potassium voltage-gated channel subfamily H member 8

Overview
Namepotassium voltage-gated channel subfamily H member 8
Smed IDSMED30008580
Length (bp)3595
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of potassium voltage-gated channel subfamily H member 8 (SMED30008580) t-SNE clustered cells

Violin plots show distribution of expression levels for potassium voltage-gated channel subfamily H member 8 (SMED30008580) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of potassium voltage-gated channel subfamily H member 8 (SMED30008580) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for potassium voltage-gated channel subfamily H member 8 (SMED30008580) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008580

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008580SMESG000017882.1 SmedASXL_005927SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30008580SMESG000017883.1 SMESG000017882.1 dd_Smed_v4_10983_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008580SMESG000017883.1 SMESG000017882.1 dd_Smed_v4_10983_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Human
Match: KCNH8 (potassium voltage-gated channel subfamily H member 8 [Source:HGNC Symbol;Acc:HGNC:18864])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 372/714 (52.10%), Postives = 485/714 (67.93%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLT-------PKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVD---HANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPYSANWT-GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+ AK +PIVYCSDGF  L  ++R  VM +   C+FL G ETNE+   +I  +   K EFK EI+FYK+ G  F CLLD+VPIKNEKG VVLFL S KD+T       P+DKK+                D    +S   T+ +                 RRRSRAVLYH+ G    + KNK K+N    F    + PEYKV + KK+ FI  H+   K  WDW +L ATFY+A+ VPY+     +      +++ V DI VEILFI+D++ NFRTTYV+ SGQ+++E R I I+Y+  WFI+DLIAA+PFD+L       + T    +HL+K  R+LRL RL+QK+DRY Q+S +VL LL+ MF L AHW+ACIWY IG  E  +N+     +GW+ EL ++L+ PY  N T GGP I + +I ALYFT SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSR + Y ++ +DLK+FIR H +P++LKQRMLE+FQTTW++N GID N++LKDF D LR DI +HLN+E+L L +FE A++GCL++L+  IKT+FC PGEYL+  GD L  IYFVCSGS+E+L+++ V+A+LGK D  G  +       VI++  DVKALTYCDLQCI L G+  +  LYP +   F + +  DL++N++EG
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKSCSCKFLFGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKNGSPFWCLLDIVPIKNEKGDVVLFLASFKDITDTKVKITPEDKKE----------------DKVKGRSRAGTHFDSA---------------RRRSRAVLYHISGHLQRREKNKLKINN-NVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVPYNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVTTWFIIDLIAALPFDLLYAF----NVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLMSMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSAYIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRWSLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITMHLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLKDSMVLAILGKGDLIGANLSIKD--QVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHKFVEDIQHDLTYNLREG 676          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Human
Match: KCNH3 (potassium voltage-gated channel subfamily H member 3 [Source:HGNC Symbol;Acc:HGNC:6252])

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 372/755 (49.27%), Postives = 494/755 (65.43%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNN-NTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAV----QVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL-----NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPY-----------------------SANWTG-----GPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSG 2303
            MP  +GLLAPQNTFLDTIATRFDGTHSNFVLGNA+ A  +P+VYCSDGF  LT +SRA VM RG  C FL GP+T+E  + +I  A    KEFK E+I Y+++G  F CLLDV+PIKNEKG+V LFLVSHKD++   + KN    +  K +         ++S   N N                   RRRSRAVLYHL G    + K K KLN+   F    +LPEYKV  ++K+ FI  H G ++  WD  +L AT Y+A+ VPY   V    +   A     V D+ VE+LFILD+V NFRTT+V+ SGQ+V+  + I ++Y+  WF++D+IAA+PFD+L     N+ FG          HL+K  R+LRL RL+ ++DRY QYSAVVL LL+ +F L AHW+AC+W+YIG RE+ ++ ++   IGW+ EL+ +L+ PY                        AN TG     GP + + +IT+LYF  SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMY+RR  Y S+ RDL+++IR HRIPK LKQRMLE+FQ TWA+N GID  ++L+   D LR DIA+HL++EVL L +FE A++GCL+AL+  ++ AFCTPGEYL+H GD L  +YFVCSGS+E+L+   V+A+LGK D  G  +   +   V+++  DVK LTYC LQC++L G+ +   LYP F   FS+ L  +LS+N+  G     + D+S+ SG
Sbjct:    1 MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEVMQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEKGEVALFLVSHKDIS---ETKNRGGPDRWKETGGGRRRYGRARSKGFNAN-------------------RRRSRAVLYHLSGHLQKQPKGKHKLNK-GVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAVTVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICLHYVTTWFLLDVIAALPFDLLHAFKVNVYFG---------AHLLKTVRLLRLLRLLPRLDRYSQYSAVVLTLLMAVFALLAHWVACVWFYIGQREIESSESELPEIGWLQELARRLETPYYLVGRRPAGGNSSGQSDNCSSSSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKIFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRMLEYFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRRE--QVVKANADVKGLTYCVLQCLQLAGLHDSLALYPEFAPRFSRGLRGELSYNLGAGGGSA-EVDTSSLSG 720          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Human
Match: KCNH4 (potassium voltage-gated channel subfamily H member 4 [Source:HGNC Symbol;Acc:HGNC:6253])

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 358/719 (49.79%), Postives = 472/719 (65.65%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEA-KEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQ--RRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH----ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYS--------VIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGAN 2267
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+  + +PIVYCSDGF  LT Y R  VM +   CRFL GPET+E    ++  A    +E + EI FY++ G  F CLLD++PIKNE G+VVLFL S KD+T              +S    +G       +N+ N              T K++  RRRSR VL+ L G +  + +   K N    F    S+PEYKV  +  +  +  HY   K IWD  +L ATFY+A+ VPY+     D      +++++V DI VE+LFILD++ NFRTTYV+ SGQ++   R I ++Y+  WF +DLIAA+PFD+L I     + T    +HL+K  R+LRL RL+QK++RY Q SAVVL LL+ +F L AHW+ACIWY IG RE+  N+     IGW+ EL ++L+ PY     GGP   + +I ALYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y S+ +DLK+FIR HR+P+ LKQRMLE+FQTTWA+N GID N++L+DF D LR DIA+HLNRE+L L +F  A++GCL+AL+  IKT+FC PGEYL+  GD L   Y+VCSGSLE+L +N V+A+LGK D  G  +               V+++  DVKALTYC LQ +   G+  +  LYP + A F   L +DL+FN+++G++
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGTRGFPIVYCSDGFCELTGYGRTEVMQKTCSCRFLYGPETSEPALQRLHKALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEMGEVVLFLFSFKDIT--------------QSGSPGLGPQGGRGDSNHENSLGRRG-------ATWKFRSARRRSRTVLHRLTGHFGRRGQGGMKANN-NVFEPKPSVPEYKVASVGGSRCLLLHYSVSKAIWDGLILLATFYVAVTVPYNVCFSGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSIGLHYLATWFFIDLIAALPFDLLYIF----NITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFALLAHWMACIWYVIGRREMEANDPLLWDIGWLHELGKRLEVPYVNGSVGGPSRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELRADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGSLEVLRDNMVLAILGKGDLIGADIPEPGQEPGLGADPNFVLKTSADVKALTYCGLQQLSSRGLAEVLRLYPEYGAAFRAGLPRDLTFNLRQGSD 693          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Human
Match: KCNH4 (potassium voltage-gated channel subfamily H member 4 [Source:HGNC Symbol;Acc:HGNC:6253])

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 358/719 (49.79%), Postives = 472/719 (65.65%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEA-KEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQ--RRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH----ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYS--------VIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGAN 2267
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+  + +PIVYCSDGF  LT Y R  VM +   CRFL GPET+E    ++  A    +E + EI FY++ G  F CLLD++PIKNE G+VVLFL S KD+T              +S    +G       +N+ N              T K++  RRRSR VL+ L G +  + +   K N    F    S+PEYKV  +  +  +  HY   K IWD  +L ATFY+A+ VPY+     D      +++++V DI VE+LFILD++ NFRTTYV+ SGQ++   R I ++Y+  WF +DLIAA+PFD+L I     + T    +HL+K  R+LRL RL+QK++RY Q SAVVL LL+ +F L AHW+ACIWY IG RE+  N+     IGW+ EL ++L+ PY     GGP   + +I ALYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y S+ +DLK+FIR HR+P+ LKQRMLE+FQTTWA+N GID N++L+DF D LR DIA+HLNRE+L L +F  A++GCL+AL+  IKT+FC PGEYL+  GD L   Y+VCSGSLE+L +N V+A+LGK D  G  +               V+++  DVKALTYC LQ +   G+  +  LYP + A F   L +DL+FN+++G++
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGTRGFPIVYCSDGFCELTGYGRTEVMQKTCSCRFLYGPETSEPALQRLHKALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEMGEVVLFLFSFKDIT--------------QSGSPGLGPQGGRGDSNHENSLGRRG-------ATWKFRSARRRSRTVLHRLTGHFGRRGQGGMKANN-NVFEPKPSVPEYKVASVGGSRCLLLHYSVSKAIWDGLILLATFYVAVTVPYNVCFSGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSIGLHYLATWFFIDLIAALPFDLLYIF----NITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFALLAHWMACIWYVIGRREMEANDPLLWDIGWLHELGKRLEVPYVNGSVGGPSRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELRADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGSLEVLRDNMVLAILGKGDLIGADIPEPGQEPGLGADPNFVLKTSADVKALTYCGLQQLSSRGLAEVLRLYPEYGAAFRAGLPRDLTFNLRQGSD 693          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Human
Match: KCNH6 (potassium voltage-gated channel subfamily H member 6 [Source:HGNC Symbol;Acc:HGNC:18862])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 307/738 (41.60%), Postives = 437/738 (59.21%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQ-GQYNGKRKNKSK------------LNRFQNFN---------GAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKNS-----------VVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPY-SANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLG-LKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVD-HLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGAN 2267
            MP R+G +APQNT+LDTI  +F+G    F++ NA+ +   I+YC+DGF  L  YSR  VM +   C FL GP T     S+++ A    +E K +I++Y++    F CL+DVVP+KNE G V++F+++ +DL           +   K S   +     SQS   +    G            KY R  S+   + L   ++N ++   S             + R QN           GA+ LPEYK+   +   +   HY P K +WDW +L    Y A+  PY AA  +   +++             V+D+IV+I+F++D+V NFRTTYVN + ++V   RRIA++Y KGWF++D++AAIPFD+L    G+ + TT   I L+K  R+LRL R+ +K+DRY +Y A VL LL+  F L AHWLACIWY IG  E      K IGW+  L  +L K Y  ++   GP + + ++TALYFT SSLTSVGFGNVS NT+SEK+FSICVML+G+LM+A+IFGNV+A+IQR+YS    Y ++   +KEFIR H+IP  L+QR+ E+FQ  W+   GID+N VLK F + L+ DI +HL+R +L     F  A +GCL+ALA K KT    PG+ LVH GD+L  +YF+  GS+EIL ++ VVA+LGKND FG  V  H Q     +S  DV+ALTYCDL  I+   +  +  +YP+F   F   L  +++FN+++ A 
Sbjct:    1 MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVMQQPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDGAVIMFILNFEDLA----------QLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKY-RTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACSYTCSPLTVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLIFRTGSDETTTL--IGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNVERPYLEHK-IGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFGNVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFSGAGKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEPVSLHAQPG---KSSADVRALTYCDLHKIQRADLLEVLDMYPAFAESFWSKL--EVTFNLRDAAG 719          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 448.743 bits (1153), Expect = 1.172e-142
Identity = 231/509 (45.38%), Postives = 333/509 (65.42%), Query Frame = 3
Query:  816 GAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQV----DHANKNSV-----VLDIIVEILFILDVVFNFRTTYVNCSG---QIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSAN----WTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVL-GLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEIL-ENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGAN---HKFD 2279
            GA+ LPEYK+   +       HY P K +WDW +L    Y A+  PY AA  +    D A K+       ++D+IV+I+FI+D++ NFRTTYVN +    Q+V +  +IA +Y KGWFI+D++AA+PFD+L +V  N D TT   I L+K  R+LRL R+ +K+DRY +Y A VL LL+  F L AHWLACIWY IG  EL +   K   W+ +LS++L +PY++      TGGP + + ++T+LYFT S++TS+GFGNVSA TDSEK+F+I +M++G+LM+A++FGNV+A+IQR+YS    Y ++   L+EFIR H+IP  L+QR+ E+FQ  W+   GID+N VLK F D L+ DI +HLNR +L G   F  +  GCL+AL+ + +T    PG+ LVH GDIL  +YF+  GS+EIL ++N V+ +LGK+D FG   + L    V +S C+V+ALTYCDL  I    + ++  +YP F   F K L   +++N+++ A     KFD
Sbjct:   54 GADVLPEYKLQPTRIHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLL-LVSTNSDETTT-LIGLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSH---KEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGE--NPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYPEFAETFCKNL--TITYNLRDDAQSLRKKFD 553          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 446.817 bits (1148), Expect = 1.287e-142
Identity = 231/509 (45.38%), Postives = 333/509 (65.42%), Query Frame = 3
Query:  816 GAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQV----DHANKNSV-----VLDIIVEILFILDVVFNFRTTYVNCSG---QIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSAN----WTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVL-GLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEIL-ENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGAN---HKFD 2279
            GA+ LPEYK+   +       HY P K +WDW +L    Y A+  PY AA  +    D A K+       ++D+IV+I+FI+D++ NFRTTYVN +    Q+V +  +IA +Y KGWFI+D++AA+PFD+L +V  N D TT   I L+K  R+LRL R+ +K+DRY +Y A VL LL+  F L AHWLACIWY IG  EL +   K   W+ +LS++L +PY++      TGGP + + ++T+LYFT S++TS+GFGNVSA TDSEK+F+I +M++G+LM+A++FGNV+A+IQR+YS    Y ++   L+EFIR H+IP  L+QR+ E+FQ  W+   GID+N VLK F D L+ DI +HLNR +L G   F  +  GCL+AL+ + +T    PG+ LVH GDIL  +YF+  GS+EIL ++N V+ +LGK+D FG   + L    V +S C+V+ALTYCDL  I    + ++  +YP F   F K L   +++N+++ A     KFD
Sbjct:   54 GADVLPEYKLQPTRIHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLL-LVSTNSDETTT-LIGLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSH---KEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGE--NPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYPEFAETFCKNL--TITYNLRDDAQSLRKKFD 553          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 448.358 bits (1152), Expect = 3.376e-142
Identity = 231/509 (45.38%), Postives = 333/509 (65.42%), Query Frame = 3
Query:  816 GAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQV----DHANKNSV-----VLDIIVEILFILDVVFNFRTTYVNCSG---QIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSAN----WTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVL-GLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEIL-ENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANH---KFD 2279
            GA+ LPEYK+   +       HY P K +WDW +L    Y A+  PY AA  +    D A K+       ++D+IV+I+FI+D++ NFRTTYVN +    Q+V +  +IA +Y KGWFI+D++AA+PFD+L +V  N D TT   I L+K  R+LRL R+ +K+DRY +Y A VL LL+  F L AHWLACIWY IG  EL +   K   W+ +LS++L +PY++      TGGP + + ++T+LYFT S++TS+GFGNVSA TDSEK+F+I +M++G+LM+A++FGNV+A+IQR+YS    Y ++   L+EFIR H+IP  L+QR+ E+FQ  W+   GID+N VLK F D L+ DI +HLNR +L G   F  +  GCL+AL+ + +T    PG+ LVH GDIL  +YF+  GS+EIL ++N V+ +LGK+D FG   + L    V +S C+V+ALTYCDL  I    + ++  +YP F   F K L   +++N+++ A     KFD
Sbjct:    8 GADVLPEYKLQPTRIHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLL-LVSTNSDETTT-LIGLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSH---KEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGE--NPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYPEFAETFCKNL--TITYNLRDDAQSLRKKFD 507          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 449.514 bits (1155), Expect = 5.164e-142
Identity = 231/509 (45.38%), Postives = 333/509 (65.42%), Query Frame = 3
Query:  816 GAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQV----DHANKNSV-----VLDIIVEILFILDVVFNFRTTYVNCSG---QIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSAN----WTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVL-GLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEIL-ENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANH---KFD 2279
            GA+ LPEYK+   +       HY P K +WDW +L    Y A+  PY AA  +    D A K+       ++D+IV+I+FI+D++ NFRTTYVN +    Q+V +  +IA +Y KGWFI+D++AA+PFD+L +V  N D TT   I L+K  R+LRL R+ +K+DRY +Y A VL LL+  F L AHWLACIWY IG  EL +   K   W+ +LS++L +PY++      TGGP + + ++T+LYFT S++TS+GFGNVSA TDSEK+F+I +M++G+LM+A++FGNV+A+IQR+YS    Y ++   L+EFIR H+IP  L+QR+ E+FQ  W+   GID+N VLK F D L+ DI +HLNR +L G   F  +  GCL+AL+ + +T    PG+ LVH GDIL  +YF+  GS+EIL ++N V+ +LGK+D FG   + L    V +S C+V+ALTYCDL  I    + ++  +YP F   F K L   +++N+++ A     KFD
Sbjct:   54 GADVLPEYKLQPTRIHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLL-LVSTNSDETTT-LIGLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSH---KEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGE--NPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYPEFAETFCKNL--TITYNLRDDAQSLRKKFD 553          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 450.284 bits (1157), Expect = 5.352e-142
Identity = 231/509 (45.38%), Postives = 333/509 (65.42%), Query Frame = 3
Query:  816 GAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQV----DHANKNSV-----VLDIIVEILFILDVVFNFRTTYVNCSG---QIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSAN----WTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVL-GLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEIL-ENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGAN---HKFD 2279
            GA+ LPEYK+   +       HY P K +WDW +L    Y A+  PY AA  +    D A K+       ++D+IV+I+FI+D++ NFRTTYVN +    Q+V +  +IA +Y KGWFI+D++AA+PFD+L +V  N D TT   I L+K  R+LRL R+ +K+DRY +Y A VL LL+  F L AHWLACIWY IG  EL +   K   W+ +LS++L +PY++      TGGP + + ++T+LYFT S++TS+GFGNVSA TDSEK+F+I +M++G+LM+A++FGNV+A+IQR+YS    Y ++   L+EFIR H+IP  L+QR+ E+FQ  W+   GID+N VLK F D L+ DI +HLNR +L G   F  +  GCL+AL+ + +T    PG+ LVH GDIL  +YF+  GS+EIL ++N V+ +LGK+D FG   + L    V +S C+V+ALTYCDL  I    + ++  +YP F   F K L   +++N+++ A     KFD
Sbjct:   84 GADVLPEYKLQPTRIHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLL-LVSTNSDETTT-LIGLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSH---KEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGE--NPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYPEFAETFCKNL--TITYNLRDDAQSLRKKFD 583          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Fly
Match: Elk (gene:FBgn0011589 transcript:FBtr0086802)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 370/755 (49.01%), Postives = 496/755 (65.70%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKS---------------------------------SISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKN-KSKLNRFQNF--NGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL---NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVD-HLQSYS---------------VIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP RKGLLAPQNTFLDTIATRFDGTHSNFVLGNA+A   PIVYCSDGF+ LT YSRA +M +G  C FL GP+T EE K +I  +   K E K E+IFYK+ G  F CL D+VPIKNEK  VVLFL SHKD+T   K    ++   C S                                 + SD GD +  + NN             ++       RRRSRAVLY L G Y  ++   K+KL    NF  +     PEYK   +KK+  I  HYG  K IWDW +L ATFY+ALMVPY+AA     A++ + V D+IVE LFI+D++ NFRTT+V+  G++V   ++IAINY++GWF +DL+AA+PFD L   ++  G   H     IHL+KLTR+LRLARL+QKIDRY Q++A++L LL+  F L AHWLACIWY I ++E       +IGW+  L+E+     +   T     +  + TALYFT +SLTSVGFGNVSANT +EK+F+I +ML+GALMHA +FGNVTA+IQRMYSRR+ Y+SK RDLK+F+  H +PK+LKQR+ ++FQT+W+L+ GID+ + L++F + LRGD+++HL+RE+L L +FE A+QGCLK L+  IKT FC PGEYL+H GD L+YIY++C+GS+E+++++ VVA+LGK D  G+ ++ HL + S               V+RS  D+KALTYCDL+CI + G+  +  LYP ++  F+  +  DL+ N++EG
Sbjct:    1 MPARKGLLAPQNTFLDTIATRFDGTHSNFVLGNAQANGNPIVYCSDGFVDLTGYSRAQIMQKGCSCHFLYGPDTKEEHKQQIEKSLSNKMELKLEVIFYKKEGAPFWCLFDIVPIKNEKRDVVLFLASHKDIT-HTKMLEMNVNEECDSVFALTAALLGARFRAGSNAGMLGLGGLPGLGGPAASD-GDTEAGEGNN------------LDVPAGCNMGRRRSRAVLYQLSGHYKPEKGGVKTKLKLGNNFMHSTEAPFPEYKTQSIKKSRLILPHYGVFKGIWDWVILVATFYVALMVPYNAAFA--KADRQTKVSDVIVEALFIVDILLNFRTTFVSRKGEVVSNSKQIAINYLRGWFALDLLAALPFDHLYASDLYDGEDSH-----IHLVKLTRLLRLARLLQKIDRYSQHTAMILTLLMFSFTLAAHWLACIWYVIAVKEYEWFPESNIGWLQLLAERKNASVAILTT-----AETYSTALYFTFTSLTSVGFGNVSANTTAEKVFTIIMMLIGALMHAVVFGNVTAIIQRMYSRRSLYESKWRDLKDFVALHNMPKELKQRIEDYFQTSWSLSHGIDIYETLREFPEELRGDVSMHLHREILQLPIFEAASQGCLKLLSLHIKTNFCAPGEYLIHKGDALNYIYYLCNGSMEVIKDDMVVAILGKGDLVGSDINVHLVATSNGQMTATTNSAGQDVVVRSSSDIKALTYCDLKCIHMGGLVEVLRLYPEYQQQFANDIQHDLTCNLREG 729          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Fly
Match: Elk (gene:FBgn0011589 transcript:FBtr0340287)

