Reverse transcriptase domain-containing protein

Overview
NameReverse transcriptase domain-containing protein
Smed IDSMED30008586
Length (bp)2434
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Reverse transcriptase domain-containing protein (SMED30008586) t-SNE clustered cells

Violin plots show distribution of expression levels for Reverse transcriptase domain-containing protein (SMED30008586) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Reverse transcriptase domain-containing protein (SMED30008586) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Reverse transcriptase domain-containing protein (SMED30008586) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008586

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008586h1SMcG0014493 Contig2086GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30008586h1SMcG0014493 Contig50734uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008586h1SMcG0014493 Contig50734newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A267GEQ6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018835g2 PE=4 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 9.271e-150
Identity = 286/772 (37.05%), Postives = 433/772 (56.09%), Query Frame = 2
Query:  131 PKSYTEEKVIPEPDVTKVNIIFMNHLDVGYSDYMAHLP---GFSANVLNTYFNMHFPNAVNLARKMRIGGYVETFRYTTHPWLLSFFLHCPPNLTLANIKIQCPNSTSLASMLQAIENRDIIWHDGPMNMNFEN-LNAFGLEIALNISANLNRKFGINKPIRVLSLRDVPGLTRGAIRTLIKNNVVGITSGVNSGSAPPNVP------KLCRWRAAKRSFNEKNIPEVIYMQXXXXXXXXXXXXXXXXDGMSADNCFRAPKSTEVLCFMFRTDNSGPPQSVEEVLNAYEIVRARYINANLYAGTLEEFFNIVWQNRNLLPLFDNEIGDTWIQGTASDPKKFARFRVMQREFERYYKSGA-QI-SANVINAASYLIKPAEHTYGTEGVGDNINWRNDQWANIIKRNDVISSQLSWVEQRQYQQLVLD-----LLGYNHSLTLSILKAFKEL-ETYTNLKEF-----MAQSKPYIYTCSNNTHSIDVGFENGAISYLQAENLKISENFPLGKIIYQTYNESDTEFFLKYYK--TYWNTGYGKPNSTVNAHPESKEWKIVMKSIYRQSDSPCSFLCILEPEDPRATSYYGFPDSVLVLWDINISTNEISTEVFWDNKPPTRLMEAISIKFQPEIVGNQFQWYLSKMGEPISPYSVIKNGSQWQHNVDDSGVFISSAPDAKPVFRVIPWDTGITCPIIKGYGPTVWPAPLFPI-TSNLTGVAFNFYNNVWNTNYIYWYPFMGPGTQLDNRFKARFTTQVNLVT----EKVDDTLRY 2356
            P  ++++   P P++T+V+++FMNHLDVG+S     LP   G+SANV+NTY N++F  A N +R +R  GY+ETF Y  HPW+L  F  CP N++L  IKIQCP+  ++  + QA++   I WH G MN+ +E  L    L+I+L+ +  L+ KFGI + +  +SLRDVPGLTR AI  + KN +V +T+G+N   A P+V       K  RWR+           E+ Y + P GYP NPGP+PN+P G+   NC +AP +TE+ C+ FR+DNSGPP   +EVL+ YE++R +Y NA + A T+E+F+++V  NR+ +P+F  E GDTW+QG  +D  + AR+R + R  +    +GA Q+ S ++I  + ++ K AEHTYG  GV D +++ N  + ++++ ++      SW+EQRQ+ QL +D     L  Y  +    +   F  +   ++ L +      +    PY               ++GA  +              G  +Y+TYNESDT FFL+YY      NTG+GK NST NAHP S+ W I   +IY+ S S  +F      +DP+++  YG P S+  ++  N +    +   +  +K PTRLMEA  I F P+  G      L+K+G  I+   V  NGS WQH V  S   ++     K   RV   D+ + CP    YGPTVWP P+ P+  S + G++FN  NNVW+ N+++WYP+M        RF+      ++ +T     +VD  L +
