATGGCGAGAGAAAGATTC
CCGTGGAGAATGTCAGTCAGTGTAACGCGGCAGTAAAATGCAACGCGAAG
GAGAAGTCGAGAACAGCTGAGATATCTAACAATCACAATGATTCTCCCAT
CAAATATTCACAGGCTCACAAAAGCGCCCTCTGCAGAATCGTGTAATCAA
AGCGATGAGGGATTTGTCTAGAAAATTTGCATCATTTAAACAACAAAAGC
GATGTCTATGGTGTGCACTAGTTAAATA
back to top

protein sequence of SMED30008588-orf-1

>SMED30008588-orf-1 ID=SMED30008588-orf-1|Name=SMED30008588-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=660bp
MLGHIHLCMKELVLDKMGEEAWERILEAANCDNSRDFLVFHSYPDSIFFN
LLEAVASELNLTNDETLEAFGKQFFKYTKRHGYHKMIENLGGDMRTFLEN
LDALHEYFAVTQKSMIAPSFSIDKKSNCEMILHYNSSRKGLYPWIKGMLG
CIAKEFFKTEIQFKIITSATDNNPESRFRQHMVIIIQSKIEAQYGSLAEL
DKSISTNFRPKYPHKSLVNARHMVNFLPYHIIFDSMLYVRQSGYMLQKLC
DPLKDEQHDVILLSKIASLIVPAVPFDAVSIRRFINSAFTFLLFRNYKNL
TNETDSGILLRGQICFLDDNDCFLFIGSPRIMTLSEMEEKNLFLSDIPLY
DVTRELLLVNQQRLAEMEISKHLNEMTNQLQKTTSLLENEKARVNMLLCQ
MLPPKVAQQLLNGKRVKAEKFQMCTILFSDIVTFTSIASQCNPMDVVDML
NALYSLFDKASEDNGAYKVETIGDAYMVVAGVPEVTSRHAEIIAEQAMDM
VEASNKVRSPVSGKSLQIRVGIHSGPVVAGVVGEKMPRFCLFGDAVNVAS
RMESHGMPGRIHCSDSTYQFLLALEYVFEGRGEVEIKGKGLMKTYFLLGR
GVTHKNGERKIPVENVSQCNAAVKCNAKEKSRTAEISNNHNDSPIKYSQA
HKSALCRIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR042463HNOB_dom_associated_sf
IPR038158H-NOX_domain_sf
IPR001054A/G_cyclase
IPR011644Heme_NO-bd
IPR011645HNOB_dom_associated
IPR018297A/G_cyclase_CS
IPR029787Nucleotide_cyclase
IPR024096NO_sig/Golgi_transp_ligand-bd
Vocabulary: molecular function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
GO:0020037heme binding
GO:0004383guanylate cyclase activity
GO:0000166nucleotide binding
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0009190cyclic nucleotide biosynthetic process
GO:0035556intracellular signal transduction
GO:0006182cGMP biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 373..393
NoneNo IPR availablePANTHERPTHR45655FAMILY NOT NAMEDcoord: 1..632
NoneNo IPR availablePANTHERPTHR45655:SF15SOLUBLE GUANYLATE CYCLASE GCY-35-RELATEDcoord: 1..632
NoneNo IPR availableCDDcd07302CHDcoord: 425..597
e-value: 2.14446E-70
score: 224.38
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclaseSMARTSM00044cyc_6coord: 389..580
e-value: 5.2E-92
score: 321.7
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 416..598
e-value: 6.9E-64
score: 214.8
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 425..553
score: 47.767
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 412..601
e-value: 9.3E-75
score: 252.3
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 411..598
IPR011645Haem NO binding associatedPFAMPF07701HNOBAcoord: 218..410
e-value: 1.1E-32
score: 113.3
IPR011644Heme NO-bindingPFAMPF07700HNOBcoord: 3..164
e-value: 2.2E-44
score: 151.3
IPR042463Haem NO binding associated domain superfamilyGENE3DG3DSA:3.30.450.260coord: 218..347
e-value: 2.0E-24
score: 87.9
IPR038158H-NOX domain superfamilyGENE3DG3DSA:3.90.1520.10coord: 1..191
e-value: 1.0E-51
score: 177.0
IPR018297Adenylyl cyclase class-4/guanylyl cyclase, conserved sitePROSITEPS00452GUANYLATE_CYCLASE_1coord: 530..553
IPR024096NO signalling/Golgi transport ligand-binding domain superfamilySUPERFAMILYSSF111126Ligand-binding domain in the NO signalling and Golgi transportcoord: 1..173