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 368/753 (48.87%), Postives = 495/753 (65.74%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSI---------------------------SDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKN-KSKLNRFQNF--NGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL---NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELH----NNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVD-HLQSYS---------------VIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP RKGLLAPQNTFLDTIATRFDGTHSNFVLGNA+A   PIVYCSDGF+ LT YSRA +M +G  C FL GP+T EE K +I  +   K E K E+IFYK+ G  F CL D+VPIKNEK  VVLFL SHKD+T   K    ++   C S+                            +  GD +  + NN             ++       RRRSRAVLY L G Y  ++   K+KL    NF  +     PEYK   +KK+  I  HYG  K IWDW +L ATFY+ALMVPY+AA     A++ + V D+IVE LFI+D++ NFRTT+V+  G++V   ++IAINY++GWF +DL+AA+PFD L   ++  G   H     IHL+KLTR+LRLARL+QKIDRY Q++A++L LL+  F L AHWLACIWY I ++E      +N     GW+  L+E+     +   T     +  + TALYFT +SLTSVGFGNVSANT +EK+F+I +ML+GALMHA +FGNVTA+IQRMYSRR+ Y+SK RDLK+F+  H +PK+LKQR+ ++FQT+W+L+ GID+ + L++F + LRGD+++HL+RE+L L +FE A+QGCLK L+  IKT FC PGEYL+H GD L+YIY++C+GS+E+++++ VVA+LGK D  G+ ++ HL + S               V+RS  D+KALTYCDL+CI + G+  +  LYP ++  F+  +  DL+ N++EG
Sbjct:    1 MPARKGLLAPQNTFLDTIATRFDGTHSNFVLGNAQANGNPIVYCSDGFVDLTGYSRAQIMQKGCSCHFLYGPDTKEEHKQQIEKSLSNKMELKLEVIFYKKEGAPFWCLFDIVPIKNEKRDVVLFLASHKDIT-HTKMLEMNVNEECDSAALLGARFRAGSNAGMLGLGGLPGLGGPAASDGDTEAGEGNN------------LDVPAGCNMGRRRSRAVLYQLSGHYKPEKGGVKTKLKLGNNFMHSTEAPFPEYKTQSIKKSRLILPHYGVFKGIWDWVILVATFYVALMVPYNAAFA--KADRQTKVSDVIVEALFIVDILLNFRTTFVSRKGEVVSNSKQIAINYLRGWFALDLLAALPFDHLYASDLYDGEDSH-----IHLVKLTRLLRLARLLQKIDRYSQHTAMILTLLMFSFTLAAHWLACIWYVIAVKEYEWFPESNIVFFTGWLQLLAERKNASVAILTT-----AETYSTALYFTFTSLTSVGFGNVSANTTAEKVFTIIMMLIGALMHAVVFGNVTAIIQRMYSRRSLYESKWRDLKDFVALHNMPKELKQRIEDYFQTSWSLSHGIDIYETLREFPEELRGDVSMHLHREILQLPIFEAASQGCLKLLSLHIKTNFCAPGEYLIHKGDALNYIYYLCNGSMEVIKDDMVVAILGKGDLVGSDINVHLVATSNGQMTATTNSAGQDVVVRSSSDIKALTYCDLKCIHMGGLVEVLRLYPEYQQQFANDIQHDLTCNLREG 728          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0310016)

HSP 1 Score: 473.396 bits (1217), Expect = 6.094e-146
Identity = 259/718 (36.07%), Postives = 418/718 (58.22%), Query Frame = 3
Query:  162 MPQ-RKGLLAPQNTFLDTIATRFDG-THSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCG----PETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKNS-----VVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTG--GPEISN------FFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGL-KVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQ 2255
            MP  R+GL+APQNTFL+ I  R +    S+F+L NA+  ++PIVYC++ F  ++ Y+RA VM +   CR++CG      T++E   ++      +++ + EI+ YK+       LL V PI+NE+  VVLFL++ +D+T   +  ++    G       +G +K ++   +                       RSR    HL    +  ++  S L    + + A+ +P+Y+ +  K    I  HY   K IWDW +L  TFY A+MVPY+ A +    NK S     +V+D IV+++F +D+V NF TT+V   G++V + + I +NY+K WFI+DL++ +P+D+ N  F   +         +K+ R+LRL R+++K+DRY +Y A +L LL+  + L AHWLACIWY IG  +  N    S  W+++L+   Q PYS  W+   GPE+ N       ++TALYFT + +TSVGFGNV+A TD+EK+F+IC+M++ AL++A IFG+VT +IQ+M S    Y     +++EF++ H +PK L +R++++  +TWA+ +G+D   VL      ++ DI +HLNR+V      F  A+ GCL+ALA     +   PG+ L HTG+ +  + F+ +GSLE+++++EVVA+LGK D FG      +  +V +S  +V+ALTYCDL  I+   +  +   Y +F   F++ L   L++N++
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQK--SCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNKTPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGV------LGLSKFAKLARSVT---------------------RSRQFSAHLPTLKDPTKQ--SNLAHMMSLS-ADIMPQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFK----NKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFN-AFDRDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYS--WLWKLANVTQSPYSYIWSNDTGPELVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILGKGDVFGD--QFWKDSAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLV--LTYNLR 675          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0303286)

HSP 1 Score: 468.389 bits (1204), Expect = 4.594e-144
Identity = 259/731 (35.43%), Postives = 418/731 (57.18%), Query Frame = 3
Query:  162 MPQ-RKGLLAPQNTFLDTIATRFDG-THSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLC-----------------LLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKNS-----VVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTG--GPEISN------FFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGL-KVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQ 2255
            MP  R+GL+APQNTFL+ I  R +    S+F+L NA+  ++PIVYC++ F  ++ Y+RA VM +   C F+ G  T++E   ++      +++ + EI+ YK+   +  C                 LL V PI+NE+  VVLFL++ +D+T   +  ++    G       +G +K ++   +                       RSR    HL    +  ++  S L    + + A+ +P+Y+ +  K    I  HY   K IWDW +L  TFY A+MVPY+ A +    NK S     +V+D IV+++F +D+V NF TT+V   G++V + + I +NY+K WFI+DL++ +P+D+ N  F   +         +K+ R+LRL R+++K+DRY +Y A +L LL+  + L AHWLACIWY IG  +  N    S  W+++L+   Q PYS  W+   GPE+ N       ++TALYFT + +TSVGFGNV+A TD+EK+F+IC+M++ AL++A IFG+VT +IQ+M S    Y     +++EF++ H +PK L +R++++  +TWA+ +G+D   VL      ++ DI +HLNR+V      F  A+ GCL+ALA     +   PG+ L HTG+ +  + F+ +GSLE+++++EVVA+LGK D FG      +  +V +S  +V+ALTYCDL  I+   +  +   Y +F   F++ L   L++N++
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQKSCRCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNNLQCGCALSQFGKAQTQETPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGV------LGLSKFAKLARSVT---------------------RSRQFSAHLPTLKDPTKQ--SNLAHMMSLS-ADIMPQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFK----NKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFN-AFDRDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYS--WLWKLANVTQSPYSYIWSNDTGPELVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILGKGDVFGD--QFWKDSAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLV--LTYNLR 690          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Fly
Match: eag (gene:FBgn0000535 transcript:FBtr0073955)

HSP 1 Score: 464.151 bits (1193), Expect = 2.886e-143
Identity = 260/735 (35.37%), Postives = 420/735 (57.14%), Query Frame = 3
Query:  162 MPQ-RKGLLAPQNTFLDTIATRFDG-THSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCG----PETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLC-----------------LLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKNS-----VVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTG--GPEISN------FFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGL-KVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQ 2255
            MP  R+GL+APQNTFL+ I  R +    S+F+L NA+  ++PIVYC++ F  ++ Y+RA VM +   CR++CG      T++E   ++      +++ + EI+ YK+   +  C                 LL V PI+NE+  VVLFL++ +D+T   +  ++    G       +G +K ++   +                       RSR    HL    +  ++  S L    + + A+ +P+Y+ +  K    I  HY   K IWDW +L  TFY A+MVPY+ A +    NK S     +V+D IV+++F +D+V NF TT+V   G++V + + I +NY+K WFI+DL++ +P+D+ N  F   +         +K+ R+LRL R+++K+DRY +Y A +L LL+  + L AHWLACIWY IG  +  N    S  W+++L+   Q PYS  W+   GPE+ N       ++TALYFT + +TSVGFGNV+A TD+EK+F+IC+M++ AL++A IFG+VT +IQ+M S    Y     +++EF++ H +PK L +R++++  +TWA+ +G+D   VL      ++ DI +HLNR+V      F  A+ GCL+ALA     +   PG+ L HTG+ +  + F+ +GSLE+++++EVVA+LGK D FG      +  +V +S  +V+ALTYCDL  I+   +  +   Y +F   F++ L   L++N++
Sbjct:    1 MPGGRRGLVAPQNTFLENIIRRSNSQPDSSFLLANAQIVDFPIVYCNESFCKISGYNRAEVMQK--SCRYVCGFMYGELTDKETVGRLEYTLENQQQDQFEILLYKKNNLQCGCALSQFGKAQTQETPLWLLLQVAPIRNERDLVVLFLLTFRDITALKQPIDSEDTKGV------LGLSKFAKLARSVT---------------------RSRQFSAHLPTLKDPTKQ--SNLAHMMSLS-ADIMPQYRQEAPKTPPHILLHYCAFKAIWDWVILCLTFYTAIMVPYNVAFK----NKTSEDVSLLVVDSIVDVIFFIDIVLNFHTTFVGPGGEVVSDPKVIRMNYLKSWFIIDLLSCLPYDVFN-AFDRDEDGIGSLFSALKVVRLLRLGRVVRKLDRYLEYGAAMLILLLCFYMLVAHWLACIWYSIGRSDADNGIQYS--WLWKLANVTQSPYSYIWSNDTGPELVNGPSRKSMYVTALYFTMTCMTSVGFGNVAAETDNEKVFTICMMIIAALLYATIFGHVTTIIQQMTSATAKYHDMLNNVREFMKLHEVPKALSERVMDYVVSTWAMTKGLDTEKVLNYCPKDMKADICVHLNRKVFNEHPAFRLASDGCLRALAMHFMMSHSAPGDLLYHTGESIDSLCFIVTGSLEVIQDDEVVAILGKGDVFGD--QFWKDSAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLV--LTYNLR 692          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Zebrafish
Match: kcnh3 (potassium voltage-gated channel, subfamily H (eag-related), member 3 [Source:ZFIN;Acc:ZDB-GENE-070912-23])

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 388/793 (48.93%), Postives = 507/793 (63.93%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKE-YPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLT--PKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQV----DHAN---KNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL-----NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKS--IGWMFELSEKLQKPY------------------------SANWTG-------------------------------------GPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGI 2306
            MP  +GLLAPQNTFLDTIATRFDGTHSNFVLGNA+ +  YPIVYCSDGF  LT Y+RA +M +   C FL GPET++   ++I  A   ++EFKTE++FYK+ G +F CLLD+VPIKNEKG+VVLFLVSHKD+T   KD+ +  S E   ++ +      +    N N                     RRRSRAVLY L G    + K+K K+N    F     +PEYKV  ++K+ FI  HYG  K  WDW +L ATFY+A+ VPY+    V    D A+       V DI+VEILF+LD+V NFRTT+V+ SGQ+VY+ R I ++Y+  W  VDLIAA+PFD+L     ++ FG         +HL+K  R+LRL RL+QK++RY QYSAVVL LL+ MF L AHW+AC+WY IG  E+ NN+  S  IGW+ EL ++L  PY                        S+ W G                                     GP I + ++T+LYF  SSLTSVGFGNVSANTDSEK+FSIC ML+GALMHAA+FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+PK L QRMLE FQTTW++N GIDV+++LKDF D LR DIA+HLN+E+L L +FE A++GCL++L+  IKT+FC PGE+L+  GD L  IYFVCSGS+E+L++N V+A+LGK D  G+  D L    VI++  +VKALTYCDLQ I L G++ +  LYP +   F   +  DL++N++EG+    D +S  N G+
Sbjct:    1 MPVMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVQSLYPIVYCSDGFCELTGYARAELMQKSCACHFLYGPETSDRLMAQIQGALDERREFKTELVFYKKGGTQFWCLLDIVPIKNEKGEVVLFLVSHKDITDNKKDQDEEQSPERDEETGLEVHKVTRPPGFNAN---------------------RRRSRAVLYQLSGHLQKQDKSKLKINN-NMFGEKPPIPEYKVAAIQKSRFILLHYGTFKAGWDWLILLATFYVAVTVPYNVCFTVVGGRDEASTPRSPPSVSDILVEILFMLDIVLNFRTTFVSTSGQVVYDARSICVHYVTTWLFVDLIAALPFDLLYAFNVSVYFG---------VHLLKTVRLLRLLRLLQKLERYSQYSAVVLTLLMSMFALLAHWMACVWYIIGRSEIENNSPGSWDIGWLHELGKRLGTPYFLSPLASLIPDSLRPTILDGLVVNSSQWNGSDLVAHEPVWNSSQLNSTGTAPAAPSNAGQTGAVLGGGPSIRSSYVTSLYFALSSLTSVGFGNVSANTDSEKIFSICTMLIGALMHAAVFGNVTAIIQRMYSRRSLYHTRTKDLKDFIRVHRLPKALAQRMLECFQTTWSVNNGIDVSELLKDFPDELRADIAMHLNKELLQLPLFESASRGCLRSLSLIIKTSFCAPGEFLIRQGDALQAIYFVCSGSMEVLKDNTVLAILGKGDLIGS--DSLTKEQVIKTNANVKALTYCDLQYISLKGLREVLRLYPEYAQKFVSEIQHDLTYNLREGSGADLDWES--NGGL 758          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Zebrafish
Match: kcnh4b (potassium voltage-gated channel, subfamily H (eag-related), member 4b [Source:ZFIN;Acc:ZDB-GENE-121214-54])

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 367/711 (51.62%), Postives = 498/711 (70.04%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEA-KEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYH----AAVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL---NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKS--IGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA 2264
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+LGNA+  + YPIVYCSDGF  LT + R  VM +   C FL G  T+E+    +  A   K+E++ E+ FYK+ G  F CLLD+VPIKNEKG++VLFL S KD+T   +K ++S      S   D  +++T++ ++ +                    RRR  A++Y L  Q+    KN  KL+R  +     SLPEYKV  ++K+ FI  HY   K +WDW +L ATFY+A+ VPY+    A   V+ A ++++V DI VE+LFILD++ NFRTTYV+ SGQ+VYE R I ++Y   WF VDL+AA+PFD+L   NI       T    +HL+K  R+LRL RL+QK+DRY QYSA+VL LL+ MF L AHW+ACIWY IG +E+  N + +  IGW+ EL ++L KPY  +  GGP + + +I +LYFT SSLTSVGFGNV ANTD+EK+FS+C ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+P++LKQRMLE+FQTTW++N GIDVN++L DF D LR DIA+HLN+++L L VFE A++GCL++L+  IKT+FCTPGEYL+  GD L   YFVCSGSLE+L++N V+A+LG+ D  G+  D      VI++  DVKALTYCDLQ I + G+ ++  LYP +  +F+  ++++L++N++EG+
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLGNAQGHRGYPIVYCSDGFCELTGFGRTEVMQKNCSCHFLYGSGTSEQVVQGVKKAMEGKEEYQAEVQFYKKNGSLFWCLLDIVPIKNEKGEMVLFLFSFKDITETHEKSHHS------SKTDDKANSRTTEKSHISKA------------------RRRGHAMIYQLTSQFTRDSKNDVKLSR--DMFEKPSLPEYKVAAVQKSRFILLHYSVSKALWDWMILLATFYVAVTVPYNVCFTAYSDVETAGRSTIVSDIAVEMLFILDIILNFRTTYVSQSGQVVYEPRSICLHYATTWFFVDLVAALPFDLLYAFNI-------TVTSLVHLLKTVRLLRLLRLLQKLDRYSQYSAMVLTLLMSMFALLAHWMACIWYIIGRKEMETNASGAWDIGWLHELGKRLDKPYMNSTFGGPSVRSAYIASLYFTLSSLTSVGFGNVCANTDAEKIFSVCTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRMKDLKDFIRVHRLPQQLKQRMLEYFQTTWSVNNGIDVNELLHDFPDELRADIAMHLNKDILQLPVFEAASRGCLRSLSLHIKTSFCTPGEYLIRQGDALQANYFVCSGSLEVLKDNMVLAILGRGDLIGS--DLPGQNHVIKTNADVKALTYCDLQYIGVKGLSDVLELYPEYANIFTIDIHRNLTYNLREGS 676          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Zebrafish
Match: kcnh4b (potassium voltage-gated channel, subfamily H (eag-related), member 4b [Source:ZFIN;Acc:ZDB-GENE-121214-54])

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 367/711 (51.62%), Postives = 498/711 (70.04%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEA-KEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYH----AAVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL---NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKS--IGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA 2264
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+LGNA+  + YPIVYCSDGF  LT + R  VM +   C FL G  T+E+    +  A   K+E++ E+ FYK+ G  F CLLD+VPIKNEKG++VLFL S KD+T   +K ++S      S   D  +++T++ ++ +                    RRR  A++Y L  Q+    KN  KL+R  +     SLPEYKV  ++K+ FI  HY   K +WDW +L ATFY+A+ VPY+    A   V+ A ++++V DI VE+LFILD++ NFRTTYV+ SGQ+VYE R I ++Y   WF VDL+AA+PFD+L   NI       T    +HL+K  R+LRL RL+QK+DRY QYSA+VL LL+ MF L AHW+ACIWY IG +E+  N + +  IGW+ EL ++L KPY  +  GGP + + +I +LYFT SSLTSVGFGNV ANTD+EK+FS+C ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+P++LKQRMLE+FQTTW++N GIDVN++L DF D LR DIA+HLN+++L L VFE A++GCL++L+  IKT+FCTPGEYL+  GD L   YFVCSGSLE+L++N V+A+LG+ D  G+  D      VI++  DVKALTYCDLQ I + G+ ++  LYP +  +F+  ++++L++N++EG+
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLGNAQGHRGYPIVYCSDGFCELTGFGRTEVMQKNCSCHFLYGSGTSEQVVQGVKKAMEGKEEYQAEVQFYKKNGSLFWCLLDIVPIKNEKGEMVLFLFSFKDITETHEKSHHS------SKTDDKANSRTTEKSHISKA------------------RRRGHAMIYQLTSQFTRDSKNDVKLSR--DMFEKPSLPEYKVAAVQKSRFILLHYSVSKALWDWMILLATFYVAVTVPYNVCFTAYSDVETAGRSTIVSDIAVEMLFILDIILNFRTTYVSQSGQVVYEPRSICLHYATTWFFVDLVAALPFDLLYAFNI-------TVTSLVHLLKTVRLLRLLRLLQKLDRYSQYSAMVLTLLMSMFALLAHWMACIWYIIGRKEMETNASGAWDIGWLHELGKRLDKPYMNSTFGGPSVRSAYIASLYFTLSSLTSVGFGNVCANTDAEKIFSVCTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRMKDLKDFIRVHRLPQQLKQRMLEYFQTTWSVNNGIDVNELLHDFPDELRADIAMHLNKDILQLPVFEAASRGCLRSLSLHIKTSFCTPGEYLIRQGDALQANYFVCSGSLEVLKDNMVLAILGRGDLIGS--DLPGQNHVIKTNADVKALTYCDLQYIGVKGLSDVLELYPEYANIFTIDIHRNLTYNLREGS 676          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Zebrafish
Match: kcnh8 (potassium voltage-gated channel, subfamily H (eag-related), member 8 [Source:ZFIN;Acc:ZDB-GENE-060503-204])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 363/708 (51.27%), Postives = 484/708 (68.36%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQ-YNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH-ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNN-NTKSIGWMFELSEKLQKPYS--ANWT--GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+ +K +PIVYCSDGF  LT ++R  VM +   C+FL GPET+E     +  A   + E K EI+FYK++G  F CLLD+VPIKNEKG VVLFL S KD+T    K     +          GD+    +                        R RS  VLYH+ G  +N ++++K KLN+   F    +LPEYKV + KK+ FI  H+   K  WDW +L ATFY+A+ VPY+     D    +++ V DI VEILFI+D+VF+FRTTYV+ SGQ++++ R+I I+Y+  WFI+DL+AA+PFD+L         +    +HL+K  R+LRL RL+QK+DRY Q+S VVL LL+ MF L AHW+ACIWY IG +E+ +N +T  IGW+ EL ++L+ PY   AN T   GP + + +I ALYFT SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSR ++Y ++ +DLK+FIR H +P+ LKQRMLE+FQTTW++N GID N++L+DF D LR DIA+HLN+E+L L VF   ++GCL++L+  IKT+FC PGEYL+  GD L  ++FVCSGS+E+L++N V+A+LGK D  G  +       VI++  DVKALTYCDLQCI L G+  +  LYP +   F + +  DL++N++EG
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVSKGFPIVYCSDGFCELTGFARTEVMQQSCACKFLYGPETSEHIILHVDAALEERSELKEEIMFYKKSGSVFWCLLDIVPIKNEKGDVVLFLASFKDVTDTKAKSTLEEKKEECRREKVKGDSPFGST------------------------RLRSSTVLYHISGHLHNRQKQSKIKLNK-NVFGDPPALPEYKVADAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVPYNVCFIGDQDLTRSTTVTDIAVEILFIIDIVFSFRTTYVSKSGQVIFDARQICIHYMTTWFIIDLVAALPFDLLYAF----KVSVVSVVHLLKTVRLLRLLRLLQKMDRYSQHSTVVLTLLMSMFALLAHWMACIWYIIGKKEVESNADTWDIGWLHELGKRLESPYEGVANRTLSSGPSLRSIYIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRWSSYHTRTKDLKDFIRVHHLPQSLKQRMLEYFQTTWSVNNGIDSNELLRDFPDELRSDIAMHLNKEILELSVFSSLSRGCLRSLSLHIKTSFCAPGEYLLRQGDALQALFFVCSGSMEVLKDNMVLAILGKGDLIGANMS--VGDRVIKTNADVKALTYCDLQCINLRGLYEVLDLYPEYSHRFVQDITHDLTYNLREG 677          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Zebrafish
Match: kcnh4a (potassium voltage-gated channel, subfamily H (eag-related), member 4a [Source:ZFIN;Acc:ZDB-GENE-131125-34])