Sbjct:   20 PNYFSQKVSTPHPEITRVHLMFMNHLDVGFS-----LPSEIGYSANVINTYLNVYFERAANFSRDLRKFGYLETFSYLAHPWMLEMFFDCPQNVSLQGIKIQCPSQATVDYVAQAVKEGAIQWHAGSMNVQYETCLTPNLLQISLDSAKRLDAKFGIKRKLSAVSLRDVPGLTRAAIDLMAKNGIVAVTNGINW--ACPSVDLGSPDLKFVRWRSPDTG------NEIFYNKIPGGYPGNPGPDPNHPGGLDFSNCLQAPGTTEIQCWAFRSDNSGPPVDYKEVLSNYEVLRGQYPNAAISASTMEKFWSLVLANRDSVPVFTKENGDTWLQGDQADFHRMARYRAIARALDTCVSAGACQLESPDMIMFSRWIAKAAEHTYGLNGVWDYVHYSNLDFYSVMQNDNFRHGVSSWLEQRQFLQLAVDAAPPKLASYIAAELAPLADEFPGVGANFSRLNDTAWGRPLTAGGPYRVVFDRRAGLARFSIDSGATWHQGG-----------GAFVYRTYNESDTAFFLRYYTNPNGDNTGFGKYNSTQNAHPVSQFWSISAAAIYQHS-SQSTFAVQFLMDDPQSSVKYGAPASMWAMY--NFTGTGYTLHSWSLSKTPTRLMEAFYIDF-PKPPGALA--VLNKLGHDIAVGQVAANGSVWQHMVGHSPYSVAFRQQGKAELRVQSLDSSLACPRTASYGPTVWPVPMSPVPDSKVAGISFNMLNNVWDVNFVFWYPYMPTEANFRARFRVDLADHLDDLTVDGEHQVDAKLNW 761          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A267DZZ0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004169g1 PE=4 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 2.873e-149
Identity = 286/772 (37.05%), Postives = 434/772 (56.22%), Query Frame = 2
Query:  131 PKSYTEEKVIPEPDVTKVNIIFMNHLDVGYSDYMAHLP---GFSANVLNTYFNMHFPNAVNLARKMRIGGYVETFRYTTHPWLLSFFLHCPPNLTLANIKIQCPNSTSLASMLQAIENRDIIWHDGPMNMNFEN-LNAFGLEIALNISANLNRKFGINKPIRVLSLRDVPGLTRGAIRTLIKNNVVGITSGVNSGSAPPNVP------KLCRWRAAKRSFNEKNIPEVIYMQXXXXXXXXXXXXXXXXDGMSADNCFRAPKSTEVLCFMFRTDNSGPPQSVEEVLNAYEIVRARYINANLYAGTLEEFFNIVWQNRNLLPLFDNEIGDTWIQGTASDPKKFARFRVMQREFERYYKSGA-QI-SANVINAASYLIKPAEHTYGTEGVGDNINWRNDQWANIIKRNDVISSQLSWVEQRQYQQLVLD-----LLGYNHSLTLSILKAFKEL-ETYTNLKEF-----MAQSKPYIYTCSNNTHSIDVGFENGAISYLQAENLKISENFPLGKIIYQTYNESDTEFFLKYYK--TYWNTGYGKPNSTVNAHPESKEWKIVMKSIYRQSDSPCSFLCILEPEDPRATSYYGFPDSVLVLWDINISTNEISTEVFWDNKPPTRLMEAISIKFQPEIVGNQFQWYLSKMGEPISPYSVIKNGSQWQHNVDDSGVFISSAPDAKPVFRVIPWDTGITCPIIKGYGPTVWPAPLFPI-TSNLTGVAFNFYNNVWNTNYIYWYPFMGPGTQLDNRFKARFTTQVNLVT----EKVDDTLRY 2356
            P  ++++   P P++T+V+++FMNHLDVG+S     LP   G+SANV+NTY N++F  A N++R +R  GY+ETF Y  HPW+L  F  CP N++L  IKIQCP+  ++  + QA++   I WH G MN+ +E  L    L+I+L+ +  L+ KFGI + +  +SLRDVPGLTR AI  + KN +V +T+G+N   A P+V       K  RWR+           E+ Y + P GYP NPGP+PN+P G+   NC +AP +TE+ C+ FR+DNSGPP   +EVL+ YE++R +Y NA + A T+E+F+++V  NR+ +P+F  E GDTW+QG  +D  + AR+R + R  +    +GA Q+ S ++I  + ++ K AEHTYG  GV D +++ N  + ++++ ++      SW+EQRQ+ QL +D     L  Y  +    +   F  +   ++ L +      +    PY               ++GA  +              G  +Y+TYNESDT FFL+YY      NTG+GK NST NAHP S+ W I   +IY+ S S  +F      +DP+++  YG P S+  ++  N +    +   +  +K PTRLMEA  I F P+  G      L+K+G  I+   V  NGS WQH V  S   ++     K   RV   D+ + CP    YGPTVWP P+ P+  S + G++FN  NNVW+ N+++WYP+M        RF+      ++ +T     +VD  L +
Sbjct:   31 PNYFSQKVSTPHPEITRVHLMFMNHLDVGFS-----LPSEIGYSANVINTYLNVYFERAANVSRDLRKFGYLETFSYLAHPWMLEMFFDCPQNVSLQGIKIQCPSQATVDYVAQAVKEGAIQWHAGSMNVQYETCLTPNLLQISLDSAKRLDAKFGIKRKLSAVSLRDVPGLTRAAIDLMAKNGIVAVTNGINW--ACPSVDLGSPDLKFVRWRSPDTG------NEIFYNKIPGGYPGNPGPDPNHPGGLDFSNCLQAPGTTEIQCWAFRSDNSGPPVDYKEVLSNYEVLRGQYPNAAISASTMEKFWSLVLANRDSVPVFTKENGDTWLQGDQADFHRMARYRAIARALDTCVSAGACQLESPDMIMFSRWIAKAAEHTYGLNGVWDYVHYSNLDFYSVMQNDNFRHGVSSWLEQRQFLQLAVDAAPPKLASYIAAELAPLADEFPGVGANFSRLNDTAWGRPLTAGGPYRVVFDRRAGLARFSIDSGATWHQGG-----------GAFVYRTYNESDTAFFLRYYTNPNGDNTGFGKYNSTQNAHPVSQFWSISAVAIYQHS-SQSTFAVQFLMDDPQSSVKYGAPASMWAMY--NFTGTGYTLHSWSLSKTPTRLMEAFYIDF-PKPPGALA--VLNKLGHDIAVGQVAANGSVWQHMVGHSPYSVAFRQQGKAELRVQSLDSSLACPRTASYGPTVWPVPMSPVPDSKVAGISFNMLNNVWDVNFVFWYPYMPTEANFRARFRVDLADHLDDLTVDGEHQVDAKLNW 772          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A267GAX9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018835g4 PE=4 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 3.337e-149
Identity = 284/772 (36.79%), Postives = 434/772 (56.22%), Query Frame = 2
Query:  131 PKSYTEEKVIPEPDVTKVNIIFMNHLDVGYSDYMAHLP---GFSANVLNTYFNMHFPNAVNLARKMRIGGYVETFRYTTHPWLLSFFLHCPPNLTLANIKIQCPNSTSLASMLQAIENRDIIWHDGPMNMNFEN-LNAFGLEIALNISANLNRKFGINKPIRVLSLRDVPGLTRGAIRTLIKNNVVGITSGVNSGSAPPNVP------KLCRWRAAKRSFNEKNIPEVIYMQXXXXXXXXXXXXXXXXDGMSADNCFRAPKSTEVLCFMFRTDNSGPPQSVEEVLNAYEIVRARYINANLYAGTLEEFFNIVWQNRNLLPLFDNEIGDTWIQGTASDPKKFARFRVMQREFERYYKSGA-QI-SANVINAASYLIKPAEHTYGTEGVGDNINWRNDQWANIIKRNDVISSQLSWVEQRQYQQLVLD-----LLGYNHSLTLSILKAFKEL-ETYTNLKEF-----MAQSKPYIYTCSNNTHSIDVGFENGAISYLQAENLKISENFPLGKIIYQTYNESDTEFFLKYYK--TYWNTGYGKPNSTVNAHPESKEWKIVMKSIYRQSDSPCSFLCILEPEDPRATSYYGFPDSVLVLWDINISTNEISTEVFWDNKPPTRLMEAISIKFQPEIVGNQFQWYLSKMGEPISPYSVIKNGSQWQHNVDDSGVFISSAPDAKPVFRVIPWDTGITCPIIKGYGPTVWPAPLFPI-TSNLTGVAFNFYNNVWNTNYIYWYPFMGPGTQLDNRFKARFTTQVNLVT----EKVDDTLRY 2356
            P  ++++   P P++T+V+++FMNHLDVG+S     LP   G+SANV+N Y N++F  A N++R +R  GY+ETF Y  HPW+L  F  CP N++L  IKIQCP+  ++  + QA++   I WH G MN+ +E  L    L+I+L+ +  L+ KFGI + +  +SLRDVPGLTR AI  + KN +V +T+G+N   A P+V       K  RWR+           E+ Y + P GYP NPGP+PN+P G+   NC +AP +TE+ C+ FR+DNSGPP   +EVL+ YE++R +Y NA + A T+E+F+++V  NR+ +P+F  E GDTW+QG  +D  + AR+R + R  +    +GA Q+ S ++I  + ++ K AEHTYG  GV D +++ N  + ++++ ++      SW+EQRQ+ QL +D     L  Y  +    +   F  +   ++ L +      +    PY               ++GA  +              G  +Y+TYNESDT FFL+YY      NTG+GK NST NAHP S+ W +   +IY+ S S  +F      +DP+++  YG P S+  ++  N +    +   +  +K PTRLMEA  I F P+  G      L+K+G  I+   V  NGS WQH V  S   ++     K   RV   D+ + CP    YGPTVWP P+ P+  S + G++FN  NNVW+ N+++WYP+M        RF+      ++ +T    ++VD  L +
Sbjct:   31 PNYFSQKVSTPHPEITRVHLMFMNHLDVGFS-----LPSEIGYSANVINAYLNVYFERAANVSRDLRKFGYLETFSYLAHPWMLEMFFDCPQNVSLQGIKIQCPSQATVDYVAQAVKEGSIQWHAGSMNVQYETCLTPNLLQISLDSAKRLDAKFGIKRKLSAVSLRDVPGLTRAAIDLMAKNGIVAVTNGINW--ACPSVDLGSPDLKFVRWRSPDTG------NEIFYNKIPGGYPGNPGPDPNHPGGLDFSNCLQAPGTTEIQCWAFRSDNSGPPVDYKEVLSNYEVLRGQYPNAAISASTMEKFWSLVLANRDSVPVFTKENGDTWLQGDQADFHRMARYRAIARALDTCVSAGACQLESPDMIMFSRWIAKAAEHTYGLNGVWDYVHYSNLDFYSVMQNDNFRHGVSSWLEQRQFLQLAVDAAPPKLASYIAAELAPLADEFPGVGANFSRLNDTAWGRPLTAGGPYRVVFDRRAGLARFSIDSGATWHQGG-----------GAFVYRTYNESDTAFFLRYYTNPNGDNTGFGKYNSTQNAHPVSQFWSVSAAAIYQHS-SQSAFAVQFLMDDPQSSVKYGAPASMWAMY--NFTGTGYTLHSWSLSKTPTRLMEAFYIDF-PKPPGALA--VLNKLGHDIAVGQVAANGSVWQHMVGHSPYSVAFRQQGKAELRVQSLDSSLACPRTASYGPTVWPVPMSPVPDSKVAGISFNMLNNVWDVNFVFWYPYMPTEANFRARFRVDLADHLDDLTVDGDQQVDAKLNW 772          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A1I8H8Q3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 4.571e-149