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 360/732 (49.18%), Postives = 492/732 (67.21%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKN--NSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHA-----------AVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNN--TKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG----------ANHKFD 2279
            MP  KGLLAPQNTFLDTIA RFDGTHSNF+LGNA+ ++ YPIVYCSDGF  LT ++R  VM +   C+FL G ET+E    ++      ++EF+TE+ +Y++ G  F CLLD+VPIKNEKG+VVLFL+S K++T    K +  +S E   +     +G    SQ+                        R R R VLYHL  Q+  + K K   N F       +LPEYKV  ++K+ FI  HY   K +WDW +L ATFY+A+ VPY+            +   D +++ ++V DI VE+LFILD++ NFRTTYV  +GQ+VY+ R I ++Y   WFI+DLIAA+PFD+L +      + +   +HL+K  R+LRL RL+QK+D Y QYSAVVL LL+ +F L AHWLAC+WY IG +EL +N+  T  IGW+ EL ++L+ PY+    GGP + + +I +LYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+P++LKQRMLE+FQTTW++N GI+ N++L DF D LR DIA+HLN+++L L +F  A++GCL++L+  IKT+FC PGEYL+  GD LH  +FVCSGSLE+L++  V+A+LGK D  G   D      VI++  DVKALTYCDLQ I +  +Q +  LYP + + F++ ++ +L++N++EG          A  KFD
Sbjct:    1 MPVMKGLLAPQNTFLDTIAKRFDGTHSNFLLGNAQGSRGYPIVYCSDGFCELTGFARTEVMKKTCTCQFLHGQETSERVTQQVEKTLEGQREFQTEVCYYRKNGTTFWCLLDIVPIKNEKGEVVLFLLSFKNITDSYGKSHLGSSTEEDRRHG-RKVGRTHLSQA------------------------RERGRNVLYHLTCQFTNRSKRKLPNNVFSQ----PTLPEYKVASVQKSRFILLHYSVCKAMWDWLILLATFYVAVTVPYNVCFSTPDDSQLDSPDCDSSSRTTIVSDIAVEMLFILDIILNFRTTYVGPAGQVVYDTRSICLHYCTTWFILDLIAALPFDLLYLF-----NISTSLVHLLKTVRLLRLLRLLQKLDGYSQYSAVVLTLLMSVFALLAHWLACVWYVIGRQELASNDPLTWDIGWLQELGKRLETPYTNGTVGGPSLRSAYIASLYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRMKDLKDFIRVHRLPQQLKQRMLEYFQTTWSVNNGINANELLHDFPDELRADIAMHLNKDILQLPLFSSASRGCLRSLSLHIKTSFCAPGEYLIRHGDALHAQHFVCSGSLEVLKDGMVLAILGKGDLVG--ADLPGKDQVIKANADVKALTYCDLQYISVRALQEVLELYPEYGSRFNEDIHHNLTYNLREGQARFSRSTRLAQEKFD 696          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Xenopus
Match: snc13.2 (class I histocompatibility antigen [Source:Xenbase;Acc:XB-GENE-5757686])

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 365/708 (51.55%), Postives = 475/708 (67.09%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKE-YPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVD----HANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNN--TKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA 2264
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+    +PIVYCSDGF  LT + R  VM +   CRFL G ET+E     I      K+E++ E+  YK+    F C LD+VPIKNEKG+VVLFL S KD T          E   +   SD  +   S S++                   +  RR+SR ++  + GQ  G+ K+  KLN   N     SLPEYKV   +K  FI  HY   K +WDW +L ATFY+A+ VPY+           A ++++V DI VE+LFI+D++ NFRTTYV+ SGQ+VYE R I I+Y+  WF VDLIAA+PFD+L       + T    +HL+K  R+LRL RL+QK+DRY QYSA+VL LL+ MF L AHW+AC+WY IG +E+ +N+  T  IGW+ EL ++L+ PY  N  GGP I + +I +LYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR H +P++LKQR LE+FQTTW++N GID N++LKDF D LR DIA+HLN+++L L VFE A++GCL+AL+  IKT+FC PGEYL+  GD L   YFVCSGSLE+L++N V+A+LGK D  G   D      VI++  DVKALTYCDLQ + L G+  +  LYP +   F   ++ DL+FN++EG+
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQVHHGFPIVYCSDGFCDLTGFGRTEVMQKNCTCRFLYGVETSENVIQDIERVLDEKQEYQAEVCLYKKDANLFWCQLDIVPIKNEKGEVVLFLFSFKDTT----------EIRMRMQYSDKKEGGRSGSSH------------------FRSSRRQSRTMMCQMSGQVAGRNKSDLKLNSVSN--NKPSLPEYKVASAEKPRFILLHYSIFKALWDWLILLATFYVAVTVPYNVCFTGHDDSVSAARSTIVSDIAVEMLFIIDIILNFRTTYVSHSGQVVYETRSICIHYLATWFFVDLIAALPFDLLYAF----NVTVTSLVHLLKTIRLLRLLRLLQKLDRYSQYSAMVLTLLMSMFALLAHWMACVWYVIGRKEMESNDPVTWDIGWLHELGKRLEAPYINNSIGGPSIRSAYIASLYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRVKDLKDFIRVHCLPQQLKQRTLEYFQTTWSVNNGIDANELLKDFPDELRADIAMHLNKDILQLSVFETASRGCLRALSLHIKTSFCAPGEYLLRQGDALQANYFVCSGSLEVLKDNMVLAILGKGDLIGA--DLSNKDQVIKTNADVKALTYCDLQYLSLRGLLEVLELYPEYCNKFRADIHHDLTFNLREGS 672          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Xenopus
Match: snc13.2 (class I histocompatibility antigen [Source:Xenbase;Acc:XB-GENE-5757686])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 365/708 (51.55%), Postives = 475/708 (67.09%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKE-YPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVD----HANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNN--TKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA 2264
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+    +PIVYCSDGF  LT + R  VM +   CRFL G ET+E     I      K+E++ E+  YK+    F C LD+VPIKNEKG+VVLFL S KD T          E   +   SD  +   S S++                   +  RR+SR ++  + GQ  G+ K+  KLN   N     SLPEYKV   +K  FI  HY   K +WDW +L ATFY+A+ VPY+           A ++++V DI VE+LFI+D++ NFRTTYV+ SGQ+VYE R I I+Y+  WF VDLIAA+PFD+L       + T    +HL+K  R+LRL RL+QK+DRY QYSA+VL LL+ MF L AHW+AC+WY IG +E+ +N+  T  IGW+ EL ++L+ PY  N  GGP I + +I +LYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR H +P++LKQR LE+FQTTW++N GID N++LKDF D LR DIA+HLN+++L L VFE A++GCL+AL+  IKT+FC PGEYL+  GD L   YFVCSGSLE+L++N V+A+LGK D  G   D      VI++  DVKALTYCDLQ + L G+  +  LYP +   F   ++ DL+FN++EG+
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQVHHGFPIVYCSDGFCDLTGFGRTEVMQKNCTCRFLYGVETSENVIQDIERVLDEKQEYQAEVCLYKKDANLFWCQLDIVPIKNEKGEVVLFLFSFKDTT----------EIRMRMQYSDKKEGGRSGSSH------------------FRSSRRQSRTMMCQMSGQVAGRNKSDLKLNSVSN--NKPSLPEYKVASAEKPRFILLHYSIFKALWDWLILLATFYVAVTVPYNVCFTGHDDSVSAARSTIVSDIAVEMLFIIDIILNFRTTYVSHSGQVVYETRSICIHYLATWFFVDLIAALPFDLLYAF----NVTVTSLVHLLKTIRLLRLLRLLQKLDRYSQYSAMVLTLLMSMFALLAHWMACVWYVIGRKEMESNDPVTWDIGWLHELGKRLEAPYINNSIGGPSIRSAYIASLYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRVKDLKDFIRVHCLPQQLKQRTLEYFQTTWSVNNGIDANELLKDFPDELRADIAMHLNKDILQLSVFETASRGCLRALSLHIKTSFCAPGEYLLRQGDALQANYFVCSGSLEVLKDNMVLAILGKGDLIGA--DLSNKDQVIKTNADVKALTYCDLQYLSLRGLLEVLELYPEYCNKFRADIHHDLTFNLREGS 672          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Xenopus
Match: fth1.1 (ferritin, heavy polypeptide 1, gene 1 [Source:Xenbase;Acc:XB-GENE-5742862])

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 358/706 (50.71%), Postives = 475/706 (67.28%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVD---HANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK-SIGWMFELSEKLQKPYSANWT-GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+ AK +PIVYCSDGF  L  ++R  VM +   C+FL G ETNE+   +I  +   K EFK EI+FYK+ G  F CLLD+VPIKNEKG VVLFL S KD+T         IE   K      G  K     +                      +RRSRAVLYH+ G    +R+          F    +LPEYKV + KK+ FI  H+   K  WDW +L ATFY+A+ VPY+ + + +    + +++ V DI VEILFI D++ NFRTTYV+ SGQ++++ R I I+Y+  WF++DLIAA+PFD+L       + T    +HL+K  R+LRL RL+QK+DRY Q+S +VL LL+ MF L AHW+ACIWY IG  E+ N      IGW+ EL ++L+ P+ +N + GGP I + +I +LYFT SSLTSVGFGNVSANTD EK+FSIC+ML+GALMHA +FGNVTA+IQRMYSR + Y ++ +DLK+FIR H +P++LKQRMLE+FQT W++N GID +++LKDF D LR DI ++LN+E+L L +FE A++GCL++L+  IKT+FC PGEYL+  GD L  IY VCSGS+E+L++  V+A+LGK D  G  +       VI++  DVKALTYCDLQCI L G+  +   YP +   F + + QDL++N++EG
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKSCSCKFLYGAETNEQTTLEIEMSLEEKSEFKGEIMFYKKNGTSFWCLLDIVPIKNEKGDVVLFLASFKDIT----DIKAKIEKEDKKEERLKGRGKAGSHFDAA--------------------KRRSRAVLYHISGHIQ-RREKNKLNLNNNVFVDKPALPEYKVQDAKKSKFIILHFSTFKAAWDWLILLATFYVAVTVPYNVSFEDNDDPSSTRSTTVSDISVEILFITDIILNFRTTYVSESGQVIFKSRSICIHYVTTWFVIDLIAALPFDLLYAF----NVTVVSLVHLLKTIRLLRLLRLLQKLDRYSQHSTIVLTLLMSMFALLAHWMACIWYVIGKMEMKNKPLSWDIGWLHELGKRLESPFHSNDSQGGPTIRSTYIASLYFTLSSLTSVGFGNVSANTDVEKIFSICIMLIGALMHALVFGNVTAIIQRMYSRWSLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTNWSVNNGIDSHELLKDFPDELRSDITMYLNKEILQLSLFESASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYLVCSGSMEVLKDGMVLAILGKGDLIGANLSIKD--QVIKTNADVKALTYCDLQCIILKGLYEVLDFYPEYAHTFVEHIQQDLTYNLREG 675          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Xenopus
Match: fth1.1 (ferritin, heavy polypeptide 1, gene 1 [Source:Xenbase;Acc:XB-GENE-5742862])

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 358/706 (50.71%), Postives = 475/706 (67.28%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVD---HANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK-SIGWMFELSEKLQKPYSANWT-GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+ AK +PIVYCSDGF  L  ++R  VM +   C+FL G ETNE+   +I  +   K EFK EI+FYK+ G  F CLLD+VPIKNEKG VVLFL S KD+T         IE   K      G  K     +                      +RRSRAVLYH+ G    +R+          F    +LPEYKV + KK+ FI  H+   K  WDW +L ATFY+A+ VPY+ + + +    + +++ V DI VEILFI D++ NFRTTYV+ SGQ++++ R I I+Y+  WF++DLIAA+PFD+L       + T    +HL+K  R+LRL RL+QK+DRY Q+S +VL LL+ MF L AHW+ACIWY IG  E+ N      IGW+ EL ++L+ P+ +N + GGP I + +I +LYFT SSLTSVGFGNVSANTD EK+FSIC+ML+GALMHA +FGNVTA+IQRMYSR + Y ++ +DLK+FIR H +P++LKQRMLE+FQT W++N GID +++LKDF D LR DI ++LN+E+L L +FE A++GCL++L+  IKT+FC PGEYL+  GD L  IY VCSGS+E+L++  V+A+LGK D  G  +       VI++  DVKALTYCDLQCI L G+  +   YP +   F + + QDL++N++EG
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKSCSCKFLYGAETNEQTTLEIEMSLEEKSEFKGEIMFYKKNGTSFWCLLDIVPIKNEKGDVVLFLASFKDIT----DIKAKIEKEDKKEERLKGRGKAGSHFDAA--------------------KRRSRAVLYHISGHIQ-RREKNKLNLNNNVFVDKPALPEYKVQDAKKSKFIILHFSTFKAAWDWLILLATFYVAVTVPYNVSFEDNDDPSSTRSTTVSDISVEILFITDIILNFRTTYVSESGQVIFKSRSICIHYVTTWFVIDLIAALPFDLLYAF----NVTVVSLVHLLKTIRLLRLLRLLQKLDRYSQHSTIVLTLLMSMFALLAHWMACIWYVIGKMEMKNKPLSWDIGWLHELGKRLESPFHSNDSQGGPTIRSTYIASLYFTLSSLTSVGFGNVSANTDVEKIFSICIMLIGALMHALVFGNVTAIIQRMYSRWSLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTNWSVNNGIDSHELLKDFPDELRSDITMYLNKEILQLSLFESASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYLVCSGSMEVLKDGMVLAILGKGDLIGANLSIKD--QVIKTNADVKALTYCDLQCIILKGLYEVLDFYPEYAHTFVEHIQQDLTYNLREG 675          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Xenopus
Match: snc13.2 (class I histocompatibility antigen [Source:Xenbase;Acc:XB-GENE-5757686])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 364/710 (51.27%), Postives = 480/710 (67.61%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKE-YPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEK--FLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVD----HANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNN--TKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA 2264
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+    +PIVYCSDGF  LT + R  VM +   CRFL G ET+E     I      K+E++ E+  YK+ G    F C LD+VPIKNEKG+VVLFL S KD T + +    +  +    S+  +  +K  +S +                +  +  RR+SR ++  + GQ  G+ K+  KLN     N   SLPEYKV   +K  FI  HY   K +WDW +L ATFY+A+ VPY+           A ++++V DI VE+LFI+D++ NFRTTYV+ SGQ+VYE R I I+Y+  WF VDLIAA+PFD+L       + T    +HL+K  R+LRL RL+QK+DRY QYSA+VL LL+ MF L AHW+AC+WY IG +E+ +N+  T  IGW+ EL ++L+ PY  N  GGP I + +I +LYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR H +P++LKQR LE+FQTTW++N GID N++LKDF D LR DIA+HLN+++L L VFE A++GCL+AL+  IKT+FC PGEYL+  GD L   YFVCSGSLE+L++N V+A+LGK D  G   D      VI++  DVKALTYCDLQ + L G+  +  LYP +   F   ++ DL+FN++EG+
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQVHHGFPIVYCSDGFCDLTGFGRTEVMQKNCTCRFLYGVETSENVIQDIERVLDEKQEYQAEVCLYKKDGGSNLFWCQLDIVPIKNEKGEVVLFLFSFKDTT-EIRMPIYTPYHLMSLSLYCLEKHKNRRSGS----------------SHFRSSRRQSRTMMCQMSGQVAGRNKSDLKLN-----NNKPSLPEYKVASAEKPRFILLHYSIFKALWDWLILLATFYVAVTVPYNVCFTGHDDSVSAARSTIVSDIAVEMLFIIDIILNFRTTYVSHSGQVVYETRSICIHYLATWFFVDLIAALPFDLLYAF----NVTVTSLVHLLKTIRLLRLLRLLQKLDRYSQYSAMVLTLLMSMFALLAHWMACVWYVIGRKEMESNDPVTWDIGWLHELGKRLEAPYINNSIGGPSIRSAYIASLYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRVKDLKDFIRVHCLPQQLKQRTLEYFQTTWSVNNGIDANELLKDFPDELRADIAMHLNKDILQLSVFETASRGCLRALSLHIKTSFCAPGEYLLRQGDALQANYFVCSGSLEVLKDNMVLAILGKGDLIG--ADLSNKDQVIKTNADVKALTYCDLQYLSLRGLLEVLELYPEYCNKFRADIHHDLTFNLREGS 682          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Mouse
Match: Kcnh8 (potassium voltage-gated channel, subfamily H (eag-related), member 8 [Source:MGI Symbol;Acc:MGI:2445160])

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 371/707 (52.48%), Postives = 483/707 (68.32%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH---ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPYSANWT-GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+ AK +PIVYCSDGF  L  ++R  VM +   C+FL G ETNE+   +I  +   K EFK EI+FYK+ G  F CLLD+VPIKNEKG VVLFL S KD+T  D K   + E           D K  ++   +      D             RRRSRAVLYH+ G    + KNK K+N    F    + PEYKV + KK+ FI  H+   K  WDW +L ATFY+A+ VPY+     +      +++ V DI VEILFI+D++ NFRTTYV+ SGQ+++E R I I+Y+  WFI+DLIAA+PFD+L       + T    +HL+K  R+LRL RL+QK+DRY Q+S +VL LL+ MF L AHW+ACIWY IG  E  +N+     +GW+ EL ++L+ PY  N T GGP I + +I ALYFT SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSR + Y ++ +DLK+FIR H +P++LKQRMLE+FQTTW++N GID N++LKDF D LR DI +HLN+E+L L +FE A++GCL++L+  IKT+FC PGEYL+  GD L  IYFVCSGS+E+L+++ V+A+LGK D  G  +       VI++  DVKALTYCDLQCI L G+  +  LYP +   F + +  DL++N++EG
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKSCSCKFLFGVETNEQLMLQIEKSLEEKVEFKGEIMFYKKNGAPFWCLLDIVPIKNEKGDVVLFLASFKDIT--DTKVKITSE-----------DKKEDRTKGRSRAGSHFDSA-----------RRRSRAVLYHISGHLQRREKNKLKINN-NVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVPYNVCFIGNEDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVTTWFIIDLIAALPFDLLYAF----NVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLMSMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSAYIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRWSLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITMHLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLKDSMVLAILGKGDLIGANLSIKD--QVIKTNADVKALTYCDLQCIILKGLFEVLGLYPEYAHKFVEDIQHDLTYNLREG 676          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Mouse
Match: Kcnh3 (potassium voltage-gated channel, subfamily H (eag-related), member 3 [Source:MGI Symbol;Acc:MGI:1341723])

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 369/765 (48.24%), Postives = 489/765 (63.92%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAV----QVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL-----NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPY----------------------------------SANWT-----GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSG 2303
            MP  +GLLAPQNTFLDTIATRFDGTHSNFVLGNA+ A  +P+VYCSDGF  LT +SRA VM RG  C FL GP+T+E  + +I  A    KEFK E+I Y+++G  F CLLDV+PIKNEKG+V LFLVSHKD++  + K     +N  +         +      N N                   RRRSRAVLYHL G    + K K KLN+   F    +LPEYKV  ++K+ FI  H G ++  WD  +L AT Y+A+ VPY   V    +   A     V D+ VE+LFILD+V NFRTT+V+ SGQ+V+  + I ++Y+  WF++D+IAA+PFD+L     N+  G          HL+K  R+LRL RL+ ++DRY QYSAVVL LL+ +F L AHW+AC+W+YIG +E+ ++ ++   IGW+ EL+ +L+ PY                                   AN T     GGP + + +IT+LYF  SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMY+RR  Y S+ RDL+++IR HRIPK LKQRMLE+FQ TWA+N GID  ++L+   D LR DIA+HL++EVL L +FE A++GCL+AL+  ++ AFCTPGEYL+H GD L  +YFVCSGS+E+L+   V+A+LGK D  G  +   Q   V+++  DVK LTYC LQC++L G+     LYP F   FS+ L  +LS+N+  G     + D+S+ SG
Sbjct:    1 MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEVMQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEKGEVALFLVSHKDIS--ETKNRGGPDNWKERGGGRRRYGRAGSKGFNAN-------------------RRRSRAVLYHLSGHLQKQPKGKHKLNK-GVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAVTVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICLHYVTTWFLLDVIAALPFDLLHAFKVNVYVG---------AHLLKTVRLLRLLRLLPRLDRYSQYSAVVLTLLMAVFALLAHWVACVWFYIGQQEIESSESELPEIGWLQELARRLETPYYLVSRSPDGGNSSGQSENCSSSSSSSGSGGGRGSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKIFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRMLEYFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELP--QREQVVKANADVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGVSA-EVDTSSLSG 731          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Mouse
Match: Kcnh4 (potassium voltage-gated channel, subfamily H (eag-related), member 4 [Source:MGI Symbol;Acc:MGI:2156184])