Identity = 283/763 (37.09%), Postives = 429/763 (56.23%), Query Frame = 2
Query:  131 PKSYTEEKVIPEPDVTKVNIIFMNHLDVGYSDYMAHLP---GFSANVLNTYFNMHFPNAVNLARKMRIGGYVETFRYTTHPWLLSFFLHCPPNLTLANIKIQCPNSTSLASMLQAIENRDIIWHDGPMNMNFEN-LNAFGLEIALNISANLNRKFGINKPIRVLSLRDVPGLTRGAIRTLIKNNVVGITSGVNSGSAPPNVP------KLCRWRAAKRSFNEKNIPEVIYMQXXXXXXXXXXXXXXXXDGMSADNCFRAPKSTEVLCFMFRTDNSGPPQSVEEVLNAYEIVRARYINANLYAGTLEEFFNIVWQNRNLLPLFDNEIGDTWIQGTASDPKKFARFRVMQREFERYYKSGA-QI-SANVINAASYLIKPAEHTYGTEGVGDNINWRNDQWANIIKRNDVISSQLSWVEQRQYQQLVLD-----LLGYNHSLTLSILKAFKEL-ETYTNLKEF-----MAQSKPYIYTCSNNTHSIDVGFENGAISYLQAENLKISENFPLGKIIYQTYNESDTEFFLKYYK--TYWNTGYGKPNSTVNAHPESKEWKIVMKSIYRQSDSPCSFLCILEPEDPRATSYYGFPDSVLVLWDINISTNEISTEVFWDNKPPTRLMEAISIKFQPEIVGNQFQWYLSKMGEPISPYSVIKNGSQWQHNVDDSGVFISSAPDAKPVFRVIPWDTGITCPIIKGYGPTVWPAPLFPI-TSNLTGVAFNFYNNVWNTNYIYWYPFMGPGTQLDNRFKARFTTQVNLVTEKVD 2341
            P  ++++   P P++T+V+++FMNHLDVG+S     LP   G+SANV+N Y N++F  A N++R +R  GY+ETF Y  HPW+L  F  CP N++L  IKIQCP+  ++  + QA++   I WH G MN+ +E  L    L+I+L+ +  L+ KFGI + +  +SLRDVPGLTR AI  + KN +V +T+G+N   A P+V       K  RWR+           E+ Y + P GYP NPGP+PN+P G+   NC +AP +TE+ C+ FR+DNSGPP   +EVL+ YE++R +Y NA + A T+E+F+++V  NR+ +P+F  E GDTW+QG  +D  + AR+R + R  +    +GA Q+ S ++I  + ++ K AEHTYG  GV D +++ N  + ++++ ++      SW+EQRQ+ QL +D     L  Y  +    +   F  +   ++ L +      +    PY               ++GA  +              G  +Y+TYNESDT FFL+YY      NTG+GK NST NAHP S+ W I   +IY+ S S  +F      +DP+++  YG P S+  ++  N +    +   +  +K PTRLMEA  I F P+  G      L+K+G  I+   V  NGS WQH V  S   ++     K   RV   D+ + CP    YGPTVWP P+ P+  S + G++FN  NNVW+ N+++WYP+M        RF+      ++ +T   D
Sbjct:   36 PNYFSQKVSTPHPEITRVHLMFMNHLDVGFS-----LPSEIGYSANVINAYLNVYFERAANVSRDLRKFGYLETFSYLAHPWMLEMFFDCPQNVSLQGIKIQCPSQATVDYVAQAVKEGAIQWHAGSMNVQYETCLTPNLLQISLDSAKRLDAKFGIKRKLSAVSLRDVPGLTRAAIDLMAKNGIVAVTNGINW--ACPSVDLGSPDLKFVRWRSPDTG------NEIFYNKIPGGYPGNPGPDPNHPGGLDFSNCLQAPGTTEIQCWAFRSDNSGPPVDYKEVLSNYEVLRGQYPNAAISASTMEKFWSLVLANRDSVPVFTKENGDTWLQGDQADFHRMARYRAIARALDTCVSAGACQLESPDMIMFSRWIAKAAEHTYGLNGVWDYVHYSNLDFYSVMQNDNFRHGVSSWLEQRQFLQLAVDAAPPKLASYIAAELAPLADEFPGVGANFSRLNDTAWGRPLTAGGPYRVVFDRRAGLARFSIDSGATWHQGG-----------GAFVYRTYNESDTAFFLRYYTNPNGDNTGFGKYNSTQNAHPVSQFWSISAAAIYQHS-SQSTFAVQFLMDDPQSSVKYGAPASMWAMY--NFTGTGYTLHSWSLSKTPTRLMEAFYIDF-PKPPGALA--VLNKLGHDIAVGQVAANGSVWQHMVGHSPYSVAFRQQGKAELRVQSLDSSLACPRTASYGPTVWPVPMSPVPHSKVAGISFNMLNNVWDVNFVFWYPYMPTEANFRARFRVDLADHLDDLTVDGD 768          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A267E6B6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010566g1 PE=4 SV=1)

HSP 1 Score: 457.603 bits (1176), Expect = 1.544e-146
Identity = 289/728 (39.70%), Postives = 415/728 (57.01%), Query Frame = 2
Query:  179 KVNIIFMNHLDVGYSDYMAHLP--GFSANVLNTYFNMHFPNAVNLARKMRIGGYVETFRYTTHPWLLSFFLHCPPNLTLANIKIQCPNSTSLASMLQAIENRDIIWHDGPMNMNFENLNAFGLEIALNISANLNRKFGINKPIRVLSLRDVPGLTRGAIRTLIKNNVVGITSGVNSGSAPPNVPKLCRWRAAKRSFNEKNIPEVIYMQXXXXXXXXXXXXXXXXDGMSADNCFRAPKSTEVLCFMFRTDNSGPPQSVEEVLNAYEIVRARYINANLYAGTLEEFFNIVWQNRNLLPLFDNEIGDTWIQGTASDPKKFARFRVMQREFERYYKSGAQISAN---VINAASYLIKPAEHTYGTEGVGDNINWRNDQWANIIKRNDVISSQLSWVEQRQYQQLVLDLLGYNHSLTLSILKAFKELE-TYTNLKEFMAQS-KP-YIYTCSNNTHSIDVGFENGAISYLQAENLK--ISENFPLGKIIYQTYNESDTEFFLKYYKTYWNTGYGKPNSTVNAHPESKEWKIVMKSIYRQSDSPCSFLCILEPEDPRATSYYGFPDSVLVLWDINISTNEISTEVFWDNKPPTRLMEAISIKFQ-----PEIVGNQFQWYLSKMGEPISPYSVIKNGSQWQHNVDDSGVFISSAPDAKPVFRVIPWDTGITCPIIKGYGPTVWPAPLFPITSNLT---GVAFNFYNNVWNTNYIYWYPFMGPGTQLDNRFKARFT 2308
            +V++IFMNHLDVGY+     +P  G+  NVLN YF++HFP A++L +++R GG+ E FRYTTHPWLL  +L+CP +LTL  I++QCPNST L +M  A+   D++WH GPMNM  EN+N   LE +LNIS  L+ KF   K IRVLS RDVPG+T  AI  L KNN+V ++ GVN  S PP V      R      +E +   ++ + +P GYPN+PG +P NP G+S  +C       E+LCF FRTDN GPPQSV EVLN+YEI+R ++  A + A TLE+F   +   ++L+ +   EIGDTWIQG ASDP+K A +R + R F R    GA  S N   V +A  Y+IKP EHT+G     D  N+RN  +      +  + ++ +W+EQR +  L +      H L+  + +   +L  T  ++  ++ QS +P  I+       S    F +G+I +LQ    +   ++   L K +Y++Y+E D     K  ++Y N GYGKPN T NA+P S EW+++    YR+ D+  SF+ ++ PED  A S YG P  V + ++    ++ I  +V   NK  TR+ E + ++F+      +      +W L+K+   + P  V   GS  QH +++  VF      +K V  V   D  + CP  +        A +FP    LT   GV+FN YNNVW TNYI+WYP+       D  FKARF+
Sbjct:   32 RVHVIFMNHLDVGYNG----IPDTGYINNVLNRYFHVHFPQALSLVKQIREGGFRERFRYTTHPWLLDMYLNCP-DLTLNGIQLQCPNSTDLEAMKDALTLGDVVWHAGPMNMQIENMNGALLEASLNISRRLDEKFQPEKKIRVLSQRDVPGMTSAAIPVLKKNNIVAVSVGVNPASYPPEVT-----REPFVWLDELSQESIVGIWHPGGYPNDPGDSPANPGGISVKDCSMVSGVPEILCFSFRTDNQGPPQSVAEVLNSYEILRDQFNGAEVIASTLEDFVQAILPYQSLMQVVRTEIGDTWIQGIASDPRKMAEYRALSRAFTRCRSDGA-CSGNDPQVQDAVRYMIKPPEHTWGLPSQPDQNNYRNVDFNKARSGSAYVQNENAWLEQRMFNTLAVQ-AAKGHPLSSYMAQEMSQLTPTLPDMTGYVKQSLQPDTIFEYGYYRFSF---FSDGSIDHLQINGGQSFANQRGRLAKFVYRSYDELDDN---KLLRSYGNPGYGKPNITANANPLSLEWRMLATDFYRKPDN-SSFVIVVAPEDSLAVSDYGAPQKVFLTYNF---SSGIDVDVLVWNKTSTRIEEGLFVEFRASADMADAPNASCRWLLNKVDGYVDPMRVTYGGSILQHAINEHAVFSCEMGASKKVLVVQSKDVPLACPFSR-----FQEASVFPYLDRLTRVDGVSFNIYNNVWITNYIFWYPYHTG----DQNFKARFS 728          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000008741.1 (SMESG000008741.1)

HSP 1 Score: 1458.35 bits (3774), Expect = 0.000e+0
Identity = 717/766 (93.60%), Postives = 741/766 (96.74%), Query Frame = 2
Query:   59 MTNVLLLSFIFSTLTYLTQGFGVKPKSYTEEKVIPEPDVTKVNIIFMNHLDVGYSDYMAHLPGFSANVLNTYFNMHFPNAVNLARKMRIGGYVETFRYTTHPWLLSFFLHCPPNLTLANIKIQCPNSTSLASMLQAIENRDIIWHDGPMNMNFENLNAFGLEIALNISANLNRKFGINKPIRVLSLRDVPGLTRGAIRTLIKNNVVGITSGVNSGSAPPNVPKLCRWRAAKRSFNEKNIPEVIYMQXXXXXXXXXXXXXXXXDGMSADNCFRAPKSTEVLCFMFRTDNSGPPQSVEEVLNAYEIVRARYINANLYAGTLEEFFNIVWQNRNLLPLFDNEIGDTWIQGTASDPKKFARFRVMQREFERYYKSGAQISANVINAASYLIKPAEHTYGTEGVGDNINWRNDQWANIIKRNDVISSQLSWVEQRQYQQLVLDLLGYNHSLTLSILKAFKELETYTNLKEFMAQSKPYIYTCSNNTHSIDVGFENGAISYLQAENLKISENFPLGKIIYQTYNESDTEFFLKYYKTYWNTGYGKPNSTVNAHPESKEWKIVMKSIYRQSDSPCSFLCILEPEDPRATSYYGFPDSVLVLWDINISTNEISTEVFWDNKPPTRLMEAISIKFQPEIVGNQFQWYLSKMGEPISPYSVIKNGSQWQHNVDDSGVFISSAPDAKPVFRVIPWDTGITCPIIKGYGPTVWPAPLFPITSNLTGVAFNFYNNVWNTNYIYWYPFMGPGTQLDNRFKARFTTQVNLVTEKVDDTLRY 2356