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 355/717 (49.51%), Postives = 473/717 (65.97%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEA-KEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIE-NGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH----ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYS--------VIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA 2264
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+  + +PIVYCSDGF  LT Y R  VM +   CRFL GPET+E    ++  A    +E +TEI FY++ G  F CLLD++PIKNE G+VVLFL S KD++        S   +G  +  + +G   TS    +T                    +R++R VL+ L G + G+R   S       F    S+PEYKV  +  +  +  HY   K +WD  +L ATFY+A+ VPY+     D      +++++V DI VE+LFILD++ NFRTTYV+ SGQ++   R I ++Y+  WF VDLIAA+PFD+L +     + T    +HL+K  R+LRL RL+QK++RY Q SAVVL LL+ +F L AHW+AC+WY IG RE+  N+     IGW+ EL ++L++PY     GGP   + +I ALYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y S+ +DLK+FIR HR+P+ LKQRMLE+FQTTWA+N GID N++L+DF D LR DIA+HLNRE+L L +F  A++GCL+AL+  IKT+FC PGEYL+  GD L   Y+VCSGSLE+L +N V+A+LGK D  G  +  L            V+++  DVKALTYC LQ +   G+  +  LYP + A F   L +DL+FN+++G+
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEVMQKTCSCRFLYGPETSEPALQRLQKALEGHQEHRTEICFYRKDGSAFWCLLDMMPIKNEMGEVVLFLFSFKDISQSGGPGLGSPGIHGDNNHENSLGRRGTSSRLRST--------------------KRQNRTVLHRLTGHF-GRRGQSSVKANSNLFEPKPSVPEYKVASVGGSRCLLLHYSIPKAVWDGLILLATFYVAVTVPYNVCFAGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSIGLHYLATWFFVDLIAALPFDLLYVF----NITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFALLAHWMACVWYVIGRREMEANDPLLWDIGWLHELGKRLEEPYVNGSAGGPSRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELRADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGSLEVLRDNMVLAILGKGDLIGADIPELGQEPGSGAGPSCVLKTSADVKALTYCGLQQLSSRGLAEVLRLYPEYAAAFRAGLPRDLTFNLRQGS 692          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Mouse
Match: Kcnh4 (potassium voltage-gated channel, subfamily H (eag-related), member 4 [Source:MGI Symbol;Acc:MGI:2156184])

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 355/717 (49.51%), Postives = 473/717 (65.97%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEA-KEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIE-NGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH----ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYS--------VIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA 2264
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+  + +PIVYCSDGF  LT Y R  VM +   CRFL GPET+E    ++  A    +E +TEI FY++ G  F CLLD++PIKNE G+VVLFL S KD++        S   +G  +  + +G   TS    +T                    +R++R VL+ L G + G+R   S       F    S+PEYKV  +  +  +  HY   K +WD  +L ATFY+A+ VPY+     D      +++++V DI VE+LFILD++ NFRTTYV+ SGQ++   R I ++Y+  WF VDLIAA+PFD+L +     + T    +HL+K  R+LRL RL+QK++RY Q SAVVL LL+ +F L AHW+AC+WY IG RE+  N+     IGW+ EL ++L++PY     GGP   + +I ALYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y S+ +DLK+FIR HR+P+ LKQRMLE+FQTTWA+N GID N++L+DF D LR DIA+HLNRE+L L +F  A++GCL+AL+  IKT+FC PGEYL+  GD L   Y+VCSGSLE+L +N V+A+LGK D  G  +  L            V+++  DVKALTYC LQ +   G+  +  LYP + A F   L +DL+FN+++G+
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEVMQKTCSCRFLYGPETSEPALQRLQKALEGHQEHRTEICFYRKDGSAFWCLLDMMPIKNEMGEVVLFLFSFKDISQSGGPGLGSPGIHGDNNHENSLGRRGTSSRLRST--------------------KRQNRTVLHRLTGHF-GRRGQSSVKANSNLFEPKPSVPEYKVASVGGSRCLLLHYSIPKAVWDGLILLATFYVAVTVPYNVCFAGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSIGLHYLATWFFVDLIAALPFDLLYVF----NITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFALLAHWMACVWYVIGRREMEANDPLLWDIGWLHELGKRLEEPYVNGSAGGPSRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELRADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGSLEVLRDNMVLAILGKGDLIGADIPELGQEPGSGAGPSCVLKTSADVKALTYCGLQQLSSRGLAEVLRLYPEYAAAFRAGLPRDLTFNLRQGS 692          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Mouse
Match: Kcnh6 (potassium voltage-gated channel, subfamily H (eag-related), member 6 [Source:MGI Symbol;Acc:MGI:2684139])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 304/729 (41.70%), Postives = 439/729 (60.22%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKN------KSKLNRFQNFN---------GAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQV---DHANKNS--------VVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPY-SANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLG-LKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVD-HLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP R+G +APQNT+LDTI  +F+G    F++ NA+ +   I+YC+DGF  L  YSR  VM R   C FL GP T     S+++ A    +E K +I++Y++    F CL+DVVP+KNE G V++F+++ +DL     K ++        S S +G    S+ +++    +G      +  T S+  +     V ++L+   +G             + R QN           GA+ LPEYK+   +       HY P K +WDW +L    Y A+  PY AA  +   D + + +         V+D+IV+I+F++D+V NFRTTYVN + ++V   RRIA++Y KGWF++D++AAIPFD+L    G+ + TT   I L+K  R+LRL R+ +K+DRY +Y A VL LL+  F L AHWLACIWY IG  E      K IGW+  L  +L K Y  ++   GP + + ++TALYFT SSLTSVGFGNVS NT+SEK+FSICVML+G+LM+A+IFGNV+A+IQR+YS    Y ++   +KEFIR H+IP  L+QR+ E+FQ  W+   GID+N VLK F + L+ DI +HL+R +L     F  A++GCL+ALA K KT    PG+ LVH GD+L  +YF+  GS+EIL ++ VVA+LGKND FG     H +     +S  DV+ALTYCDL  I    +  +  +YP+F   F   L  +++FN+++ 
Sbjct:    1 MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVMQRPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKSSSRSLTQRLLSHSFLG----SEGSHSRPSGQGPGPGRGKYGTVSQIPQFTLSFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQAPRIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDDSQRGTCGYTCSPLTVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLIFRTGSDETTTL--IGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNVERPYLEPK-IGWLDSLGAQLGKHYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFGNVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFRGASKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEPASLHARPG---KSSADVRALTYCDLHKIHRADLLEVLDMYPAFADTFWNKL--EVTFNLRDA 717          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. UniProt/SwissProt
Match: sp|Q96L42|KCNH8_HUMAN (Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens OX=9606 GN=KCNH8 PE=2 SV=2)

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 372/714 (52.10%), Postives = 485/714 (67.93%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLT-------PKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVD---HANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPYSANWT-GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+ AK +PIVYCSDGF  L  ++R  VM +   C+FL G ETNE+   +I  +   K EFK EI+FYK+ G  F CLLD+VPIKNEKG VVLFL S KD+T       P+DKK+                D    +S   T+ +                 RRRSRAVLYH+ G    + KNK K+N    F    + PEYKV + KK+ FI  H+   K  WDW +L ATFY+A+ VPY+     +      +++ V DI VEILFI+D++ NFRTTYV+ SGQ+++E R I I+Y+  WFI+DLIAA+PFD+L       + T    +HL+K  R+LRL RL+QK+DRY Q+S +VL LL+ MF L AHW+ACIWY IG  E  +N+     +GW+ EL ++L+ PY  N T GGP I + +I ALYFT SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSR + Y ++ +DLK+FIR H +P++LKQRMLE+FQTTW++N GID N++LKDF D LR DI +HLN+E+L L +FE A++GCL++L+  IKT+FC PGEYL+  GD L  IYFVCSGS+E+L+++ V+A+LGK D  G  +       VI++  DVKALTYCDLQCI L G+  +  LYP +   F + +  DL++N++EG
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKSCSCKFLFGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKNGSPFWCLLDIVPIKNEKGDVVLFLASFKDITDTKVKITPEDKKE----------------DKVKGRSRAGTHFDSA---------------RRRSRAVLYHISGHLQRREKNKLKINN-NVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVPYNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVTTWFIIDLIAALPFDLLYAF----NVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLMSMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSAYIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRWSLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITMHLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLKDSMVLAILGKGDLIGANLSIKD--QVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHKFVEDIQHDLTYNLREG 676          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. UniProt/SwissProt
Match: sp|Q9QWS8|KCNH8_RAT (Potassium voltage-gated channel subfamily H member 8 OS=Rattus norvegicus OX=10116 GN=Kcnh8 PE=2 SV=2)

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 371/707 (52.48%), Postives = 483/707 (68.32%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH---ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPYSANWT-GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+ AK +PIVYCSDGF  L  ++R  VM +   C+FL G ETNE+   +I  +   K EFK EI+FYK+ G  F CLLD+VPIKNEKG VVLFL S KD+T  D K   + E           D K  ++   +      D             RRRSRAVLYH+ G    + KNK K+N    F    + PEYKV + KK+ FI  H+   K  WDW +L ATFY+A+ VPY+     +      +++ V DI VEILFI+D++ NFRTTYV+ SGQ+++E R I I+Y+  WFI+DLIAA+PFD+L       + T    +HL+K  R+LRL RL+QK+DRY Q+S +VL LL+ MF L AHW+ACIWY IG  E  +N+     +GW+ EL ++L+ PY  N T GGP I + +I ALYFT SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSR + Y ++ +DLK+FIR H +P++LKQRMLE+FQTTW++N GID N++LKDF D LR DI +HLN+E+L L +FE A++GCL++L+  IKT+FC PGEYL+  GD L  IYFVCSGS+E+L+++ V+A+LGK D  G  +       VI++  DVKALTYCDLQCI L G+  +  LYP +   F + +  DL++N++EG
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKSCSCKFLFGVETNEQLMLQIEKSLEEKVEFKGEIMFYKKNGAPFWCLLDIVPIKNEKGDVVLFLASFKDIT--DTKVKITSE-----------DKKEDRAKGRSRAGSHFDSA-----------RRRSRAVLYHISGHLQRREKNKLKINN-NVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVPYNVCFIGNEDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVTTWFIIDLIAALPFDLLYAF----NVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLMSMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSAYIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRWSLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITMHLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLKDSMVLAILGKGDLIGANLSIKD--QVIKTNADVKALTYCDLQCIILKGLFEVLGLYPEYAHKFVEDIQHDLTYNLREG 676          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. UniProt/SwissProt
Match: sp|Q9ULD8|KCNH3_HUMAN (Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens OX=9606 GN=KCNH3 PE=1 SV=2)

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 372/755 (49.27%), Postives = 494/755 (65.43%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNN-NTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAV----QVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL-----NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPY-----------------------SANWTG-----GPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSG 2303
            MP  +GLLAPQNTFLDTIATRFDGTHSNFVLGNA+ A  +P+VYCSDGF  LT +SRA VM RG  C FL GP+T+E  + +I  A    KEFK E+I Y+++G  F CLLDV+PIKNEKG+V LFLVSHKD++   + KN    +  K +         ++S   N N                   RRRSRAVLYHL G    + K K KLN+   F    +LPEYKV  ++K+ FI  H G ++  WD  +L AT Y+A+ VPY   V    +   A     V D+ VE+LFILD+V NFRTT+V+ SGQ+V+  + I ++Y+  WF++D+IAA+PFD+L     N+ FG          HL+K  R+LRL RL+ ++DRY QYSAVVL LL+ +F L AHW+AC+W+YIG RE+ ++ ++   IGW+ EL+ +L+ PY                        AN TG     GP + + +IT+LYF  SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMY+RR  Y S+ RDL+++IR HRIPK LKQRMLE+FQ TWA+N GID  ++L+   D LR DIA+HL++EVL L +FE A++GCL+AL+  ++ AFCTPGEYL+H GD L  +YFVCSGS+E+L+   V+A+LGK D  G  +   +   V+++  DVK LTYC LQC++L G+ +   LYP F   FS+ L  +LS+N+  G     + D+S+ SG
Sbjct:    1 MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEVMQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEKGEVALFLVSHKDIS---ETKNRGGPDRWKETGGGRRRYGRARSKGFNAN-------------------RRRSRAVLYHLSGHLQKQPKGKHKLNK-GVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAVTVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICLHYVTTWFLLDVIAALPFDLLHAFKVNVYFG---------AHLLKTVRLLRLLRLLPRLDRYSQYSAVVLTLLMAVFALLAHWVACVWFYIGQREIESSESELPEIGWLQELARRLETPYYLVGRRPAGGNSSGQSDNCSSSSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKIFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRMLEYFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRRE--QVVKANADVKGLTYCVLQCLQLAGLHDSLALYPEFAPRFSRGLRGELSYNLGAGGGSA-EVDTSSLSG 720          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. UniProt/SwissProt
Match: sp|P59111|KCNH8_MOUSE (Potassium voltage-gated channel subfamily H member 8 OS=Mus musculus OX=10090 GN=Kcnh8 PE=2 SV=2)

HSP 1 Score: 704.901 bits (1818), Expect = 0.000e+0
Identity = 370/707 (52.33%), Postives = 482/707 (68.18%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH---ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPYSANWT-GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+ AK +PIVYCSDGF  L  ++R  VM +   C+FL G ETNE+   +I  +   K EFK EI+FYK+ G  F CLLD+VPIKNEKG VVLFL S KD+T  D K   + E           D K  ++   +      D             RRRSRAVLYH+ G    + KNK K+N    F    + PEYK  + KK+ FI  H+   K  WDW +L ATFY+A+ VPY+     +      +++ V DI VEILFI+D++ NFRTTYV+ SGQ+++E R I I+Y+  WFI+DLIAA+PFD+L       + T    +HL+K  R+LRL RL+QK+DRY Q+S +VL LL+ MF L AHW+ACIWY IG  E  +N+     +GW+ EL ++L+ PY  N T GGP I + +I ALYFT SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSR + Y ++ +DLK+FIR H +P++LKQRMLE+FQTTW++N GID N++LKDF D LR DI +HLN+E+L L +FE A++GCL++L+  IKT+FC PGEYL+  GD L  IYFVCSGS+E+L+++ V+A+LGK D  G  +       VI++  DVKALTYCDLQCI L G+  +  LYP +   F + +  DL++N++EG
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKSCSCKFLFGVETNEQLMLQIEKSLEEKVEFKGEIMFYKKNGAPFWCLLDIVPIKNEKGDVVLFLASFKDIT--DTKVKITSE-----------DKKEDRTKGRSRAGSHFDSA-----------RRRSRAVLYHISGHLQRREKNKLKINN-NVFVDKPAFPEYKASDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVPYNVCFIGNEDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVTTWFIIDLIAALPFDLLYAF----NVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLMSMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSAYIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRWSLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITMHLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLKDSMVLAILGKGDLIGANLS--IKDQVIKTNADVKALTYCDLQCIILKGLFEVLGLYPEYAHKFVEDIQHDLTYNLREG 676          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. UniProt/SwissProt
Match: sp|O89047|KCNH3_RAT (Potassium voltage-gated channel subfamily H member 3 OS=Rattus norvegicus OX=10116 GN=Kcnh3 PE=2 SV=1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 370/757 (48.88%), Postives = 489/757 (64.60%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAV----QVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL-----NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK--SIGWMFELSEKLQKPY--------------------------SANWT-----GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSG 2303
            MP  +GLLAPQNTFLDTIATRFDGTHSNFVLGNA+ A  +P+VYCSDGF  LT +SRA VM RG  C FL GP+T+E  + +I  A    KEFK E+I Y+++G  F CLLDV+PIKNEKG+V LFLVSHKD++  + K     +N  +         +      N N                   RRRSRAVLYHL G    + K K KLN+   F    +LPEYKV  ++K+ FI  H G ++  WD  +L AT Y+A+ VPY   V    +   A     V D+ VE+LFILD+V NFRTT+V+ SGQ+V+  + I ++Y+  WF++D+IAA+PFD+L     N+  G          HL+K  R+LRL RL+ ++DRY QYSAVVL LL+ +F L AHW+AC+W+YIG +E+ N+ ++   IGW+ EL+ +L+ PY                           AN T     GGP + + +IT+LYF  SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMY+RR  Y S+ RDL+++IR HRIPK LKQRMLE+FQ TWA+N GID  ++L+   D LR DIA+HL++EVL L +FE A++GCL+AL+  ++ AFCTPGEYL+H GD L  +YFVCSGS+E+L+   V+A+LGK D  G  +   Q   V+++  DVK LTYC LQC++L G+     LYP F   FS+ L  +LS+N+  G     + D+S+ SG
Sbjct:    1 MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVAGLFPVVYCSDGFCDLTGFSRAEVMQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEKGEVALFLVSHKDIS--ETKNRGGPDNWKERGGGRRRYGRAGSKGFNAN-------------------RRRSRAVLYHLSGHLQKQPKGKHKLNK-GVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAVTVPYSVCVSTAREPSAARGPPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICLHYVTTWFLLDVIAALPFDLLHAFKVNVYVG---------AHLLKTVRLLRLLRLLPRLDRYSQYSAVVLTLLMAVFALLAHWVACVWFYIGQQEIENSESELPEIGWLQELARRLETPYYLVSRSPDGGNSSGQSENCSSSGGGSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKIFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRMLEYFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALRPAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELP--QREQVVKANADVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGVSA-EVDTSSLSG 723          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. TrEMBL
Match: A0A267EXZ9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034371g1 PE=4 SV=1)

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 422/764 (55.24%), Postives = 543/764 (71.07%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLT----------------------PKDKKKNNSIENG-CKSSIS------DMGDNKTSQSNNN-----TNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNK--SKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAA------VQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFG--NQDHTTKPQ-IHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPY--------------SANWT---GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGAN 2267
            MPQR+G LAPQNTFLDTIATRFDGTHSNFVLGNA+AKE PIVYCSDGF  LT ++RA VMSRG  CRFL G  T +EEK+KI ++   +KE KTE+IFY +T   FLCLLD+VPIKNEKG+VVLFL SHKD+T                      P D   N S   G  +S IS      D  DN+++ S +       + EE  DED EE  T  KYQRRRSRAVLYHL GQ+  K KNK  S+LN+ QN +G  +LPEYKV E+K++  I  HYG +KI WDW +L  TFYIA+MVPY+AA       + + A+   + +D++VE++FI D+  NFRTT+V+ SGQ+VY QR IAINYIK WF +DL+AA+PFDI+ ++    + D  +K +  +LMKL RMLRL +L QKIDRY QYS++VL LLI MF L AHW ACIW  IG ++L  N T+ I W+ +LS  +  P+              S N +   GGP  ++ +ITALY+TCSSLTS+GFGNVSANTD EK+FSICVML+GALMHAA+FGNVTALIQ+MY++R AY +K ++LK+F RTH IPK LK+RM EFFQ  W++NRGI+ ++++KDF + LRGDIA+HLNRE+L L +FE A+QGCLKA+AQ+I+T FC P EYLVH+GD+L YIYFV +GS+EIL+ N VVA+LGK D FGT + + +   ++RS CDV++LTYCD+QCIEL G+  + L YP +   F + L  DL++N++EG++
Sbjct:    1 MPQRRGFLAPQNTFLDTIATRFDGTHSNFVLGNAQAKERPIVYCSDGFCELTGFARAQVMSRGCACRFLWGERTADEEKAKIEDSLEEQKELKTEVIFYTKTRSPFLCLLDIVPIKNEKGEVVLFLASHKDITKEKRSRCGVSSPSGDSSNSQADPSDLANNVSPSAGRPRSRISEASGPADTADNESASSGSVGSGSSPDEEEANDEDAEECSTAYKYQRRRSRAVLYHLSGQFESKSKNKTFSQLNKIQNLSGKSTLPEYKVQEVKRSKGILLHYGLLKITWDWLILLCTFYIAIMVPYNAANSSGKLRKANGADDAGIAVDLLVEVVFIADICINFRTTFVSKSGQVVYCQRMIAINYIKTWFFLDLLAAVPFDIIILISNAVSSDLASKMETFNLMKLARMLRLLKLYQKIDRYAQYSSLVLLLLISMFALSAHWFACIWLVIGRKQLEVNQTREISWISKLSSDINAPFDFSCSSGAPDEDASSGNGSCSVGGPAKASRYITALYYTCSSLTSIGFGNVSANTDHEKIFSICVMLIGALMHAAVFGNVTALIQKMYAKRAAYTAKTQELKDFTRTHHIPKHLKRRMQEFFQAMWSINRGINPSEIMKDFPEELRGDIALHLNREILSLPIFETASQGCLKAIAQQIQTVFCRPEEYLVHSGDVLKYIYFVVNGSMEILKENMVVAILGKGDLFGTDIKNPE--GLMRSMCDVRSLTYCDVQCIELKGLIELLLQYPEYHEKFKEDLLHDLTYNMREGSD 762          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. TrEMBL
Match: A0A267DRF8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018296g1 PE=4 SV=1)

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 417/764 (54.58%), Postives = 543/764 (71.07%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKK---------------------NNSIENGCK--------SSISDMGDNKTSQSNNN-----TNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNK--SKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAA------VQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFG--NQDHTTKPQ-IHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPY--------------SANWT---GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGAN 2267
            MPQR+G LAPQNTFLDTIATRFDGTHSNFVLGNA+AKE PIVYCSDGF  LT ++RA VMSRG  CRFL G  T +EEK+KI ++   +KE KTE+IFY +T   FLCLLD+VPIKNEKG+VVLFL SHKD+T + + +                     NN   +  +        S  +D  DN+++ S +       + EE  DED EE  T  KYQRRRSRAVLYHL GQ+  K KNK  S+LN+ QN +G  +LPEYKV E+K++  I  HYG +KI WDW +L  TFYIA+MVPY+AA       + + A+   + +D++VE++FI D+  NFRTT+V+ SGQ+VY QR IAINYIK WF +DL+AA+PFDI+ ++    + D  +K +  +LMKL RMLRL +L QKIDRY QYS++VL LLI MF L AHW ACIW  IG ++L  N T+ I W+ +LS  +  P+              S N +   GGP  ++ +ITALY+TCSSLTS+GFGNVSANTD EK+FSICVML+GALMHAA+FGNVTALIQ+MY++R AY +K ++LK+F RTH IPK LK+RM EFFQ  W++NRGI+ ++++KDF + LRGDIA+HLNRE+L L +FE A+QGCLKA+AQ+I+T FC P EYLVH+GD+L YIYFV +GS+EIL+ N VVA+LGK D FGT + + +   ++RS CDV++LTYCD+QCIEL G+  + L YP +   F + L  DL++N++EG++
Sbjct:    1 MPQRRGFLAPQNTFLDTIATRFDGTHSNFVLGNAQAKERPIVYCSDGFCELTGFARAQVMSRGCACRFLWGERTADEEKAKIEDSLEEQKELKTEVIFYTKTRSPFLCLLDIVPIKNEKGEVVLFLASHKDITKEKRSRCGVSSPSGDSSNSQADPSGLANNVSPSAGRPRSRISEASGPADTADNESASSGSVGSGSSPDEEEANDEDAEECSTAYKYQRRRSRAVLYHLSGQFESKSKNKTFSQLNKIQNLSGKSTLPEYKVQEVKRSKGILLHYGLLKITWDWLILLCTFYIAIMVPYNAANSSGKLRKANGADDAGIAVDLLVEVVFIADICINFRTTFVSKSGQVVYCQRMIAINYIKTWFFLDLLAAVPFDIIILISNAVSSDLASKMETFNLMKLARMLRLLKLYQKIDRYAQYSSLVLLLLISMFALSAHWFACIWLVIGRKQLEVNQTREISWISKLSSDINAPFDFSCSSGAPDEDASSGNGSCSVGGPAKASRYITALYYTCSSLTSIGFGNVSANTDHEKIFSICVMLIGALMHAAVFGNVTALIQKMYAKRAAYTAKTQELKDFTRTHHIPKHLKRRMQEFFQAMWSINRGINPSEIMKDFPEELRGDIALHLNREILSLPIFETASQGCLKAIAQQIQTVFCRPEEYLVHSGDVLKYIYFVVNGSMEILKENMVVAILGKGDLFGTDIKNPE--GLMRSMCDVRSLTYCDVQCIELKGLIELLLQYPEYHEKFKEDLLHDLTYNMREGSD 762          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. TrEMBL
Match: A0A1S3I8E8 (potassium voltage-gated channel subfamily H member 8 OS=Lingula unguis OX=7574 GN=LOC106161295 PE=4 SV=1)