            MTNVLLLSFIFSTLTYLTQGFGVKPKSYTEEKVIPEPDVTKVNIIFMNHLDVGYSDYMAHLPGFSANVLN YFNMHFPNAVNLARKMRIGGYVETFRYTTHPWLLSFFLHCPPNLTLANIKIQCPNSTSLASMLQAIENRDIIWHDGPMNMNFENLNAFGLEIALNISANLNRKFGINKPIRVLSLRDVPGLTRGAIRTLIKNNVVGITSGVNSGSAPPNVPKLCRWRAAKRSFNEKNIPEVIYMQNPHGYPNNPGPNPNNPDGMSADNCFRAPKSTEVLCFMFRTDNSGPPQSVEEVLNAYEIVRARYINANLYAGTLEEFFNIVWQNRNLLPLFDNEIGDTWIQGTASDPKKFARFRVMQREFERYYKSGAQISANVINAASYLIKPAEHTYGTEGVGDNINWRNDQWANIIKRNDVISSQLSWVEQRQYQQLVLDLLGYNHSLTLSILKAFKELETYTNLKEFMAQSKPYIYTCSNNTHSIDVGFENGAISYLQAENLKISENFPLGKIIYQTYNESDTEFFLKYYKTYWNTGYGKPNSTVNAHPESKEWKIV++++YR+ + PCSFLCIL PED +A++YYGFPDSV + WDINI+   ISTEV  +NK PTRLME+IS+ FQP++V N  QWY SKMGEPISPYSVI+NGSQWQHNVDDSGVFISSAPD+ PVFRVIPWDTG++CPII+GYGPTVWPAPL PITSNLTGVAFNFYNNVWNTNYI+WYPF G  T LDN+FKARFTT VNLVT+KVDDTLRY
Sbjct:    1 MTNVLLLSFIFSTLTYLTQGFGVKPKSYTEEKVIPEPDVTKVNIIFMNHLDVGYSDYMAHLPGFSANVLNIYFNMHFPNAVNLARKMRIGGYVETFRYTTHPWLLSFFLHCPPNLTLANIKIQCPNSTSLASMLQAIENRDIIWHDGPMNMNFENLNAFGLEIALNISANLNRKFGINKPIRVLSLRDVPGLTRGAIRTLIKNNVVGITSGVNSGSAPPNVPKLCRWRAAKRSFNEKNIPEVIYMQNPHGYPNNPGPNPNNPDGMSADNCFRAPKSTEVLCFMFRTDNSGPPQSVEEVLNAYEIVRARYINANLYAGTLEEFFNIVWQNRNLLPLFDNEIGDTWIQGTASDPKKFARFRVMQREFERYYKSGAQISANVINAASYLIKPAEHTYGTEGVGDNINWRNDQWANIIKRNDVISSQLSWVEQRQYQQLVLDLLGYNHSLTLSILKAFKELETYTNLKEFMAQSKPYIYTCSNNTHSIDVGFENGAISYLQAENLKISENFPLGKIIYQTYNESDTEFFLKYYKTYWNTGYGKPNSTVNAHPESKEWKIVLRTMYRKPNHPCSFLCILSPEDSKASTYYGFPDSVFIYWDINIANGHISTEVILNNKHPTRLMESISVVFQPKVVENNHQWYFSKMGEPISPYSVIQNGSQWQHNVDDSGVFISSAPDSPPVFRVIPWDTGLSCPIIEGYGPTVWPAPLSPITSNLTGVAFNFYNNVWNTNYIFWYPFKGSNTTLDNQFKARFTTHVNLVTKKVDDTLRY 766          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000008737.1 (SMESG000008737.1)

HSP 1 Score: 1255.35 bits (3247), Expect = 0.000e+0
Identity = 608/784 (77.55%), Postives = 690/784 (88.01%), Query Frame = 2
Query:   56 IMTNVLLLSFIFS-TLTYLTQGFGVKPKSYTEEKVIPEPDVTKVNIIFMNHLDVGYSDYMAHLPGFSANVLNTYFNMHFPNAVNLARKMRIGGYVETFRYTTHPWLLSFFLHCPPNLTLANIKIQCPNSTSLASMLQAIENRDIIWHDGPMNMNFENLNAFGLEIALNISANLNRKFGINKPIRVLSLRDVPGLTRGAIRTLIKNNVVGITSGVNSGSAPPNVPKLCRWRAAKRSFNEKNIPEVIYMQXXXXXXXXXXXXXXXXDGMSADNCFRAPKSTEVLCFMFRTDNSGPPQSVEEVLNAYEIVRARYINANLYAGTLEEFFNIVWQNRNLLPLFDNEIGDTWIQGTASDPKKFARFRVMQREFERYYKSGAQISANVINAASYLIKPAEHTYGTEGVGDNINWRNDQWANIIKRNDVISSQLSWVEQRQYQQLVLDLLGYNHSLTLSILKAFKELETYTNLK--------------EFMAQSKPYIYTCSNNTHSIDVGFENGAISYLQAENLKISENFPLGKIIYQTYNESDTEFFLKYYKTYWNTGYGKPNSTVNAHPESKEWKIVMKSIYRQSDSPCSFLCILEPEDPRATSYYGFPDSVLVLWDINISTNEISTEVFWDNKPPTRLMEAISIKFQPEIVGNQFQWYLSKMGEPISPYSVIKNGSQWQHNVDDSGVFISSAPDAKPVFRVIPWDTGITCPIIKGYGPTVWPAPLFPITSNLTGVAFNFYNNVWNTNYIYWYPFMGPGTQLDNRFKARFTTQVNLVTEKVDDTLRYYI 2362