HSP 1 Score: 797.734 bits (2059), Expect = 0.000e+0
Identity = 395/704 (56.11%), Postives = 514/704 (73.01%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHA---AVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK-SIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP RKGLLAPQNTFLDTIA RFDGTHSNFVLGNA+A  YPIVYCSDGF  LT +SRA VMS+   C+FL GPE+ EE+K +I  A    KE KTE++FYK+ G  F CLLD+VPIKNEKG+VVLFL SHKD+T K+K  +   +   +        +    SNN+                  KYQRRRSRAVLYHL GQ+    K+K +LN+ QN +G ++LPEYKV E  +   I  HY   KI WDW +L  TFYIA++VP++A   A Q D   + S+V D+IVE+LFI+D+V NFRTTYV+ SGQ++Y+ + IAINYIKGWF++DL+AAIPFD+L ++  +    T   IHL+K+ R+LRLARL+QK+DRY QYS V+LALL+  + L AHWLACIWY IG  E++ N    ++GW+FEL+E++  P   N +  P+++  ++TALYFT SSLTSVGFGNVSANT++EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR  Y +K RDLK+F  TH IPK LKQRM EFFQTTW++N GID  ++LKDF + LRGDI++HL R++L L +FE A+QGC+K+++ +IKT+FC PGEYL H GD ++YIY++CSGS+EIL+++ VVA+LGK D FG  +D      V +S CDV++LTYCDLQCI + G+  + +LYP F   F+  L  DL++N++EG
Sbjct:    1 MPGRKGLLAPQNTFLDTIARRFDGTHSNFVLGNAQAINYPIVYCSDGFCELTCFSRAQVMSKSCACKFLYGPESKEEKKMEIDMALENHKELKTEVLFYKKNGTPFWCLLDIVPIKNEKGEVVLFLCSHKDIT-KEKVISMDTDAAVQGDSPTHDPDLLESSNNDI-----------------KYQRRRSRAVLYHLSGQFQKPNKSKLQLNKLQNLSGKKTLPEYKVQEAHRPRLILLHYSIFKIAWDWLILLCTFYIAVIVPFNACFVATQED-GERKSLVADVIVEMLFIIDIVLNFRTTYVSSSGQVIYDPKMIAINYIKGWFVLDLLAAIPFDLLYMLQVD----TGTLIHLLKIARLLRLARLLQKMDRYSQYSTVILALLMSTYVLIAHWLACIWYLIGKEEINANGANWTVGWIFELTERIDLPV-YNKSDIPDVATSYLTALYFTTSSLTSVGFGNVSANTNAEKIFSICAMLVGALMHAVVFGNVTAIIQRMYSRRQTYHTKTRDLKDFFCTHHIPKPLKQRMQEFFQTTWSINNGIDPIEILKDFPEELRGDISMHLYRDILSLPIFETASQGCVKSVSLQIKTSFCAPGEYLAHKGDAINYIYYLCSGSMEILKDDMVVAILGKGDLFGCDIDFED--MVNKSSCDVRSLTYCDLQCICIKGLLEVLMLYPEFAESFTNDLQHDLTYNLREG 678          

HSP 2 Score: 70.4774 bits (171), Expect = 2.717e-8
Identity = 35/89 (39.33%), Postives = 54/89 (60.67%), Query Frame = 3
Query: 2049 LGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVL 2315
            +GK D FG  +D      V +S CDV++LTYCDLQCI + G+  + +LYP F   F+  L  DL++N++EG    ++ + S  +G+  L
Sbjct:  683 VGKGDLFGCDIDFEDM--VNKSSCDVRSLTYCDLQCICIKGLLEVLMLYPEFAESFTNDLQHDLTYNLREG----YEPEESEMNGVPSL 765          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. TrEMBL
Match: R7UNL6 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_168526 PE=4 SV=1)

HSP 1 Score: 783.482 bits (2022), Expect = 0.000e+0
Identity = 398/739 (53.86%), Postives = 523/739 (70.77%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDK----KKNNSIENGCKSSI----SDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTS------------KYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKN----SVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNN-NTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILE-NNEVVALLGKNDWF----------GTYV---DHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP RKGLLAPQNTFLDTIATRFDGTHSNFVLGNA+A  +PIVYCSDGF  LT ++RA VMS+   C+FL G ET+ +E   I +A   + E KTE++FYK+ G  F CLLD+VPIKNEKG+VVLFL SHKD++ KDK       +S  NG    +    + +   + S     TN         E    TS            KYQRRRSRAVLY L G YN  +  KSKL   +N +G  S+PEYKV E+K++ FI  HYG  KI WDW +L  TFYIA++VPY+AA    + + N    S+V D+IVEILF +D++ NFRTTYV+ SGQ++Y+ + IA+NY +GWF++DL+AAIPFD+L     N    T   IHL+K+ R+LRLARLMQK++RY QYS V+L LL+ MF + AHWLAC+WY+IG  EL ++ +  ++GW+++LSEKL KP   N T   +  + +I+ALYFTC+SLTSVGFGNVSANTD+EK+FS+  ML+GALMHA +FGNVTA+IQR+YSRR  YQSK +DLK+F+R H IPK LKQR+ E+FQTTW+LN GID ++VL+DF   ++GDIA+HL++EVL   +FE+A+QGCLKA++ KIK+ FC PGEY++H G+I++Y+YFVC+GSLEIL+ N  VVA+LG+   F          G Y+   D   S +VI+S CDVK+LTYCDL+CI L G++ +  LYP F+  F   +  DL++N++EG
Sbjct:    1 MPARKGLLAPQNTFLDTIATRFDGTHSNFVLGNAQASSHPIVYCSDGFCELTGFTRAQVMSKSCACKFLYGSETSADEIHGIESALDKQVELKTEVLFYKKGGTSFWCLLDIVPIKNEKGEVVLFLASHKDIS-KDKFVSFDTADSQLNGKPLFVYYLLATVAQQRYSHPPITTNMFSRVIFTSEMPSCTSIGEENNVNESCQKYQRRRSRAVLYQLSGTYNKHKTTKSKLQLNKNLSGT-SVPEYKVQEIKRSKFILLHYGIFKIGWDWLILLCTFYIAIIVPYNAAFVTSNESSNQERASIVSDVIVEILFSIDIILNFRTTYVSKSGQVMYDPKLIALNYFRGWFLLDLLAAIPFDLLYAFQVN----TGTLIHLLKVARLLRLARLMQKLERYSQYSFVILTLLMAMFTVLAHWLACVWYFIGKEELASSPDNWTVGWLYQLSEKLDKPV-INRTLSFDHRSAYISALYFTCTSLTSVGFGNVSANTDAEKIFSVIAMLIGALMHALVFGNVTAIIQRLYSRRAIYQSKTQDLKDFLRVHHIPKVLKQRLQEYFQTTWSLNSGIDTSEVLRDFPIEMQGDIAMHLHKEVLACPIFEEASQGCLKAVSMKIKSMFCAPGEYVIHRGEIINYVYFVCNGSLEILDRNGMVVAILGRGPHFIITLNYRFIIGIYLFGSDLGYSEAVIKSSCDVKSLTYCDLECILLIGLKEVLTLYPEFEDKFVNDIQHDLTYNLREG 732          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. TrEMBL
Match: A0A2S1WM35 (Putative potassium voltage-gated channel KCNH 5 OS=Hirudo verbana OX=311461 PE=2 SV=1)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 393/731 (53.76%), Postives = 513/731 (70.18%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGC--------KSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSK--LNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAA-VQVDHAN--KNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK-SIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAV 2312
            MP RKGLLAPQN FLDTIATRFDGTHSNFVLGN++   YPIVYCSDGF  LT ++RA VMS+   C+FL GPET E+E  K+  +F  K E ++E++ Y++   KF CLLDVVPIKNEKG+VVLFLVSHKD++       N   + C        +    D       +S ++   +       E ++  +KYQRRRSRAVLY L G ++ +   KSK  L++ +  +G   +PEYKV EMK++ FI  HYG  KI WDW +L  TFYIA +VPY+AA V     N  + S+V D+IVEILF++D+V NFRTTYVN SGQ++Y+ R IA NY KGWF +DL+AAIPFD+L   F  +   T   IHL+K+ R+LRLARL+QK+DRY Q+S V+L LL+ MF + AHWLACIWY+IG +EL  ++   ++GW+ +L++KL +P S N T  P+ S  +I+ALYFT +SLTSVGFGNVS NT +EK+FSI  ML+GALMHA +FGNVTA+IQRMY+RR  YQSK RDLK+F RTH +P  LKQRM E+FQTTW+LN GID  +V+KDF   ++GDIA+HL+REVL L +FE A+QGCLK +A  IK  FC PGE+++H GD++  IYFVC+GSLEIL+++ VVA+LGK D FGT V +  S  ++RS CDVK+LTYCDL CI L G+ N+  +YP     F   L  DL++ ++EG     D D++    I +
Sbjct:    1 MPARKGLLAPQNNFLDTIATRFDGTHSNFVLGNSQVLSYPIVYCSDGFCELTGFARAQVMSKSCLCKFLFGPETREDEIKKLETSFENKSELQSELLLYRKNATKFWCLLDVVPIKNEKGEVVLFLVSHKDISSTLTNGTNKHLSSCFAKDSDKSEDDEDDDESESLKKSRDDRRKQTAAYLGDENVE--AKYQRRRSRAVLYQLSGTFSRQTSTKSKIQLSKIKTLSGTNEVPEYKVQEMKRSRFILLHYGIFKIAWDWLVLICTFYIAFVVPYNAAFVASSEGNIERLSIVTDVIVEILFLIDIVLNFRTTYVNKSGQVIYKPRLIATNYFKGWFGLDLLAAIPFDLL-WTFQVE---TGALIHLLKVARLLRLARLLQKLDRYSQHSVVILTLLMAMFTVLAHWLACIWYFIGKKELDRHSANWTVGWLHQLADKLGEPIS-NKTNLPQASTSYISALYFTLTSLTSVGFGNVSPNTSAEKIFSIVAMLIGALMHALVFGNVTAIIQRMYARRAIYQSKTRDLKDFFRTHHVPASLKQRMQEYFQTTWSLNSGIDRQEVMKDFPIEMQGDIAMHLHREVLSLPIFENASQGCLKTIALMIKPMFCAPGEFIIHKGDVMSCIYFVCNGSLEILKDSMVVAILGKGDLFGTDVGY--SDPIVRSNCDVKSLTYCDLLCIPLDGLHNLLGMYPEIAEKFESDLVHDLTYILREGYVEAEDDDATILPSITI 722          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Cavefish
Match: kcnh4b (potassium voltage-gated channel, subfamily H (eag-related), member 4b [Source:ZFIN;Acc:ZDB-GENE-121214-54])

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 375/734 (51.09%), Postives = 504/734 (68.66%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEA-KEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAV----QVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL---NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKS--IGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYV---DHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA---NHKFDCDSSANSGIAVL 2315
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+LGNA+  + YPIVYCSDGF  LT + R  VM +   CRFL GP T+E     +  A   K+E++ E+ FYK+ G  F CLLD+VPIKNEKG++VLFL S KD+T    K ++S             D +  QS  + +    E              RRR R VL H+  Q++  R  K+ +N   N     SLPEYKV  ++K+ FI  HY   K +WDW +L ATFY+A+ VPY+       ++D   ++++V DI VE+LFILD++ NFRTTYV+ SGQ+VY+ R I I+Y   WF VDL+AA+PFD+L   NI       T    +HL+K  R+LRL RL+QK+DRY QYSA+VL LL+ MF L AHW+ACIWY IG +E+  + T S  IGW+ EL  +L+ PY  +  GGP + + +I +LYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+P++LKQRMLE+FQTTW++N GID N++L DF D LR DIA+HLN+++L L VFE A++GCL++L+  IKT+FC PGEYL+  GD LH  YFVCSGSLE+L+++ V+A+LGK D  G+ +   DH     VI++  DVKALTYCDLQ I + G++ +  LYP + +VF+  ++ +L++N++EG+   N++ DC +S +S +  +
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLGNAQGHRGYPIVYCSDGFCELTGFVRTEVMQKNCSCRFLYGPGTSEHVAQGMEKALEGKEEYQAEVQFYKKNGTSFWCLLDIVPIKNEKGEMVLFLFSFKDITDTHGKGHHSSRR----------DEEKRQSRKSGSSRLSEA-------------RRRGRTVLCHITSQFS--RGGKNDVNLSGNMFEKPSLPEYKVAAVQKSRFILLHYSISKALWDWMILLATFYVAVTVPYNVCFTPYNELDTTARSTIVSDIAVEMLFILDIILNFRTTYVSQSGQVVYDSRSICIHYAATWFFVDLVAALPFDLLYAFNI-------TVTSLVHLLKTVRLLRLLRLLQKLDRYSQYSAMVLTLLMSMFALLAHWMACIWYVIGRKEMERHQTTSWDIGWLHELGRRLETPYHNSTVGGPSVRSAYIASLYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRMKDLKDFIRVHRLPQQLKQRMLEYFQTTWSVNNGIDANELLHDFPDELRADIAMHLNKDILQLPVFEGASRGCLRSLSLHIKTSFCAPGEYLIRQGDALHANYFVCSGSLEVLKDSMVLAILGKGDLIGSDLPGQDH-----VIKTNADVKALTYCDLQYISVKGLREVLELYPEYASVFTADIHHNLTYNLREGSEAENNRVDCSASTDSKLPSI 697          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Cavefish
Match: kcnh4b (potassium voltage-gated channel, subfamily H (eag-related), member 4b [Source:ZFIN;Acc:ZDB-GENE-121214-54])

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 375/747 (50.20%), Postives = 504/747 (67.47%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEA-KEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAV----QVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL---NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKS--IGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYV---DHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA----------------NHKFDCDSSANSGIAVL 2315
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+LGNA+  + YPIVYCSDGF  LT + R  VM +   CRFL GP T+E     +  A   K+E++ E+ FYK+ G  F CLLD+VPIKNEKG++VLFL S KD+T    K ++S             D +  QS  + +    E              RRR R VL H+  Q++  R  K+ +N   N     SLPEYKV  ++K+ FI  HY   K +WDW +L ATFY+A+ VPY+       ++D   ++++V DI VE+LFILD++ NFRTTYV+ SGQ+VY+ R I I+Y   WF VDL+AA+PFD+L   NI       T    +HL+K  R+LRL RL+QK+DRY QYSA+VL LL+ MF L AHW+ACIWY IG +E+  + T S  IGW+ EL  +L+ PY  +  GGP + + +I +LYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+P++LKQRMLE+FQTTW++N GID N++L DF D LR DIA+HLN+++L L VFE A++GCL++L+  IKT+FC PGEYL+  GD LH  YFVCSGSLE+L+++ V+A+LGK D  G+ +   DH     VI++  DVKALTYCDLQ I + G++ +  LYP + +VF+  ++ +L++N++EG+                N++ DC +S +S +  +
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLGNAQGHRGYPIVYCSDGFCELTGFVRTEVMQKNCSCRFLYGPGTSEHVAQGMEKALEGKEEYQAEVQFYKKNGTSFWCLLDIVPIKNEKGEMVLFLFSFKDITDTHGKGHHSSRR----------DEEKRQSRKSGSSRLSEA-------------RRRGRTVLCHITSQFS--RGGKNDVNLSGNMFEKPSLPEYKVAAVQKSRFILLHYSISKALWDWMILLATFYVAVTVPYNVCFTPYNELDTTARSTIVSDIAVEMLFILDIILNFRTTYVSQSGQVVYDSRSICIHYAATWFFVDLVAALPFDLLYAFNI-------TVTSLVHLLKTVRLLRLLRLLQKLDRYSQYSAMVLTLLMSMFALLAHWMACIWYVIGRKEMERHQTTSWDIGWLHELGRRLETPYHNSTVGGPSVRSAYIASLYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRMKDLKDFIRVHRLPQQLKQRMLEYFQTTWSVNNGIDANELLHDFPDELRADIAMHLNKDILQLPVFEGASRGCLRSLSLHIKTSFCAPGEYLIRQGDALHANYFVCSGSLEVLKDSMVLAILGKGDLIGSDLPGQDH-----VIKTNADVKALTYCDLQYISVKGLREVLELYPEYASVFTADIHHNLTYNLREGSEAEGLTRFSRSPRFPHNNRVDCSASTDSKLPSI 710          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Cavefish
Match: kcnh3 (potassium voltage-gated channel subfamily H member 3-like [Source:NCBI gene;Acc:103035070])

HSP 1 Score: 704.516 bits (1817), Expect = 0.000e+0
Identity = 383/777 (49.29%), Postives = 498/777 (64.09%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKE-YPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMG---DNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQV-----DHANKNSV--VLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL-----NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKS--IGWMFE-----------------LSEKLQKPY--------------------------SANWT--------------------GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFN 2249
            MP  +GLLAPQNTFLDTIATRFDGTHSNFVLGNA+ +  YPIVYCSDGF  LT Y+RA +M +   C FL GPET++   ++I +A   ++EFKTE++FYK+ G +F CLLD+VPIKNEKG+VVLFLVSHKD+T  D KK+   E  C  +  + G      T     N N                   RRRSRAVLY L G    + K+K K+N    F     +PEYKV  ++K+ FI  HYG  K  WDW +L ATFY+A+ VPY+    V     D +   S   V DI+VEILFILD++ NFRTT+V+ SGQ+VY+ R I ++Y+  W  VDLIAA+PFD+L     ++ FG         +HL+K  R+LRL RL+QK++RY QYSAVVL LL+ MF L AHW+AC+WY+IG RE+ NN+  S  IGW+ E                 L + LQ  +                          S+ W                     GGP + + ++T+LYF  SSLTSVGFGNVSANTDSEK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+PK L+QRMLE FQTTW++N GIDV+++LKDF D LR DIA+HLN+E+L L +FE A++GCL++L+  IKT+FC PGE+L+  GD L  IYFVCSGS+E+L++N V+A+LGK D  G+  D L    VI++  +VKALTYCDLQ I L G++ +  LYP +   F   +  DL++N
Sbjct:    1 MPVMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVQSLYPIVYCSDGFCELTGYARAELMQKSCACHFLYGPETSDRLTTQIQSALDERREFKTELVFYKKGGTQFWCLLDIVPIKNEKGEVVLFLVSHKDIT--DNKKDQD-EQQCPETDEETGLEVHKVTRPQGFNAN-------------------RRRSRAVLYQLSGHLQKQDKSKLKINN-NMFGEKPPIPEYKVAAIQKSRFILLHYGTFKAGWDWLILLATFYVAVTVPYNVCFTVVGGRDDGSTPRSPPSVSDILVEILFILDILLNFRTTFVSTSGQVVYDARSICVHYVTTWLFVDLIAALPFDLLYAFNVSVYFG---------VHLLKTVRLLRLLRLLQKLERYSQYSAVVLTLLMSMFALLAHWMACVWYFIGRREIENNSPGSWDIGWLHELAKRLGTPYFLSPLTALLPDSLQASFLDGLSVNSTQWNSSSAEAAVQETAVNSSQWNATGVGPAGGVSTGQAGSVLGGGPSVRSSYVTSLYFALSSLTSVGFGNVSANTDSEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRTKDLKDFIRVHRLPKALEQRMLECFQTTWSVNNGIDVSELLKDFPDELRADIAMHLNKELLQLPLFESASRGCLRSLSLIIKTSFCAPGEFLIRQGDALQAIYFVCSGSMEVLKDNTVLAILGKGDLIGS--DSLTREQVIKTNANVKALTYCDLQYISLKGLREVLRLYPEYAQKFVSEIQHDLTYN 743          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Cavefish
Match: kcnh4a (potassium voltage-gated channel subfamily H member 4 [Source:NCBI gene;Acc:103032693])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 359/714 (50.28%), Postives = 488/714 (68.35%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPY-----------HAAVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNN--TKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP  KGLLAPQNTFLDTIA RFDGTHSNF+LGNA+ ++ YPIVYCSDGF  LT ++R  VM +   C FL GPET+E    ++      ++E++ E+ +YK+ G  F CLLD+VPIKNEKG+VVLFL S KD+T    K ++       S   D   N+ S  ++ +                    R R R+VLYHL  Q+  + K K   N F       +LPEYKV  ++K+ FI  HY   K +WDW +L ATFY+A+ VPY           H   + D  +++++V DI VE+LFILD++ NFRTTYV  +GQ+VY+ R I ++Y   WFI+DLIAA+PFD+L       + +    +HL+K  R+LRL RL+QK+DRY QYSAVVL LL+ +F L AHWLAC+WY IG +EL +N+  T  IGW+ EL ++L+ PY+   TGGP + + +I +LYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+P++LKQRMLE+FQTTW++N GI+ N++L DF D LR DIA+HLN+++L L +F  A++GCL++L+  IKT+FC PGEYL+  GD LH  +FVCSGSLE+L++  V+A+LGK D  G   D      VI++  DVKALTYCDLQ I +  ++ +  LYP + + F++ L+ +L++N++EG
Sbjct:    1 MPVMKGLLAPQNTFLDTIAKRFDGTHSNFLLGNAQGSRGYPIVYCSDGFCELTSFARTEVMKKTCTCHFLHGPETSERVTQQVQKTLEGQREYQAEVRYYKKNGTPFWCLLDIVPIKNEKGEVVLFLFSFKDITDSYGKTHHF------SKSHDGTQNRKSSRSHLSRA------------------RERGRSVLYHLTSQFTNRSKGKLANNVFSK----PTLPEYKVASVQKSRFILLHYSVCKALWDWLILLATFYVAVTVPYNVCFSSPDDSNHDEPECDSTSRSTIVSDIAVEMLFILDIILNFRTTYVGPAGQVVYDARSICLHYSATWFILDLIAALPFDLLYAF----NVSVTSLVHLLKTVRLLRLLRLLQKLDRYSQYSAVVLTLLMSVFALLAHWLACVWYVIGRKELASNDPLTWDIGWLQELGKRLETPYTNGTTGGPSMRSAYIASLYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRMKDLKDFIRVHRLPRQLKQRMLEYFQTTWSVNNGINANELLHDFPDELRADIAMHLNKDILQLPLFSSASRGCLRSLSLHIKTSFCAPGEYLIRHGDALHAHHFVCSGSLEVLKDGMVLAILGKGDLIG--ADLAGWDQVIKANADVKALTYCDLQYISIRALREVLELYPEYGSRFTEDLHHNLTYNLREG 680          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Cavefish
Match: kcnh5a (potassium voltage-gated channel subfamily H member 5 [Source:NCBI gene;Acc:103032183])