            I+ N L L F+F  ++  L++GFG  P    +E VIPEPDVTKVNIIFMNHLDVGYSD++A L G++ANVLNTYFN+H+P A++LA +++  GYVETFRYTTHPWLLSFFL+CP NL LANIK+QCPN+ +L +M+QAI+N  I+WHDGPMNMNFEN+NAFGLE++LNISANLN++FG  KP+RV+SLRDVPGL+RG IRTL+KNNVVGITSGVNSGSAPPNV KLCRWRAA+RSF E+NIPE++YMQNP GYP++ GPNPNNP GM   +CFRAP STEVLCF FR DN+GPPQS++EVLNAYE+VR RYINA LYAGT EEFF+I W+NRNLLP+ DNE+GDTWIQGTASDPKKFARFR MQREFE YY+ G  I++NV++A+ +LIKPAEHTYG +  GD+INWRNDQ+ NI ++  V++S+LSW+EQRQYQQLVLD+LG  H LT+SILKAFK LE +  ++               F  Q+ PY + C+NNTHSI V F++GAI+ L+ +N++IS   PLGK+IY TYNESDTEFFLKYYKTYWNTGYGKPNSTVNAHPESKEWKIVMKSIYRQSDSPCSFLCILEPEDPRATSYYGFPDSVLVLWDINISTNEISTEVFWDNKPPTRLMEAISIKFQPEIVGNQFQWYLSKMGEPISPYSVIKNGSQWQHNVDDSGVFISSAPDAKPVFRVIPWDTGITCPIIKGYGPTVWPAPLFPITSNLTGVAFNFYNNVWNTNYIYWYPFMGPGTQLDNRFKARFTTQVNLVTEKVDDTLRYYI
Sbjct:    2 IIVNSLFLLFVFYFSIIELSEGFGKSPPKNVKEAVIPEPDVTKVNIIFMNHLDVGYSDHLAGLTGYTANVLNTYFNVHYPKAIDLANQLKSQGYVETFRYTTHPWLLSFFLNCPKNLVLANIKVQCPNAAALNTMIQAIKNGVILWHDGPMNMNFENMNAFGLEVSLNISANLNKQFGFIKPVRVVSLRDVPGLSRGVIRTLLKNNVVGITSGVNSGSAPPNVTKLCRWRAARRSFKEQNIPEILYMQNPWGYPDDVGPNPNNPGGMKQQDCFRAPGSTEVLCFKFRVDNTGPPQSIQEVLNAYEVVRGRYINAKLYAGTFEEFFDIAWKNRNLLPVVDNEVGDTWIQGTASDPKKFARFRAMQREFEFYYQMGNPITSNVVDASRFLIKPAEHTYGLDSCGDSINWRNDQFENIRQQPGVLTSELSWIEQRQYQQLVLDILGPTHPLTISILKAFKRLEDFDGIEYRGHGQSARNSIHSSFKLQNNPYSFECTNNTHSITVEFKDGAITSLKMDNIEISPENPLGKLIYNTYNESDTEFFLKYYKTYWNTGYGKPNSTVNAHPESKEWKIVMKSIYRQSDSPCSFLCILEPEDPRATSYYGFPDSVLVLWDINISTNEISTEVFWDNKPPTRLMEAISIKFQPEIVGNQFQWYLSKMGEPISPYSVIKNGSQWQHNVDDSGVFISSAPDAKPVFRVIPWDTGITCPIIKGYGPTVWPAPLFPITSNLTGVAFNFYNNVWNTNYIYWYPFMGPGTQLDNRFKARFTTQVNLVTEKVDDTLRYYI 785          
The following BLAST results are available for this feature:
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GEQ69.271e-15037.05Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DZZ02.873e-14937.05Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GAX93.337e-14936.79Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8H8Q34.571e-14937.09Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E6B61.544e-14639.70Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000008741.10.000e+093.60SMESG000008741.1[more]
SMESG000008737.10.000e+077.55SMESG000008737.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008586 ID=SMED30008586|Name=Reverse transcriptase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2434bp
GATATTTAATTCTTTCTATTAAATTGACTAAGTATTTGGTATTATTCAAG
ATAACATAATGACAAATGTTTTATTGCTATCATTTATATTCTCTACGTTA
ACTTATCTGACTCAAGGATTTGGTGTTAAACCAAAATCTTACACTGAAGA
AAAAGTAATACCAGAACCTGATGTTACTAAAGTGAATATAATATTTATGA
ATCACTTAGATGTTGGGTACAGTGATTATATGGCTCATCTTCCTGGATTT
TCAGCCAATGTTTTGAATACTTATTTTAATATGCATTTTCCAAATGCTGT
AAATTTAGCTAGAAAAATGAGAATTGGAGGTTATGTTGAAACTTTTCGAT
ATACAACTCATCCTTGGTTGTTATCCTTTTTTCTGCACTGTCCACCGAAT
TTGACATTGGCTAATATTAAAATCCAGTGCCCAAATTCCACTTCTTTGGC
TTCCATGTTGCAGGCGATAGAAAATAGAGACATTATTTGGCATGATGGAC
CAATGAATATGAATTTCGAAAATTTAAATGCATTTGGATTAGAAATAGCT
TTAAACATTTCGGCAAATCTTAATCGAAAATTTGGTATAAATAAACCGAT
TCGTGTCCTTTCACTGCGAGATGTGCCAGGTTTAACCCGAGGAGCCATTA
GGACTCTTATAAAGAACAATGTCGTCGGTATTACTAGTGGAGTTAATTCT
GGTTCTGCTCCTCCAAATGTACCAAAATTATGCCGATGGAGAGCTGCTAA
ACGCTCGTTTAACGAAAAGAACATTCCAGAAGTTATTTATATGCAAAATC
CACATGGTTATCCTAACAATCCTGGTCCTAACCCAAATAACCCAGATGGA
ATGTCTGCAGATAATTGTTTTCGTGCTCCTAAATCTACTGAAGTACTTTG
TTTTATGTTTCGTACTGATAATAGCGGACCCCCACAATCCGTTGAAGAAG