HSP 1 Score: 486.493 bits (1251), Expect = 4.294e-154
Identity = 252/698 (36.10%), Postives = 399/698 (57.16%), Query Frame = 3
Query:  171 RKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNK-SKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHN---NNTKSIGWMFELSEKLQKPY------SANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGL-KVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRC-DVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFL 2228
            ++GL+APQNTFL+ I  R   + ++F+LGNA+  E+PIVY +DGF  L+ Y RA VM + S C F+ G  T+ +   K+   F   +    E++ YK+        + V PI+NE  +VVLFL + KD+T              K  I D      ++    T                       SR  +  L      +  +K S+L       G++ LP+YK +  K    I  HY   K  WDW +L  TFY A+MVPY+ + +    N   +V+D +V+++F++D+V NF TT+V   G+++ + + I +NY+K WF++DL++ +P+DI+N  F N D         +K+ R+LRL R+ +K+D Y +Y A VL LL+ +FGL AHWLACIWY IG  E+ +   N  K+  W+++L+  +  PY      S  W GGP     +I++LYFT +SLT++GFGN++  TD EK+FS+ +M++G+L++A IFGNVT + Q+MY+    Y     ++++F++ +++PK L +R++++  +TWA+++GID   VL      +R DI +HLNR+V      F  A+ GCL++LA + +T  C PG+ + H G+ +  + FV SGSLE+++++EV+A+LGK D FG   D     + +   C +V+ALTYCDL  I    +  +   Y +F   FS+ L
Sbjct:    5 KRGLVAPQNTFLENIVRR--SSETSFLLGNAQIVEWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGELTDRKTIDKVRQTFDNYESNCFEVLLYKKNRTPVWLYMQVAPIRNENDKVVLFLCTFKDITV------------FKQPIEDETTKGWTKFARLTRALTT------------------SRGTVQQLAPMNKTEVSHKPSRLAEALQL-GSDILPQYKQEAPKTPPHIILHYCTFKTTWDWVILILTFYTAIMVPYNVSFKTKQNNLAWLVVDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIIN-AFENVDEGLSSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIKTDSWLYQLAVSIGTPYRYNASGSGQWEGGPSKDTLYISSLYFTMTSLTTIGFGNIAPTTDGEKIFSVAMMMVGSLLYATIFGNVTTIFQQMYTNTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWAMSKGIDTEKVLSICPKDMRADICVHLNRQVFNEHPAFRLASDGCLRSLAVEFQTTHCAPGDLIFHAGESVDTLCFVVSGSLEVIQDDEVIAILGKGDVFG---DVFWKETALAHACANVRALTYCDLHVIRRDALLKVLEFYTAFANSFSRNL 665          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005922.1 (pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-1 gene:ENSPMAG00000005344.1 transcript:ENSPMAT00000005922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 282/521 (54.13%), Postives = 377/521 (72.36%), Query Frame = 3
Query:  720 RRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHAN----KNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKS--IGWMFELSEKLQKPYSANWTGG-PEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            RRRSRAVLYHL G    + KNK K+N    F    SLPEYKV  ++K+ FI  HYG  K  WD  +L ATFY+A+ VPY+        N    +++ V+DI VEILFI+D++ NFRTTYV+ SGQ+VY+ R I ++Y+  WF +DLIAA+PFD+L     N   TT   +HL+K  R+LRL RL+Q +DRY QYS VVL LL+ MFGL AHW+ACIWY IG  E+  N+  S  IGW+ EL +KL+ P+  N TGG P   + +I +LYF  SSLTSVGFGNVSANTD+EK+FS+C ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+PK+LKQRMLE+FQTTW++N GID +++LKDF D LR DIA+H+N+E+L L +FE A++GCL++L+  IK +FC PGE+L+  GD L   YFVCSGS+E+L+++ V+A+LGK D  G+  D      V+++  DVKALTYCDLQCI L G+ ++  LYP +   F + +  +L++N++EG
Sbjct:    1 RRRSRAVLYHLSGHLQKQDKNKLKINN-NVFGEKPSLPEYKVAAIQKSRFILLHYGTFKAGWDLLILLATFYVAVTVPYNVCFSETVENISDPRSTAVVDISVEILFIIDILLNFRTTYVSKSGQVVYDGRSICVHYVTTWFFIDLIAALPFDLLYAF--NVSVTT--LVHLLKTVRLLRLLRLLQNLDRYSQYSTVVLTLLMFMFGLLAHWMACIWYKIGRAEIEINDRHSWDIGWLHELGKKLETPFHTNNTGGGPSTRSAYIASLYFALSSLTSVGFGNVSANTDAEKIFSVCAMLIGALMHAVVFGNVTAIIQRMYSRRSQYHTRTKDLKDFIRVHRLPKQLKQRMLEYFQTTWSVNNGIDTHELLKDFPDELRADIAMHMNKEILQLAIFESASRGCLRSLSLSIKPSFCAPGEFLIRQGDALQAFYFVCSGSMEVLKDDMVLAILGKGDLIGS--DLSSKDQVLKTNADVKALTYCDLQCIHLRGLYDVLDLYPEYSHQFHEDIQGELTYNLREG 514          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Sea Lamprey
Match: kcnh8 (potassium voltage-gated channel, subfamily H (eag-related), member 8 [Source:ZFIN;Acc:ZDB-GENE-060503-204])

HSP 1 Score: 461.07 bits (1185), Expect = 4.971e-152
Identity = 235/417 (56.35%), Postives = 311/417 (74.58%), Query Frame = 3
Query:  828 LPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAA-VQVDH---ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNN--TKSIGWMFELSEKLQKPYSANWTGG-PEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGK 2057
            LPEYKV   +++  I  HYG  K  WDW +L ATFY+A+ VPY+   +  D    ++++++V DI  EILFI+D+V NFRTTYV+ SGQ+VY  R I ++Y+  WF +DLIAA+PFD+L IV    +  T   +HL+K  R+LRL RL+QK+DRY QYSAVVLA+L+ MF L AHW+ACIWY IG  E+ + +  T  IGW+ EL  +L  P+  N T G P I + +IT+LYFT SS+TSVGFGNVSANTD EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ RDLKEFIR HR+P +LKQRMLE+FQTTW++N GID N++LKDF D LR D+ +HLN+E+L L +FE A++GCL++L+  +KT FC PGEYL+  GD L   YF+ SGS+E L++  V+A+LG+
Sbjct:    1 LPEYKVAAAQRSRLILLHYGTFKAGWDWLILLATFYVAVTVPYNVCFLNSDEQCTSSRSTMVSDITSEILFIIDIVLNFRTTYVSGSGQVVYNGRSICLHYVTTWFPIDLIAALPFDLLVIVRSWGERGTS-FVHLLKTVRLLRLLRLLQKLDRYSQYSAVVLAMLMCMFALLAHWMACIWYIIGFEEMKSTDLVTHQIGWLQELQRRLVAPHYPNITQGMPPIRSAYITSLYFTLSSITSVGFGNVSANTDGEKIFSICAMLIGALMHAVVFGNVTAIIQRMYSRRSLYLTRTRDLKEFIRIHRLPHQLKQRMLEYFQTTWSVNNGIDTNELLKDFPDELRADVTMHLNKEMLQLPLFESASRGCLRSLSLNVKTTFCAPGEYLIRQGDALQAFYFILSGSMEALKDGTVLAILGE 416          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 466.848 bits (1200), Expect = 8.792e-147
Identity = 252/712 (35.39%), Postives = 402/712 (56.46%), Query Frame = 3
Query:  240 SNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTP-KDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFN--GAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTK------------------------PQ-----IHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSI---GWMFELSEKLQKPYSAN---WTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGL-KVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRC-DVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQ 2255
            +NF+LGNA+  ++PIVY +DGF  L+ Y RA VM + S C F+ G  T++E   K+   F   +    EI+ YK+        + + PI+NE  +VVLFL + +D+T  K   +++S +   K +       + +++  N                        SR+VL  L    + K +N  K +R       G++ LP+YK +  K    I  HY   K  WDW +L  TFY A+MVPY+ + +    N   +V+D +V+++F++D+V NF TT+V  +G+++ + + I +NY+K WF++DL++ +P+DI+N  F N D   +                        PQ        +K+ R+LRL R+ +K+D Y +Y A VL LL+ +FGL AHWLACIWY IG  E+ +  T  I    W+++L E +  PY  N   W GGP     +I++LYFT +SLTS+GFGN++  TD EK+F++ +M++G+L++A IFGNVT + Q+MY+    Y      +++F++ +++PK L +R++++  +TW++++GID   VL      +R DI +HLNR+V      F  A+ GCL+ALA + +T  C PG+ + H G+ +  + FV SGSLE+++++EVVA+LGK D FG   D      VI   C +V+ALTYCDL  I    +  +   Y +F   FS+ L   L++N++
Sbjct:    8 TNFLLGNAQILDWPIVYSNDGFCKLSGYHRAEVMQKSSTCSFMYGDLTDKETMEKVKQTFENYESCSFEILMYKKNRTPLWFYMQIAPIRNEHEKVVLFLCTFRDITAFKQPIEDDSTKGWTKFA-------RLTRALTN------------------------SRSVLQQLTPNVH-KGENVHKHSRLAEVLQLGSDILPQYKQETPKTPPHIILHYCAFKTTWDWIILILTFYTAIMVPYNVSFKTKQNNVAWLVVDSVVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIIN-AFENVDEVVRAAQIRGPFGSRSPSRLLDAWPRVAPQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEATNLIRKHSWLYQLGETIGTPYHFNGTQWEGGPSKDAVYISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLHICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTHHCAPGDLIYHAGESVDTLCFVVSGSLEVIQDDEVVAILGKGDVFG---DVFWKERVIAPSCANVRALTYCDLHVIRRDALVKVLDFYMAFANSFSRNLI--LTYNVR 681          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005594.1 (pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1 gene:ENSPMAG00000005049.1 transcript:ENSPMAT00000005594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 447.203 bits (1149), Expect = 1.782e-143
Identity = 228/497 (45.88%), Postives = 325/497 (65.39%), Query Frame = 3
Query:  816 GAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAV-----QVDHANK------NSV-VLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIG--LRELHNNNTKSIGWMFELSEKLQKPYS-ANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVL-GLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQE 2258
            GA+ LPEYK+   +   +   HY P K +WDW +L    Y A+  PY AA      QV++  +      N + ++D++V+I+F++D+  NFRTTY+N + ++V    +IAI+Y KGWF++D++AAIPFD+L    G+    T   I L+K  R+LRL R+ +K+DRY +Y A VL LL+  F L AHWLACIWY IG   R + +     IGW+ +L  ++ KPY+  + + GP I + ++TALYFT SSLTSVGFGNVS NT+ EK+FSICVML+G+LM+A+IFGNV+A+IQR+YS    Y ++   +KEFIR H+IP  L+QR+ E+FQ  W+   GID+N VLK F + L+ DI +HLNR +L   K F  A++GCL+ALA K KT    PG+ LVH+GD++  +YF+  GS+EIL  + VVA+LGKND FG  V+        +S  DV+ALTYCDL  I    +  +  +YP F   F   L  +++FN+++
Sbjct:   72 GADVLPEYKLQAPRIHKWTILHYSPFKAVWDWLILLLVIYTAIFTPYTAAFLLSDQQVENERQKCGYSCNPLNIVDLMVDIMFMVDIFINFRTTYINKNEEVVSHPGKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSGSGETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLVLLMCTFALIAHWLACIWYAIGNMERPVDSLAKDRIGWLDQLGGQIGKPYNDTDTSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNYEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNMVLKGFPECLQADICLHLNRTLLESCKAFNGASKGCLRALAMKFKTTHAPPGDTLVHSGDVITAMYFLSRGSIEILREDIVVAILGKNDIFGEPVNQYSRPG--KSSADVRALTYCDLHKIVREDMLEVLDMYPEFSEHFWPSL--EITFNLRD 564          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Sea Lamprey
Match: kcnh8 (potassium voltage-gated channel, subfamily H (eag-related), member 8 [Source:ZFIN;Acc:ZDB-GENE-060503-204])

HSP 1 Score: 414.461 bits (1064), Expect = 7.586e-134
Identity = 235/455 (51.65%), Postives = 306/455 (67.25%), Query Frame = 3
Query:  468 GEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAE--SLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAA-VQVDH---ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNN--TKSIGWMFELSEKLQKPYSANWTGG-PEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDV 1805
            G  F CLLD+VPI+NEK +VVLFL S KD++  D K+  + ++G K +         + S  NT+                   RRRSRAVLYHL G    +R++ SKL    N  G E  +LPEYKV   +++  I  HYG  K  WDW +L ATFY+A+ VPY+   +  D    ++++++V DI  EILFI+D+V NFRTTYV+ SGQ+VY  R I ++Y+  WF +DLIAA+PFD+L              +HL+K  R+LRL RL+QK+DRY QYSAVVLA+L+ MF L AHW+ACIWY IG  E+ + +  T  IGW+ EL  +L  P+  N T G P I + +IT+LYFT SS+TSVGFGNVSANTD EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ RDLKEFIR HR+P +LKQRMLE+FQTTW++N GID N+V
Sbjct:    1 GSPFWCLLDIVPIRNEKREVVLFLASFKDIS--DTKRGPT-QDGVKEAEERPRQKGQTGSGFNTS-------------------RRRSRAVLYHLSGHL--QRQDNSKLKLKNNVFGPEKAALPEYKVAAAQRSRLILLHYGTFKAGWDWLILLATFYVAVTVPYNVCFLNSDEQCTSSRSTMVSDITSEILFIIDIVLNFRTTYVSGSGQVVYNGRSICLHYVTTWFPIDLIAALPFDLLCAF----KIAVTSFVHLLKTVRLLRLLRLLQKLDRYSQYSAVVLAMLMCMFALLAHWMACIWYIIGFEEMKSTDLVTHQIGWLQELQRRLVAPHYPNITQGMPPIRSAYITSLYFTLSSITSVGFGNVSANTDGEKIFSICAMLIGALMHAVVFGNVTAIIQRMYSRRSLYLTRTRDLKEFIRIHRLPHQLKQRMLEYFQTTWSVNNGIDTNEV 427          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Nematostella
Match: EDO45888 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU8])

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 309/699 (44.21%), Postives = 450/699 (64.38%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKE-YPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSA-NWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNI 2252
            MP R+G  APQNTFL+TIA +FD  +SNFVLG+A+ K  YPIVYCSDGF  LT ++R  +M R   C FL G ETN+E+   I NA   +KE K E+IFY++ G  F CLLD+VPIKNEKG VVLFLVSHKD+T    K+  S E     +  D  +N + ++                 + T    R+ SR VL HL  QY  +  + +K    +    +  LP YK +  KK+  +F HY  +K +WDW +L  TFYIA+MVPY+ A       ++ +++D+++E+ FILD+V +FRTT+VN +G+IVYEQ+ IAI+Y+KGWFI+D +AA+PF+ L  +    + +    + L+K  R+LRL R+++K+ RY +YS V+L LL+  F + AHWLACIWY IGL E+ +N+T  I W+++  E +Q P+ A +   GP+  + ++TALYF  +S+T+VGFGNVSANT +EK F++ VML+GALMHAAIFGNV A+IQ++Y+ R  Y S+  ++K+FIR H I   L  R+ + F TTW+L+ G+D  ++L  F   L+ D+ +HL R +L L VF +A +G  + ++ K+   +  PGEYL+   D+++ IY++ SGS+E+L+   V A+LGK D FG   D  +   + RS  DV+ALTYCD+  I    +Q +  LYP F   FS+ L  +L++++
Sbjct:    1 MPMRRGRFAPQNTFLETIAQKFDHGNSNFVLGSAQEKNNYPIVYCSDGFCELTGFTRTELMRRTCACNFLYGLETNQEDVRNIQNALKTQKELKKEVIFYRKNGSHFFCLLDIVPIKNEKGTVVLFLVSHKDVT----KRKQSGE-----ATHDRDENASGRTGPGER------------KLTRSRSRKFSRDVLLHLSRQYQ-QSNSATKPQSRRPTKRSRRLPLYKRETTKKSKLLFLHYSNVKSLWDWWVLILTFYIAIMVPYNVAFSRHGKARDLIIVDMVIELFFILDIVVHFRTTFVNKAGRIVYEQKAIAIHYLKGWFILDFLAALPFEALYFI----NKSWGFLVQLLKCGRLLRLFRVVRKLHRYTEYSTVLLTLLMLAFAMVAHWLACIWYVIGLEEVSHNST--ISWLYQFGETIQMPFIAFSPDTGPDEGSAYVTALYFILTSMTTVGFGNVSANTRAEKAFAVVVMLIGALMHAAIFGNVAAIIQKLYANRVRYHSRSNEIKQFIRVHHIEADLANRLEDCFHTTWSLSGGVDTREILTTFPYELQADVCMHLYRGLLDLPVFSQAPRGLFRMVSLKVSPVYIGPGEYLLTQNDVINSIYYIASGSMEVLQGESVAAILGKGDLFGE--DISRKSPIRRSNGDVRALTYCDVYYITRDKLQEVMHLYPDFSYKFSEKL--ELTYDL 667          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Nematostella
Match: EDO30140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1M9])

HSP 1 Score: 497.278 bits (1279), Expect = 1.893e-160
Identity = 278/748 (37.17%), Postives = 418/748 (55.88%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHS-NFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQV------DHANKNS------------------VVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWT-GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGL-KVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALL-------------------GKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGAN 2267
            MP ++GL+APQNTF+ TI  +FDG+   NFVLGNA+A   PI+YC++GF  LT YSRA ++ R   C FLCG  TNE  K  + NA     E   EI++Y++ G  FLC + V P+K+E G+V +++V+H+D+T    + +             +  +  ++   N N          E +  +K  RR             N +RK  + +       GA+ LPEYK+       +   HY   K  WDW +LF   Y A++ PY A+  +      D  NK+                   V+LD +V+++FI+D+  NFRTT+V+ + ++V    RIA++Y K WF++DL+AAIPF++L I+ GN D TT   I L+K  R+LRL R+ +K+D Y +Y   VL LL+  F L AHWLACIWY IG  E    N+   GW+  L+E++ +P+       GP+I + +ITALYFT SSLTSVGFGNVS NT++EK+FSICVML+G+L +AAIFGNV A+I R+YS    Y ++ + ++EFIR H+IP  L+QR+ ++    W+   GID++                 LN  VL   + F  A+QGCL++LA K++T    PG+++++ GD + ++YF+  G++E+L+++ ++A+L                   GK D FG       +     S   ++ALTYCDL+ I    + N   +YP+F+  F++ L        +EGA 
Sbjct:    1 MPVKRGLVAPQNTFIQTIIKKFDGSPDRNFVLGNAQADGLPIIYCNEGFCELTGYSRAELVQRNCSCDFLCGQGTNEVAKQDVKNALKGTVERHIEILYYRKDGSPFLCSVLVAPVKDEAGRVSMYIVNHEDVTWSPNRDDV------------INHSSVTRVVCNINFYSAFVARKIEYRGLAKRNRR-------------NEQRKKSALVMSL----GADVLPEYKLQAPNIHPWTILHYSVFKAFWDWLILFLVIYTAIVTPYMASFILTRDKMRDELNKDPETRRDYGSGAREVYSDPLVILDYLVDVMFIVDIFINFRTTFVDSNDEVVSHPCRIAVHYFKTWFVIDLMAAIPFELL-IMVGNTDETTT-LIGLLKTARLLRLVRVARKLDHYSEYGMAVLCLLMCSFALLAHWLACIWYAIGNLERQRTNSTH-GWLDVLAEQIHRPFDEKEVDSGPDIESKYITALYFTLSSLTSVGFGNVSPNTNAEKIFSICVMLIGSLFYAAIFGNVAAIIARLYSNTARYHAQMQRVREFIRFHQIPNPLRQRIEDYSHHIWSYTNGIDMDQ---------------DLNANVLTTYRAFTSASQGCLRSLALKLRTTHLPPGDFIIYQGDEISHLYFLVRGTVEVLKDDTIMAILGEQEDEIMMLCLQFSIYLQGKGDSFGENFGLSPNRPPGNSHVSIRALTYCDLRAISRDDLVNTMRMYPNFQQTFNQDLEITYLLREREGAG 701          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Nematostella
Match: EDO36780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHR1])

HSP 1 Score: 443.736 bits (1140), Expect = 1.322e-141
Identity = 252/714 (35.29%), Postives = 394/714 (55.18%), Query Frame = 3
Query:  162 MPQ-RKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQ-DHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLR----ELHNNNTKSIGWMFELSEKLQKPYSANWTG--------GPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKV-FEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQE 2258
            MP  R+GL+ PQNTFL+ I  R +G H NF+LGNA+    PIVY SDGF  LT +SR+ VM + S+C FL G  T+ E   +I +A   K+  + EII YK+ G     LL + PI NEKG+VVLFL++ KD+T              K  I   G  K     N +                      R + VL   + Q +  +KN  ++    + N  + +P+YK +  +    +  HY   K  WDW +L  T Y  + VP+      +    N  +LD+IV+ LFI D+V NF TTYV   G+I+ + R I +NY+K WF++DL++++P+ +L  +  ++ + T    +  +++ R+LRL R+ +KID+Y +Y A    LL+  F L AHW+AC++Y I  +    ++H        W++ L++++   Y  N           GP I+  +++ALY+T +SLT++GFGN+S NT +EKLF    ML+G+++ + IFG V+A++Q+       Y S   ++++F + +++P  L  R++++F +TWA N+GID ++VLK     L+ DI +HLNR VL   + F  A  G  +A+A+        P + ++H G+ L  +YF+  GSLE+ +   VV LLG+ D FG  V      +V +S  DV ALTYCDL CI+   +  +   YP F   F+K L   LS+N+++
Sbjct:    1 MPAGRRGLVVPQNTFLENIVRRSNGLHPNFILGNAQILGNPIVYASDGFCKLTGFSRSEVMKKSSDCTFLHGEHTSNESMKEIHDALINKQALQLEIIIYKKDGLAMWVLLHIGPIVNEKGEVVLFLMTIKDITEY------------KDPIPGTGGAKGWARLNKS--------------------LTRHKTVLVAFK-QKSASQKNAQQITHLMSLND-DIIPQYKQEIPETPPRVILHYNTFKTSWDWVILILTLYTTVSVPFMVCFAYNSEPLN--ILDMIVDWLFIADIVLNFHTTYVGKDGEIIDDPRLIRLNYLKTWFVLDLVSSLPYGVLYFIPKSEMEQTIANLLSFLRVFRLLRLGRVARKIDKYLEYGASTFFLLMLSFCLVAHWMACMFYVIATKYDKYDVH-------CWLYILADQIGMQYKKNGNSTEYDYTNTGPTIAARYVSALYYTLTSLTTIGFGNISPNTTAEKLFGCVTMLLGSILFSLIFGQVSAILQQSQKNTAKYHSIIDNMRQFSKLYKLPSVLADRIIDYFMSTWASNKGIDTDEVLKYCPKDLQADICVHLNRVVLENNLAFRDAPMGVKRAIARNFWICHVAPNDRIIHHGESLDVLYFIARGSLEVKQGEAVVGLLGEGDVFGDNV--CNEPTVGQSAVDVHALTYCDLHCIQRDALLEVLEFYPEFAMKFAKNL--QLSYNLRD 667          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Nematostella
Match: EDO47044 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RND4])

HSP 1 Score: 327.405 bits (838), Expect = 1.670e-100
Identity = 170/492 (34.55%), Postives = 288/492 (58.54%), Query Frame = 3
Query:  870 IFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH---------------ANKNSVVLDIIVEILFILDVVFNFRTTYV-NCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIH------------LMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLG-LKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQE 2258
            I +H    K +WDW +L    Y A  +P+ A   +                 +     + ++ V++LF++D+  NFR+TYV   + +++   ++IA+NY K WF++DL++AIPF+ +  V   +D  +   +             L+K  R+LRL R+++K DRY +Y   V+ LL   F L AHWLACIW+ IG  +L ++N+    W+ +LS   Q   S N T  P +   +ITALYFT +SL+SVGFGNVS NT++EK+FSI VM++GALM+A+IFGN+TA+IQR+YSR + ++   R +++F+R ++IP+ L+  + E+F+  W+  +G+D++ VLK F + L+ DI +HL++++      F+ A++GCL+ALA++       PG+YL+  GD +  +YF+  G +E+L++     +LGK D         QS    ++   +   TYC +  ++   + ++  +Y  F+  F+  L   L++N+ +
Sbjct:    1 IIRHDSIFKAVWDWVILVFVIYTAFEIPFSATFLLPQELSRMKSSSRFAALVSGSPLAICNLCVDLLFVVDIPINFRSTYVREGTDELIVNPKKIALNYFKSWFLIDLLSAIPFEFM--VDHRKDGVSNQGVSMPLTGLATTLMGLLKTARLLRLVRIVRKFDRYSEYGQAVIILLTCFFLLVAHWLACIWHAIGQAQLGDHNS----WIEKLSRHSQHVSSGNVTHTPGLQTRYITALYFTMTSLSSVGFGNVSPNTNAEKVFSILVMIVGALMYASIFGNMTAIIQRLYSRTSRHRRNLRIIQDFVRFYKIPRNLRDDLEEYFRHEWSYTKGMDIDTVLKRFPESLQADICVHLHKKLFAECSAFQCASEGCLRALARRFDIRRHLPGQYLIKQGDEVKKLYFIAKGFVEVLKDGHCELVLGKGDVISCDYTSRQSLRTAKANASLLIQTYCQIHVVDWQDLLSVLRVYSKFRESFTNHL--KLAYNLDD 484          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Nematostella
Match: EDO47123 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RND7])

HSP 1 Score: 324.709 bits (831), Expect = 1.798e-100
Identity = 160/408 (39.22%), Postives = 258/408 (63.24%), Query Frame = 3
Query:  867 FIFQHYGPIKIIWDWALLFATFYIALMVPYHAA--------VQVDHANKNSVVLDIIVEILFILDVVFNFRTTYV-NCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPY--SANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGL-KVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLG 2054
            +I  H    K +WDW +L    Y ++ +PY AA        +Q   A     ++++IV+++F++D++ NFR+TY    + ++V   R+IA NY+K WF++D +AAIPF++  +  G +   +     L+K  R+LRL R+ +K+DRY +Y   V+ LL  +F L AHWLACIWY+IG  E+ N +    GW+  L E+  +P   SA    GP + + ++T+LYFT +SLTS+GFGNV+ NT++EKLF++ +ML+GALM+AAIFGN+TA+IQR+Y+R   Y    + +KEFIR H IP  L+  + E+F   W+      ++ VL+ F D L+ D+ +H++R V G   VF K  +GC++AL+ K       PG Y++  GD + Y+YFV  G+++++++ + +++LG
Sbjct:    5 YIILHNSKFKAVWDWFVLLLVIYTSIEIPYTAAFGQSQKSPLQQLKAGSAIGIVNLIVDLMFVVDILINFRSTYTRQGTDELVSNPRKIACNYLKSWFVIDFLAAIPFELF-VEAGGKGAISLAG--LLKTARLLRLVRVSRKLDRYSEYGLAVVILLTCLFTLVAHWLACIWYFIGRGEIRNKH----GWITLLGEQTGQPVNTSAPENSGPSMKSRYVTSLYFTLTSLTSIGFGNVAPNTNAEKLFAVAMMLVGALMYAAIFGNMTAIIQRLYTRTARYHKDLKVIKEFIRFHNIPDTLRDTLTEYFTHEWSSRHDQQLDTVLRRFPDSLQSDVCVHIHRAVFGSHHVFHKLGEGCVRALSVKFNIKNYLPGHYIIKEGDEVKYLYFVVEGTVDVIKSGKSLSILG 405          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Medaka
Match: kcnh8 (potassium voltage-gated channel subfamily H member 8 [Source:NCBI gene;Acc:101170602])

HSP 1 Score: 723.391 bits (1866), Expect = 0.000e+0
Identity = 370/711 (52.04%), Postives = 484/711 (68.07%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAE-AKEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQ--RRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAV--QVDHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTK-SIGWMFELSEKLQKPYSA-----NWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG 2261
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+L NA+ +K +PIVYCSDGF  LT +SRA VM +   C+FL GPET+E     I  A   +KEFK EI+FY +T   F CLLD+VPIKNEKG VVLFL S KD+T    K                            + +  E+     ++T S +   R RS  VLYH+ G  + + K+K KLN+   F    +LPEYKV + KK+ FI  HY   K  WDW +L ATFY+A+ VPY+       D   +++ V DI VEILFI+D++FNFRTTYV+ SGQ++++ R+I I+Y+  WFI+DL+AA+PFD+L  V  +         HL+K  R+LRL RL+QK+DRY Q+S VVL LL+ MF L AHW+ACIWY IG  E+  N+    IGW+ EL ++L+ PY A       T GP I + +I +LYFT SSLTSVGFGNVSANTD+EK+FSICVML+GALMHA +FGNVTA+IQRMYSR + Y ++ +DLK+FIR H +P+ LKQRMLE+FQTTW++N GID N++LKDF D LR DI +HLN+E+L L +F  A++GCL++L+  IKT+FC PGEYL+  GD L  I+FVCSGS+E+L+++ V+A+LGK D  G  +       VI++  DVKALTYCDLQCI L G+  +  LYP +   F + + QDL++N++EG
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVSKGFPIVYCSDGFCELTGFSRAEVMQKSCACKFLYGPETSESIILSIDEALEERKEFKDEIMFYSKTAVLFWCLLDIVPIKNEKGDVVLFLASFKDITDTKAKA--------------------------IHEDRREERRRGRVKTGSPFSTARLRSGTVLYHISGHLHSREKSKIKLNK-NVFGDPPALPEYKVADAKKSKFILLHYSTFKAGWDWLILLATFYVAVTVPYNVCFIGDDDDLTRSTTVSDIAVEILFIIDIIFNFRTTYVSKSGQVIFDARQICIHYLTTWFIIDLVAALPFDLLYAVRVSVVSVV----HLLKTVRLLRLLRLLQKMDRYSQHSTVVLTLLMSMFALLAHWMACIWYIIGKMEIEANSYNWDIGWLHELGKRLESPYHAMAEVNGTTSGPSIRSVYIASLYFTLSSLTSVGFGNVSANTDAEKIFSICVMLIGALMHALVFGNVTAIIQRMYSRWSQYHTRTKDLKDFIRIHHLPQSLKQRMLEYFQTTWSVNNGIDCNELLKDFPDELRSDITMHLNKEILELSLFASASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIFFVCSGSMEVLKDDMVLAILGKGDLIGANLS--LDNRVIKTNADVKALTYCDLQCINLKGLYEVLDLYPEYSHHFVQDIQQDLTYNLREG 678          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Medaka
Match: ENSORLT00000038506.1 (potassium voltage-gated channel subfamily H member 4 [Source:NCBI gene;Acc:101174955])

HSP 1 Score: 712.22 bits (1837), Expect = 0.000e+0
Identity = 359/709 (50.63%), Postives = 498/709 (70.24%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEA-KEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH----ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL---NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA 2264
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+LGNA+  + YPIVYCSDGF  LT ++R  VM +   C FL G +T+E    ++  A   ++E+KTE+ FYK+ G  F CLLD+VPIKNEKG++VLFL S KD+T    K       G +++ S+  +++  +  ++++  +                R+R R +LY L   ++  R  K  +N   N     S+PEYKV  ++K+ FI  HY   K +WDW +L ATFY+A+ VPY+ +         A ++++V DI VE+LFI+D++ NFRTTYV+ SGQ+VY+ R I I+Y+  WF VDL+AA+PFD+L   NI       T    +HL+K  R+LRL RL+QK+DRY QYSA+VL LL+ +F L AHW+AC+WY IG +E+H N T  IGW+ EL ++L+ PY  +  GGP + + +I ALYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+P++LKQRMLE+FQTTW++N GID N++L +F D LR DIA+HLN+++L L VF+ A++GCL++L+  IKT+FC PGEYL+  GD LH  YFVCSGSLE+L+++ V+A+LGK D  G+  D   S  VI++  DVKALTYCDLQ I + G++ +  LYP + ++F+  ++ +L++N++EG+
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLGNAQGHRGYPIVYCSDGFCDLTGFTRTEVMQKNCTCHFLYGADTSEHVAQQMEKALEGREEYKTEVHFYKKDGVPFWCLLDIVPIKNEKGEMVLFLFSFKDITETYGK-------GHQTNKSEAAEDRRQRRRSHSHFSKA---------------RKRGRTMLYQLTSHFS--RGGKGDVNLGGNMVDKPSIPEYKVAAVQKSRFILLHYSVSKALWDWLILLATFYVAVTVPYNVSFTPHDDSVTAARSTIVSDIAVEMLFIIDIILNFRTTYVSQSGQVVYKGRSICIHYVTTWFFVDLVAALPFDLLYAFNI-------TVTSLVHLLKTVRLLRLLRLLQKLDRYSQYSAMVLTLLMSVFALLAHWMACVWYMIGRKEIHTNETWEIGWLHELGKRLETPYINSTAGGPTVRSSYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRMKDLKDFIRVHRLPQQLKQRMLEYFQTTWSVNNGIDANELLHNFPDELRADIAMHLNKDILQLPVFKGASRGCLRSLSLHIKTSFCVPGEYLIRQGDALHANYFVCSGSLEVLKDDMVLAILGKGDLIGS--DLPGSEQVIKTNADVKALTYCDLQYISVRGLREVLELYPEYASLFASDIHNNLTYNLREGS 676          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Medaka
Match: ENSORLT00000035685.1 (potassium voltage-gated channel subfamily H member 8 [Source:NCBI gene;Acc:101162654])

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 377/775 (48.65%), Postives = 498/775 (64.26%), Query Frame = 3
Query:  174 KGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKE-YPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYH---AAVQV-----DHANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL-----NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKS--IGWMFELSEKLQKPY-------------------------------SANWT-----------------GGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGI 2306
            +GLLAPQNTFLDTIATRFDGTHSNFVLGNA+ +  +PIVYCSDGF  LT ++R  +M +   C FL G ET+E   S++  A   ++EFKTEII YK+ G KF CLLD+VPIKNEK +VVLFLVSHKD+T                      +NK     ++T+ E           +    +RRRSRAVLY L G    + K KSKL       GA  +PEYKV +++K+ FI  HYG  K  WDW +L ATFY+A+ VPY+    AV+V       A     V DI+VEILFI+D+V NFRTTYV+ SGQ+VY+ R I ++Y+  W  VDL+AA+PFD+L     ++ FG         +HL+K  R+LRL RL+QK+DRY QYSAVVL LL+  F L AHW+AC+W++IG  E+ + N  S  +GW+ EL+++L  PY                               SA W                  GGP + + ++T+LYF  SSLTSVGFGNVSANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+PK L+QR++E FQTTW++N GIDV+++LKDF D LR DIA+HLN E+L L +F+ A++GCL++L+  IK +FC PGE+L+  GD L  IYFVCSGS+E+L++N V+A+LG+ D  G+  D L    VI++   VKALTYCDLQ I L G+Q +  LYP +   F   ++ DL++N++EG  H    DS  N G+
Sbjct:    2 RGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVRSVHPIVYCSDGFCELTGFARGELMQKSCACHFLYGSETSERLTSQMQAALDERREFKTEIILYKKNGSKFWCLLDIVPIKNEKSEVVLFLVSHKDIT----------------------ENKDRAGESDTDGENSLQVHKVGRPSGRSMERRRSRAVLYQLSGHLQRQDKTKSKLKINNTVLGANPVPEYKVADVQKSRFILLHYGAFKAGWDWLILLATFYVAITVPYNVCFTAVEVREDGGSAARNPPSVSDILVEILFIIDIVLNFRTTYVSTSGQVVYDARSICVHYVTSWLFVDLMAALPFDLLYAFNISVNFG---------VHLLKTVRLLRLLRLLQKLDRYSQYSAVVLTLLMSTFALLAHWMACVWFFIGRSEIESKNPASWDVGWLHELAKRLGTPYFLAPVTSLLGVSEPPPGPGSGAPSSFSQWNSSAQWNGSRSRTKALNGSGLVLGGGPSVRSSYVTSLYFALSSLTSVGFGNVSANTDAEKIFSICTMLVGALMHAVVFGNVTAIIQRMYSRRSLYHTRTKDLKDFIRVHRLPKALEQRVMECFQTTWSVNNGIDVSELLKDFPDELRADIAMHLNEELLQLPLFQSASRGCLRSLSLIIKNSFCAPGEFLIRQGDALQAIYFVCSGSMEVLKDNTVLAILGRGDLIGS--DCLTQAEVIKTNACVKALTYCDLQYISLKGLQEVLRLYPDYAQRFLTEIHHDLTYNLREG--HSAQMDSETNGGV 741          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Medaka
Match: ENSORLT00000005614.2 (potassium voltage-gated channel subfamily H member 4 [Source:NCBI gene;Acc:101174955])

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 366/728 (50.27%), Postives = 502/728 (68.96%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEA-KEYPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAVQVDH----ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL---NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHK-FDCDSSANSGIAVLP 2318
            MP  KGLLAPQNTFLDTIATRFDGTHSNF+LGNA+  + YPIVYCSDGF  LT ++R  VM +   C FL G +T+E    ++  A   ++E+KTE+ FYK+ G  F CLLD+VPIKNEKG++VLFL S KD+T          E   K   ++  + + S S+ +                     R+R R +LY L   ++  R  K  +N   N     S+PEYKV  ++K+ FI  HY   K +WDW +L ATFY+A+ VPY+ +         A ++++V DI VE+LFI+D++ NFRTTYV+ SGQ+VY+ R I I+Y+  WF VDL+AA+PFD+L   NI       T    +HL+K  R+LRL RL+QK+DRY QYSA+VL LL+ +F L AHW+AC+WY IG +E+H N T  IGW+ EL ++L+ PY  +  GGP + + +I ALYFT SSLTSVGFGNV ANTD+EK+FSIC ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+P++LKQRMLE+FQTTW++N GID N++L +F D LR DIA+HLN+++L L VF+ A++GCL++L+  IKT+FC PGEYL+  GD LH  YFVCSGSLE+L+++ V+A+LGK D  G+  D   S  VI++  DVKALTYCDLQ I + G++ +  LYP + ++F+  ++ +L++N++EG+  + F+  SS    ++VLP
Sbjct:    1 MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLGNAQGHRGYPIVYCSDGFCDLTGFTRTEVMQKNCTCHFLYGADTSEHVAQQMEKALEGREEYKTEVHFYKKDGVPFWCLLDIVPIKNEKGEMVLFLFSFKDIT----------ETYGKGHQTNKSEGRRSHSHFSK-------------------ARKRGRTMLYQLTSHFS--RGGKGDVNLGGNMVDKPSIPEYKVAAVQKSRFILLHYSVSKALWDWLILLATFYVAVTVPYNVSFTPHDDSVTAARSTIVSDIAVEMLFIIDIILNFRTTYVSQSGQVVYKGRSICIHYVTTWFFVDLVAALPFDLLYAFNI-------TVTSLVHLLKTVRLLRLLRLLQKLDRYSQYSAMVLTLLMSVFALLAHWMACVWYMIGRKEIHTNETWEIGWLHELGKRLETPYINSTAGGPTVRSSYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRMKDLKDFIRVHRLPQQLKQRMLEYFQTTWSVNNGIDANELLHNFPDELRADIAMHLNKDILQLPVFKGASRGCLRSLSLHIKTSFCVPGEYLIRQGDALHANYFVCSGSLEVLKDDMVLAILGKGDLIGS--DLPGSEQVIKTNADVKALTYCDLQYISVRGLREVLELYPEYASLFASDIHNNLTYNLREGSQGEGFNRFSSV---VSVLP 685          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Medaka
Match: kcnh4a (potassium voltage-gated channel subfamily H member 4 [Source:NCBI gene;Acc:101171169])

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 355/729 (48.70%), Postives = 489/729 (67.08%), Query Frame = 3
Query:  162 MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKE-YPIVYCSDGFLLLTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYKRTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSSISDMGDNKTSQSNNNTNCXXXXXXXXXXIQTTSKYQRRRSRAVLYHLQGQYNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDWALLFATFYIALMVPYHAAV-----QVDH---ANKNSVVLDIIVEILFILDVVFNFRTTYVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDIL---NIVFGNQDHTTKPQIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNN--TKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGI 2306
            MP  KGLLAPQNTFLD+IA  FDGTH NF+LGNA ++  YPIVYCSDGF  LT ++R  VM +   C FL G ET++    ++  A   ++EF+ EI FY++ G +F C LDVVPIKNEK +VVLFL+S KD++          E+  +S     GD+  ++S+                 +   Y + R R +L HL   +  + K K     FQ      SLPEYKV  ++K+ FI  HY   K +WDW +L ATFY+A+ VP++          DH    +++++  DI VE+LF+LD+  NFRTTYV+ SGQ+VY+ R I I+Y   WF VDLIAA+PFD+L   NI       T    +HL+K  R+LRL RL+QK+DRY QYSAVVL LL+ +F L AHW+ACIWY IG +E+ +++  T  IGW+ EL ++L+ PY  +  GGP + + +I +LYFT SSLTSVGFGNV ANTD+EK+FS+C+ML+GALMHA +FGNVTA+IQRMYSRR+ Y ++ +DLK+FIR HR+P++LKQRMLE FQ TW++N GI+ N++L++F D LR DIA+HLN+++L L +FE+A++GCL++L+  IKT+FC PGEYL+  GD LH  YFVCSGSLE+L++  V+A+LGK D  G+  D      VI++  DVKALTYCDLQ I +  ++ +  LYP + + FS  ++ +L++N++EG        S AN G+
Sbjct:    1 MPVMKGLLAPQNTFLDSIANHFDGTHCNFLLGNALSRHGYPIVYCSDGFCELTGFARTEVMQKSCTCGFLHGAETSDSVLQQVHKALEGQQEFQGEICFYQKNGNQFWCFLDVVPIKNEKSEVVLFLLSFKDVS----------ESHGRSHCYTPGDDSANESSRGN-------------PSDFTYVQERGRTILRHLSNFFTKRGKRKLTDGMFQK----PSLPEYKVAAVEKSRFILLHYSIFKALWDWLILLATFYVAITVPFNVCFVSHYEGPDHHSLVSRSTLGSDIAVEMLFMLDIFLNFRTTYVSQSGQVVYDGRSICIHYCTTWFFVDLIAALPFDLLYAFNI-------TVTSLVHLLKTVRLLRLLRLLQKLDRYSQYSAVVLTLLMSVFALLAHWMACIWYVIGRKEIESSDPITWDIGWLQELGKRLETPYVNSTVGGPSMPSAYIASLYFTLSSLTSVGFGNVCANTDAEKIFSVCIMLIGALMHAVVFGNVTAIIQRMYSRRSLYHTRMKDLKDFIRVHRLPQQLKQRMLENFQATWSVNNGINANELLREFPDELRADIAMHLNKDILQLPMFERASRGCLRSLSLHIKTSFCAPGEYLIRQGDALHANYFVCSGSLEVLKDGMVLAILGKGDLIGS--DLPVHEQVIKTNADVKALTYCDLQYISVKALKEVLGLYPEYSSRFSFDIHFNLTYNLREG--------SEANCGV 685          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Planmine SMEST
Match: SMESG000017883.1 (SMESG000017883.1)