TTTTGAATGCCTACGAAATAGTCAGAGCACGTTATATAAATGCAAATTTA
TATGCGGGAACTTTAGAAGAATTCTTCAATATTGTTTGGCAAAATAGAAA
TCTATTGCCTTTATTTGATAACGAAATTGGTGATACATGGATCCAAGGAA
CGGCTTCAGATCCTAAAAAGTTCGCACGTTTCCGAGTAATGCAAAGAGAA
TTTGAACGTTATTATAAATCGGGAGCACAAATATCTGCGAATGTTATCAA
TGCAGCTTCTTATTTAATAAAACCAGCTGAACATACATATGGCACGGAAG
GTGTTGGAGATAATATTAATTGGCGAAATGATCAGTGGGCAAATATTATA
AAAAGAAATGATGTAATTAGTTCTCAATTATCATGGGTTGAACAACGACA
ATATCAGCAATTAGTTTTAGATTTGTTAGGATATAATCATAGTCTCACTC
TGTCAATTTTAAAAGCTTTCAAGGAATTAGAAACTTATACTAATTTGAAA
GAATTTATGGCACAAAGTAAGCCATACATTTATACATGTTCCAATAATAC
TCATTCAATTGATGTTGGATTTGAAAATGGAGCCATTTCTTACTTACAAG
CGGAAAATTTAAAAATTTCTGAAAATTTTCCCCTTGGAAAGATAATTTAT
CAAACCTATAATGAATCTGATACAGAATTCTTTCTGAAATATTATAAAAC
TTATTGGAACACTGGTTATGGAAAACCAAATTCAACAGTTAATGCTCACC
CGGAAAGTAAAGAATGGAAAATCGTAATGAAGAGTATTTATCGACAAAGT
GATAGCCCATGTTCATTTTTGTGCATACTCGAACCGGAAGATCCTAGAGC
AACGTCATATTATGGTTTTCCGGATTCCGTTTTGGTTTTATGGGATATTA
ATATCTCAACAAATGAAATTTCAACAGAGGTATTTTGGGATAATAAACCT
CCAACTCGGCTTATGGAGGCTATTTCAATCAAATTTCAACCGGAAATCGT
TGGTAATCAATTTCAGTGGTATTTGAGTAAAATGGGAGAACCGATATCTC
CTTATTCTGTTATTAAAAATGGTAGTCAATGGCAGCATAATGTAGATGAC
TCTGGAGTGTTCATTTCTTCAGCGCCAGATGCCAAACCGGTATTTCGAGT
AATCCCATGGGATACTGGAATTACATGTCCGATAATCAAGGGCTATGGAC
CAACTGTATGGCCAGCTCCTCTTTTCCCAATCACGAGCAATCTAACTGGA
GTTGCATTTAATTTCTATAACAATGTGTGGAATACCAATTACATATATTG
GTACCCGTTTATGGGGCCTGGAACCCAATTGGACAATAGATTCAAGGCAC
GTTTTACAACTCAAGTGAATTTAGTGACCGAGAAAGTGGACGATACTCTT
CGATATTACATTTAATTTTGGAATTTGTGATGAATTATTTTTGTTATTCT
TGACTTTTATAAATCCTCTTATTGTGAACTCTAA
back to top

protein sequence of SMED30008586-orf-1

>SMED30008586-orf-1 ID=SMED30008586-orf-1|Name=SMED30008586-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=769bp
MTNVLLLSFIFSTLTYLTQGFGVKPKSYTEEKVIPEPDVTKVNIIFMNHL
DVGYSDYMAHLPGFSANVLNTYFNMHFPNAVNLARKMRIGGYVETFRYTT
HPWLLSFFLHCPPNLTLANIKIQCPNSTSLASMLQAIENRDIIWHDGPMN
MNFENLNAFGLEIALNISANLNRKFGINKPIRVLSLRDVPGLTRGAIRTL
IKNNVVGITSGVNSGSAPPNVPKLCRWRAAKRSFNEKNIPEVIYMQNPHG
YPNNPGPNPNNPDGMSADNCFRAPKSTEVLCFMFRTDNSGPPQSVEEVLN
AYEIVRARYINANLYAGTLEEFFNIVWQNRNLLPLFDNEIGDTWIQGTAS
DPKKFARFRVMQREFERYYKSGAQISANVINAASYLIKPAEHTYGTEGVG
DNINWRNDQWANIIKRNDVISSQLSWVEQRQYQQLVLDLLGYNHSLTLSI
LKAFKELETYTNLKEFMAQSKPYIYTCSNNTHSIDVGFENGAISYLQAEN
LKISENFPLGKIIYQTYNESDTEFFLKYYKTYWNTGYGKPNSTVNAHPES
KEWKIVMKSIYRQSDSPCSFLCILEPEDPRATSYYGFPDSVLVLWDINIS
TNEISTEVFWDNKPPTRLMEAISIKFQPEIVGNQFQWYLSKMGEPISPYS
VIKNGSQWQHNVDDSGVFISSAPDAKPVFRVIPWDTGITCPIIKGYGPTV
WPAPLFPITSNLTGVAFNFYNNVWNTNYIYWYPFMGPGTQLDNRFKARFT
TQVNLVTEKVDDTLRYYI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003824catalytic activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006310DNA recombination
GO:0015074DNA integration
GO:0005975carbohydrate metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR032482DUF5054
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032482Protein of unknown function DUF5054PFAMPF16477DUF5054coord: 349..597
e-value: 9.5E-17
score: 61.7
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.836