HSP 1 Score: 1380.16 bits (3571), Expect = 0.000e+0
Identity = 734/782 (93.86%), Postives = 735/782 (93.99%), Query Frame = 3
Query: 1224 MKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPXXXXXXXXXXXXXXXCLESPVHSEENTCLIQEATNSDHIVNSLXXXXXXXXXXXXXXXASNELSVNLNRXXXXXXXXXXXXXXXXNIMKKNHEKLDNEPLSRDILKHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIIXXXXXXXXXXXXXXXXXXFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL 3569
            MKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQR+              KEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQEATNSDHIVNSLKQQKQNQKTKIKRKQASNELSVNLNRSTSS                                 HDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL
Sbjct:    1 MKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRI-------------PKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQEATNSDHIVNSLKQQKQNQKTKIKRKQASNELSVNLNRSTSS--------------------------------PHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL 737          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Planmine SMEST
Match: SMESG000017883.1 (SMESG000017883.1)

HSP 1 Score: 1375.15 bits (3558), Expect = 0.000e+0
Identity = 728/782 (93.09%), Postives = 729/782 (93.22%), Query Frame = 3
Query: 1224 MKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPXXXXXXXXXXXXXXXCLESPVHSEENTCLIQEATNSDHIVNSLXXXXXXXXXXXXXXXASNELSVNLNRXXXXXXXXXXXXXXXXNIMKKNHEKLDNEPLSRDILKHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIIXXXXXXXXXXXXXXXXXXFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL 3569
            MKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQR+              KEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQEATNSDHIVNSLKQQKQNQKTKIKRKQASNEL                                       DILKHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL
Sbjct:    1 MKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRI-------------PKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQEATNSDHIVNSLKQQKQNQKTKIKRKQASNEL---------------------------------------DILKHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL 730          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Planmine SMEST
Match: SMESG000017883.1 (SMESG000017883.1)

HSP 1 Score: 1374.38 bits (3556), Expect = 0.000e+0
Identity = 734/785 (93.50%), Postives = 735/785 (93.63%), Query Frame = 3
Query: 1224 MKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA---NHKFDCDSSANSGIAVLPXXXXXXXXXXXXXXXCLESPVHSEENTCLIQEATNSDHIVNSLXXXXXXXXXXXXXXXASNELSVNLNRXXXXXXXXXXXXXXXXNIMKKNHEKLDNEPLSRDILKHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIIXXXXXXXXXXXXXXXXXXFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL 3569
            MKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQR+              KEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGA   NHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQEATNSDHIVNSLKQQKQNQKTKIKRKQASNELSVNLNRSTSS                                 HDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL
Sbjct:    1 MKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRI-------------PKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGAVRENHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQEATNSDHIVNSLKQQKQNQKTKIKRKQASNELSVNLNRSTSS--------------------------------PHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL 740          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Planmine SMEST
Match: SMESG000017883.1 (SMESG000017883.1)

HSP 1 Score: 1370.14 bits (3545), Expect = 0.000e+0
Identity = 729/777 (93.82%), Postives = 730/777 (93.95%), Query Frame = 3
Query: 1239 MLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPXXXXXXXXXXXXXXXCLESPVHSEENTCLIQEATNSDHIVNSLXXXXXXXXXXXXXXXASNELSVNLNRXXXXXXXXXXXXXXXXNIMKKNHEKLDNEPLSRDILKHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIIXXXXXXXXXXXXXXXXXXFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL 3569
            MLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQR+              KEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQEATNSDHIVNSLKQQKQNQKTKIKRKQASNELSVNLNRSTSS                                 HDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL
Sbjct:    1 MLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRI-------------PKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQEATNSDHIVNSLKQQKQNQKTKIKRKQASNELSVNLNRSTSS--------------------------------PHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL 732          
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Planmine SMEST
Match: SMESG000017883.1 (SMESG000017883.1)

HSP 1 Score: 1365.13 bits (3532), Expect = 0.000e+0
Identity = 723/777 (93.05%), Postives = 724/777 (93.18%), Query Frame = 3
Query: 1239 MLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYSRRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPXXXXXXXXXXXXXXXCLESPVHSEENTCLIQEATNSDHIVNSLXXXXXXXXXXXXXXXASNELSVNLNRXXXXXXXXXXXXXXXXNIMKKNHEKLDNEPLSRDILKHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIIXXXXXXXXXXXXXXXXXXFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL 3569
            MLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQR+              KEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQEATNSDHIVNSLKQQKQNQKTKIKRKQASNEL                                       DILKHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL
Sbjct:    1 MLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWYYIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFTCSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRI-------------PKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLKDFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYLVHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIRSRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEGANHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQEATNSDHIVNSLKQQKQNQKTKIKRKQASNEL---------------------------------------DILKHDIARNRRRSFELSRKRQTNYSIYSAESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEEILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSASPIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSSPICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSSKKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPYTQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL 725          
The following BLAST results are available for this feature:
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNH80.000e+052.10potassium voltage-gated channel subfamily H member... [more]
KCNH30.000e+049.27potassium voltage-gated channel subfamily H member... [more]
KCNH40.000e+049.79potassium voltage-gated channel subfamily H member... [more]
KCNH40.000e+049.79potassium voltage-gated channel subfamily H member... [more]
KCNH60.000e+041.60potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1031.172e-14245.38Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.287e-14245.38Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1033.376e-14245.38Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1035.164e-14245.38Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1035.352e-14245.38Potassium voltage-gated channel unc-103 [Source:U... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Elk0.000e+049.01gene:FBgn0011589 transcript:FBtr0086802[more]
Elk0.000e+048.87gene:FBgn0011589 transcript:FBtr0340287[more]
eag6.094e-14636.07gene:FBgn0000535 transcript:FBtr0310016[more]
eag4.594e-14435.43gene:FBgn0000535 transcript:FBtr0303286[more]
eag2.886e-14335.37gene:FBgn0000535 transcript:FBtr0073955[more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh30.000e+048.93potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh4b0.000e+051.62potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh4b0.000e+051.62potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh80.000e+051.27potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh4a0.000e+049.18potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snc13.20.000e+051.55class I histocompatibility antigen [Source:Xenbase... [more]
snc13.20.000e+051.55class I histocompatibility antigen [Source:Xenbase... [more]
fth1.10.000e+050.71ferritin, heavy polypeptide 1, gene 1 [Source:Xenb... [more]
fth1.10.000e+050.71ferritin, heavy polypeptide 1, gene 1 [Source:Xenb... [more]
snc13.20.000e+051.27class I histocompatibility antigen [Source:Xenbase... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnh80.000e+052.48potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh30.000e+048.24potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh40.000e+049.51potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh40.000e+049.51potassium voltage-gated channel, subfamily H (eag-... [more]
Kcnh60.000e+041.70potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96L42|KCNH8_HUMAN0.000e+052.10Potassium voltage-gated channel subfamily H member... [more]
sp|Q9QWS8|KCNH8_RAT0.000e+052.48Potassium voltage-gated channel subfamily H member... [more]
sp|Q9ULD8|KCNH3_HUMAN0.000e+049.27Potassium voltage-gated channel subfamily H member... [more]
sp|P59111|KCNH8_MOUSE0.000e+052.33Potassium voltage-gated channel subfamily H member... [more]
sp|O89047|KCNH3_RAT0.000e+048.88Potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EXZ90.000e+055.24Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DRF80.000e+054.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3I8E82.717e-856.11potassium voltage-gated channel subfamily H member... [more]
R7UNL60.000e+053.86Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2S1WM350.000e+053.76Putative potassium voltage-gated channel KCNH 5 OS... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh4b0.000e+051.09potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh4b0.000e+050.20potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh30.000e+049.29potassium voltage-gated channel subfamily H member... [more]
kcnh4a0.000e+050.28potassium voltage-gated channel subfamily H member... [more]
kcnh5a4.294e-15436.10potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005922.10.000e+054.13pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-... [more]
kcnh84.971e-15256.35potassium voltage-gated channel, subfamily H (eag-... [more]
kcnh1b8.792e-14735.39potassium voltage-gated channel, subfamily H (eag-... [more]
ENSPMAT00000005594.11.782e-14345.88pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1... [more]
kcnh87.586e-13451.65potassium voltage-gated channel, subfamily H (eag-... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458880.000e+044.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301401.893e-16037.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367801.322e-14135.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470441.670e-10034.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471231.798e-10039.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnh80.000e+052.04potassium voltage-gated channel subfamily H member... [more]
ENSORLT00000038506.10.000e+050.63potassium voltage-gated channel subfamily H member... [more]
ENSORLT00000035685.10.000e+048.65potassium voltage-gated channel subfamily H member... [more]
ENSORLT00000005614.20.000e+050.27potassium voltage-gated channel subfamily H member... [more]
kcnh4a0.000e+048.70potassium voltage-gated channel subfamily H member... [more]
back to top
BLAST of potassium voltage-gated channel subfamily H member 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017883.10.000e+093.86SMESG000017883.1[more]
SMESG000017883.10.000e+093.09SMESG000017883.1[more]
SMESG000017883.10.000e+093.50SMESG000017883.1[more]
SMESG000017883.10.000e+093.82SMESG000017883.1[more]
SMESG000017883.10.000e+093.05SMESG000017883.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008580 ID=SMED30008580|Name=potassium voltage-gated channel subfamily H member 8|organism=Schmidtea mediterranea sexual|type=transcript|length=3595bp
TGTCAAATAGAAGAAAACTTTTAGAAATCGCTCTGAATAAATTAATCTGA
TCATAAATATACTACTTATTACTACTTGGATTAAATGAATTAACAACTTA
ATTTTAAGTTTGGATATTTTGACAAATTCTATTTCTTCATTTAATTTGCT
TGCAAATATAAATGCCACAACGAAAAGGATTATTGGCCCCTCAAAATACT
TTTCTGGACACAATCGCTACTAGATTTGATGGAACACATAGCAACTTCGT
TCTTGGAAATGCTGAAGCTAAAGAATATCCAATTGTCTATTGCTCAGATG
GGTTTCTTTTGCTGACAAAATATTCTCGAGCTAATGTCATGTCTCGAGGG
AGTGAATGCCGTTTTCTTTGTGGACCCGAAACGAACGAGGAAGAAAAATC
GAAAATTTCAAATGCTTTTCACTGTAAAAAGGAATTTAAAACAGAAATTA
TTTTTTACAAAAGAACAGGAGAGAAATTTCTCTGCCTTCTTGATGTTGTT
CCAATAAAAAACGAAAAAGGACAAGTTGTTCTGTTTTTAGTATCTCATAA
AGATTTAACTCCGAAAGACAAAAAAAAGAACAACTCTATTGAAAATGGAT
GCAAATCAAGCATCTCAGACATGGGTGATAACAAAACTAGTCAAAGCAAC
AATAACACTAATTGTGAAGAGGGAGAGGATGAAGATGTAGAAGAAATTCA
AACAACCTCTAAATATCAAAGAAGACGCAGTAGAGCTGTATTATATCATT
TACAAGGACAATACAATGGCAAGAGAAAAAATAAAAGCAAGCTCAATAGA
TTTCAAAATTTCAATGGTGCTGAAAGTCTTCCCGAATACAAAGTGGATGA
AATGAAAAAAGCCTGTTTTATATTCCAACATTACGGACCTATAAAAATTA
TCTGGGATTGGGCACTGCTTTTCGCTACATTCTACATAGCATTAATGGTT
CCATATCATGCCGCAGTGCAGGTAGATCATGCCAACAAAAACTCTGTGGT
TCTTGACATCATTGTGGAAATTTTATTTATCTTGGATGTCGTATTCAATT
TTCGAACAACATATGTCAACTGCAGCGGCCAAATTGTGTATGAGCAACGC
AGAATTGCTATAAACTATATAAAAGGATGGTTTATTGTGGATTTAATTGC
TGCTATTCCATTTGATATTCTAAATATCGTTTTCGGAAATCAGGATCACA
CAACAAAACCTCAAATACATTTGATGAAATTAACTCGGATGCTGCGATTG
GCAAGATTGATGCAAAAGATTGATAGATATTATCAATATAGTGCTGTGGT
ATTGGCATTATTGATAGGAATGTTTGGTCTATGTGCCCACTGGCTGGCCT
GCATCTGGTATTACATCGGACTGCGTGAGTTACATAATAATAATACGAAA
AGCATCGGTTGGATGTTTGAATTATCTGAGAAACTTCAAAAGCCTTATTC
CGCTAATTGGACTGGTGGACCGGAAATCTCTAACTTTTTTATCACAGCGC
TCTATTTTACTTGCAGCAGTTTGACAAGTGTGGGATTCGGTAATGTTTCA
GCGAATACAGACTCAGAGAAACTTTTCTCAATTTGTGTCATGCTAATGGG
AGCACTAATGCACGCCGCAATATTTGGCAACGTAACTGCTTTGATTCAAC
GGATGTATTCACGCAGAACGGCTTATCAATCAAAACATCGAGACCTAAAA
GAATTCATTCGAACTCATCGCATACCAAAAAAATTAAAGCAAAGAATGCT
GGAGTTCTTTCAGACGACGTGGGCTCTAAATCGCGGAATCGATGTAAACG
ATGTACTCAAGGATTTTTCCGATGGACTCAGAGGGGACATTGCTATTCAT
TTAAATCGAGAGGTTCTCGGTCTCAAAGTGTTTGAAAAAGCTAATCAAGG
GTGTTTGAAAGCTTTAGCACAAAAAATAAAAACTGCTTTTTGCACCCCTG
GAGAATATCTAGTTCATACAGGTGACATACTTCACTATATTTATTTCGTT
TGCAGCGGCTCCCTTGAAATTTTAGAAAACAACGAAGTTGTTGCACTTCT
GGGTAAAAACGACTGGTTTGGAACTTATGTGGATCATTTGCAATCATACA
GCGTAATCAGATCAAGATGCGATGTTAAAGCACTTACTTATTGTGACCTA
CAATGCATTGAATTGACTGGAATTCAAAATATTTTCCTTTTATATCCCTC
TTTCAAAGCAGTTTTTTCAAAGTTTTTGTATCAGGATCTTTCTTTTAACA
TCCAAGAAGGAGCGAACCATAAATTTGACTGTGACAGTTCTGCGAATTCA
GGAATCGCAGTCTTGCCAAGCATATCAGAGGATGAGGATGAATACTCAAT
AGAAAGCGAAAGTTGCCTGGAAAGTCCGGTTCACAGTGAAGAAAACACAT
GTTTAATACAAGAAGCCACCAACAGTGATCATATTGTCAATTCTTTAAAA
CAACAGAAACAAAATCAGAAAACGAAAATTAAAAGAAAACAGGCATCAAA
TGAATTGTCTGTCAATCTGAATCGATCAACTTCTTCTCCAGTTCTTCTTT
CACAAAGCTCAGATTTAGATTTAAATATAATGAAAAAAAACCATGAAAAA
TTAGATAATGAGCCTTTATCAAGAGATATTTTAAAGCACGACATTGCTAG
AAATCGACGAAGGAGTTTCGAGTTGTCTAGAAAACGCCAGACAAACTACA
GTATATATTCAGCAGAAAGTGACAGTAGCAATGAAGACCATAAATGGCAG
AAATCGTTTCGACATGAGCTCAATGGAATGAAAAAACATGTTGAAAGGTT
AGAGAGCAATTTCATTCTCATGAATAAAACAATCAGTTGCATGAGCAGAA
ATATTGAAGAAATCCTTAGTCACATTAACAATCAAAATTTATACAATTCT
GATCTTTATACTGAAAGCAACCAATATATCTACGGAATGAGGCCAACTCC
TAACAAACATTTGAGAAAACCCTATCATCACACTCCATTACTGAAAGTTG
TATCAGCATCGCCTATTCATGAAAATGAAGAGAGGTCGCCTCATATTATC
ATAAATGAAAGAGTATATGAAAACAACGATGTCAATGATGACGATGAAGC
AAGGGCATTTCTAGATGCAACCAGATCTAATCGTCTTCCAAATATCACTT
TTCAATCCTCTCCAATTTGTGAAAACTCTTTGTTACACATCAATACAAAT
CTGTTAGAAAGTAAACTTTCACCGAGATCCGCTAGTTCTGGGTTCGTGTC
TAACCAAGAAGATATTTCGCCAAAATCATCTCAGTACTATATAGATGTCC
TCAAATCATCTAAGAAACCAATTTCCGATGACCAAAAAACTAATGAGGAA
CATTTTAAACCCTCGACTGAATTAAATCATCAAGAATTAATGAGGAAAAT
AAATCAAATTTGCAGAATGCAGTCACTTCCAGAGAGTGCTTATCCTCCCG
TAGCCCCATACACACAATATACAGCTGACAATCCCTCTTCCGGTGACATT
TCTAATGCAAAATATTTTACGCATCGTAGAATTTCTTCTCCGATACCTTT
TATTCGGTCAACTAACTTATAGAACCTTCTTTCATAGTGTTATAC
back to top

protein sequence of SMED30008580-orf-1

>SMED30008580-orf-1 ID=SMED30008580-orf-1|Name=SMED30008580-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1137bp
MPQRKGLLAPQNTFLDTIATRFDGTHSNFVLGNAEAKEYPIVYCSDGFLL
LTKYSRANVMSRGSECRFLCGPETNEEEKSKISNAFHCKKEFKTEIIFYK
RTGEKFLCLLDVVPIKNEKGQVVLFLVSHKDLTPKDKKKNNSIENGCKSS
ISDMGDNKTSQSNNNTNCEEGEDEDVEEIQTTSKYQRRRSRAVLYHLQGQ
YNGKRKNKSKLNRFQNFNGAESLPEYKVDEMKKACFIFQHYGPIKIIWDW
ALLFATFYIALMVPYHAAVQVDHANKNSVVLDIIVEILFILDVVFNFRTT
YVNCSGQIVYEQRRIAINYIKGWFIVDLIAAIPFDILNIVFGNQDHTTKP
QIHLMKLTRMLRLARLMQKIDRYYQYSAVVLALLIGMFGLCAHWLACIWY
YIGLRELHNNNTKSIGWMFELSEKLQKPYSANWTGGPEISNFFITALYFT
CSSLTSVGFGNVSANTDSEKLFSICVMLMGALMHAAIFGNVTALIQRMYS
RRTAYQSKHRDLKEFIRTHRIPKKLKQRMLEFFQTTWALNRGIDVNDVLK
DFSDGLRGDIAIHLNREVLGLKVFEKANQGCLKALAQKIKTAFCTPGEYL
VHTGDILHYIYFVCSGSLEILENNEVVALLGKNDWFGTYVDHLQSYSVIR
SRCDVKALTYCDLQCIELTGIQNIFLLYPSFKAVFSKFLYQDLSFNIQEG
ANHKFDCDSSANSGIAVLPSISEDEDEYSIESESCLESPVHSEENTCLIQ
EATNSDHIVNSLKQQKQNQKTKIKRKQASNELSVNLNRSTSSPVLLSQSS
DLDLNIMKKNHEKLDNEPLSRDILKHDIARNRRRSFELSRKRQTNYSIYS
AESDSSNEDHKWQKSFRHELNGMKKHVERLESNFILMNKTISCMSRNIEE
ILSHINNQNLYNSDLYTESNQYIYGMRPTPNKHLRKPYHHTPLLKVVSAS
PIHENEERSPHIIINERVYENNDVNDDDEARAFLDATRSNRLPNITFQSS
PICENSLLHINTNLLESKLSPRSASSGFVSNQEDISPKSSQYYIDVLKSS
KKPISDDQKTNEEHFKPSTELNHQELMRKINQICRMQSLPESAYPPVAPY
TQYTADNPSSGDISNAKYFTHRRISSPIPFIRSTNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003950K_chnl_volt-dep_ELK
IPR001610PAC
IPR000595cNMP-bd_dom
IPR000014PAS
IPR005821Ion_trans_dom
IPR014710RmlC-like_jellyroll
IPR000700PAS-assoc_C
IPR018490cNMP-bd-like
IPR003938K_chnl_volt-dep_EAG/ELK/ERG
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005622intracellular
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0000160phosphorelay signal transduction system
GO:0006810transport
GO:0023014signal transduction by protein phosphorylation
GO:0034765regulation of ion transmembrane transport
GO:0042391regulation of membrane potential
GO:0071805potassium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
GO:0000155phosphorelay sensor kinase activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity