ST13 Hsp70 interacting protein

Overview
NameST13 Hsp70 interacting protein
Smed IDSMED30008579
Length (bp)1296
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ST13 Hsp70 interacting protein (SMED30008579) t-SNE clustered cells

Violin plots show distribution of expression levels for ST13 Hsp70 interacting protein (SMED30008579) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ST13 Hsp70 interacting protein (SMED30008579) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ST13 Hsp70 interacting protein (SMED30008579) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008579

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 SmedASXL_018786SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30008579SMESG000079796.1 SMESG000078709.1 SMESG000076757.1 SMESG000075565.1 SMESG000072273.1 SMESG000072061.1 SMESG000071677.1 SMESG000070010.1 SMESG000068042.1 SMESG000067088.1 SMESG000066383.1 SMESG000060756.1 SMESG000057612.1 SMESG000027834.1 SMESG000026430.1 SMESG000018073.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000014790.1 SMESG000014236.1 SMESG000013728.1 SMESG000007706.1 SMESG000005905.1 SMESG000001430.1 SMESG000001117.1 Contig44957uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008579SMESG000079796.1 SMESG000078709.1 SMESG000076757.1 SMESG000075565.1 SMESG000072273.1 SMESG000072061.1 SMESG000071677.1 SMESG000070010.1 SMESG000068042.1 SMESG000067088.1 SMESG000066383.1 SMESG000060756.1 SMESG000057612.1 SMESG000027834.1 SMESG000026430.1 SMESG000018073.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000014790.1 SMESG000014236.1 SMESG000013728.1 SMESG000007706.1 SMESG000005905.1 SMESG000001430.1 SMESG000001117.1 Contig44957newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v4_668_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v4_668_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v4_668_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v4_668_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v4_668_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v4_668_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v4_668_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v4_668_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008579SMESG000077940.1 SMESG000077937.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 Contig17311uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008579SMESG000077940.1 SMESG000077937.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 Contig17311newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30008579SMESG000078709.1 SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 Contig54963uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30008579SMESG000078709.1 SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 Contig54963newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
body wall musculatureSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v4_668_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v6_668_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v6_668_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v6_668_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008579SMESG000071677.1 SMESG000069228.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 SMESG000001430.1 dd_Smed_v4_668_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Human
Match: ST13 (ST13 Hsp70 interacting protein [Source:HGNC Symbol;Acc:HGNC:11343])

HSP 1 Score: 178.718 bits (452), Expect = 2.265e-51
Identity = 105/232 (45.26%), Postives = 150/232 (64.66%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP------------TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  ++  L  FV +C+  PS+L  +E++F R+W+ SMG  +P             E+ P+ K      +  +  SEESDLEI  EGVIE D  +  Q MGD++ E+TEEM D A+ KK  AI+   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++E+NPDSA  YK+RG A++LLG W ++  DL L+ KLDY +DA   +K+V+P+A+ I
Sbjct:    1 MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDA-PQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKI 231          

HSP 2 Score: 58.5362 bits (140), Expect = 8.368e-9
Identity = 24/52 (46.15%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFG 1098
            ++L+DPE++  ++DPEVM A  ++  NPA + KY +NPK+  LI K+ +KFG
Sbjct:  315 EILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFG 366          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Human
Match: ST13 (ST13 Hsp70 interacting protein [Source:HGNC Symbol;Acc:HGNC:11343])

HSP 1 Score: 156.762 bits (395), Expect = 6.192e-45
Identity = 94/209 (44.98%), Postives = 133/209 (63.64%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP------------TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLS 684
            MD  ++  L  FV +C+  PS+L  +E++F R+W+ SMG  +P             E+ P+ K      +  +  SEESDLEI  EGVIE D  +  Q MGD++ E+TEEM D A+ KK  AI+   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++E+NPDSA  YK+RG A++LLG W ++  DL L+
Sbjct:    1 MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDAP-QEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALA 208          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Human
Match: ST13 (ST13 Hsp70 interacting protein [Source:HGNC Symbol;Acc:HGNC:11343])

HSP 1 Score: 140.969 bits (354), Expect = 8.592e-40
Identity = 69/131 (52.67%), Postives = 97/131 (74.05%), Query Frame = 1
Query:  349 QYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPK 741
            Q MGD++ E+TEEM D A+ KK  AI+   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++E+NPDSA  YK+RG A++LLG W ++  DL L+ KLDY +DA   +K+V+P+
Sbjct:   10 QEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPR 140          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Human
Match: ST13 (ST13 Hsp70 interacting protein [Source:HGNC Symbol;Acc:HGNC:11343])

HSP 1 Score: 122.479 bits (306), Expect = 1.291e-32
Identity = 62/113 (54.87%), Postives = 83/113 (73.45%), Query Frame = 1
Query:  316 GVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKW 654
            GVIE D  +  Q MGD++ E+TEEM D A+ KK  AI+   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++E+NPDSA  YK+RG A++LLG W
Sbjct:   50 GVIEPDTDAP-QEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHW 161          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Human
Match: STIP1 (stress induced phosphoprotein 1 [Source:HGNC Symbol;Acc:HGNC:11387])

HSP 1 Score: 62.3882 bits (150), Expect = 7.404e-10
Identity = 37/103 (35.92%), Postives = 58/103 (56.31%), Query Frame = 1
Query:  394 DAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYS 702
            D A  +KN+  + F++G+Y +A+   TEAIK NP  A LY+ RA+CY KLL    A+KD  + ++L P     Y  +  A + +  + ++ D    +L LD S
Sbjct:  334 DLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS 436          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Celegans
Match: hip-1 (Hsp-70 Interacting Protein homolog [Source:UniProtKB/TrEMBL;Acc:G5EE04])

HSP 1 Score: 153.68 bits (387), Expect = 6.386e-42
Identity = 95/231 (41.13%), Postives = 138/231 (59.74%), Query Frame = 1
Query:  103 EQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEK--NPEHK----NEPMHXXXXXXXXXXXXXXXXXXGVI-----EGDIVSEDQY---MGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            + + LL++FV +CQ  P++L   E  FF+D+L+S+GAT+P +    PE K     EP  E P  E + E ++    E        EG I  E+     MGD + E TE+  + A  ++ +A + F  G++  A+T  T AI+ NP  AML+AKRA+  +KL  P AAI D +K++ +NPDSA  YKFRG AN+LLGKW+++  DL  + KLDY + A E +K+VEP A  I
Sbjct:    2 DHVALLKQFVGMCQANPAVLHAPEFGFFKDYLVSLGATLPPKPADKPEGKCPMSEEPKKETPAAEATPEPEIPKPEEIPFPKIDNEGVIEPEEAVALPMGDSAKEATEDEIEKASEERGKAQEAFSNGDFDTALTHFTAAIEANPGSAMLHAKRANVLLKLKRPVAAIADCDKAISINPDSAQGYKFRGRANRLLGKWVEAKTDLATACKLDYDEAANEWLKEVEPNAHKI 232          

HSP 2 Score: 65.855 bits (159), Expect = 1.946e-11
Identity = 32/55 (58.18%), Postives = 42/55 (76.36%), Query Frame = 1
Query:  946 LLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGAG 1110
            L +DPE+   ++DPEV+ AL +I+ NPA +MKY NNPK+AKLI K+QSK   GAG
Sbjct:  323 LFSDPEIAAAIQDPEVLPALMDIMQNPANMMKYINNPKVAKLISKLQSK---GAG 374          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Celegans
Match: hip-1 (Hsp-70 Interacting Protein homolog [Source:UniProtKB/TrEMBL;Acc:G5EE04])

HSP 1 Score: 153.68 bits (387), Expect = 6.386e-42
Identity = 95/231 (41.13%), Postives = 138/231 (59.74%), Query Frame = 1
Query:  103 EQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEK--NPEHK----NEPMHXXXXXXXXXXXXXXXXXXGVI-----EGDIVSEDQY---MGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            + + LL++FV +CQ  P++L   E  FF+D+L+S+GAT+P +    PE K     EP  E P  E + E ++    E        EG I  E+     MGD + E TE+  + A  ++ +A + F  G++  A+T  T AI+ NP  AML+AKRA+  +KL  P AAI D +K++ +NPDSA  YKFRG AN+LLGKW+++  DL  + KLDY + A E +K+VEP A  I
Sbjct:    2 DHVALLKQFVGMCQANPAVLHAPEFGFFKDYLVSLGATLPPKPADKPEGKCPMSEEPKKETPAAEATPEPEIPKPEEIPFPKIDNEGVIEPEEAVALPMGDSAKEATEDEIEKASEERGKAQEAFSNGDFDTALTHFTAAIEANPGSAMLHAKRANVLLKLKRPVAAIADCDKAISINPDSAQGYKFRGRANRLLGKWVEAKTDLATACKLDYDEAANEWLKEVEPNAHKI 232          

HSP 2 Score: 65.855 bits (159), Expect = 1.946e-11
Identity = 32/55 (58.18%), Postives = 42/55 (76.36%), Query Frame = 1
Query:  946 LLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGAG 1110
            L +DPE+   ++DPEV+ AL +I+ NPA +MKY NNPK+AKLI K+QSK   GAG
Sbjct:  323 LFSDPEIAAAIQDPEVLPALMDIMQNPANMMKYINNPKVAKLISKLQSK---GAG 374          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Fly
Match: HIP-R (gene:FBgn0029676 transcript:FBtr0070597)

HSP 1 Score: 111.309 bits (277), Expect = 7.335e-27
Identity = 81/240 (33.75%), Postives = 124/240 (51.67%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP---------TEKNP------EHKNEPMHXXXXXXXXXXXXXXXX-----XXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            M    ++ L+ F+D     P+ L + +L+F +D++   G T+P           K P         NEP +     E+ +      S     MEGVIE D     Q MG+ S + TEE  + A   + +A   + +  + EA+ L T+AI+L+P  A+ +AKR   ++KL  PNA I+D + +LELN D A  YKFRG A +LLG +  +  DL  + KLD+ ++  E +K+V P AK I
Sbjct:    5 MQTGDLKKLKYFIDFALENPTFLNMPQLQFVKDFVEKFGGTVPPGQFNGGSAGGKCPFGGVAGAKANEPANAPEDSEDEKSLSDPESDVELDMEGVIEAD-SDPAQPMGNYSKKATEEEVEQASELRAQAASAYGQQKFDEAIALYTKAIELSPGNALFHAKRGQAFLKLKKPNACIRDCDVALELNSDLAAGYKFRGRARRLLGDFELAAHDLRQACKLDFDEETDEWLKEVTPNAKKI 243          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Fly
Match: HIP-R (gene:FBgn0029676 transcript:FBtr0070598)

HSP 1 Score: 111.309 bits (277), Expect = 7.335e-27
Identity = 81/240 (33.75%), Postives = 124/240 (51.67%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP---------TEKNP------EHKNEPMHXXXXXXXXXXXXXXXX-----XXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            M    ++ L+ F+D     P+ L + +L+F +D++   G T+P           K P         NEP +     E+ +      S     MEGVIE D     Q MG+ S + TEE  + A   + +A   + +  + EA+ L T+AI+L+P  A+ +AKR   ++KL  PNA I+D + +LELN D A  YKFRG A +LLG +  +  DL  + KLD+ ++  E +K+V P AK I
Sbjct:    5 MQTGDLKKLKYFIDFALENPTFLNMPQLQFVKDFVEKFGGTVPPGQFNGGSAGGKCPFGGVAGAKANEPANAPEDSEDEKSLSDPESDVELDMEGVIEAD-SDPAQPMGNYSKKATEEEVEQASELRAQAASAYGQQKFDEAIALYTKAIELSPGNALFHAKRGQAFLKLKKPNACIRDCDVALELNSDLAAGYKFRGRARRLLGDFELAAHDLRQACKLDFDEETDEWLKEVTPNAKKI 243          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Fly
Match: HIP-R (gene:FBgn0029676 transcript:FBtr0333764)

HSP 1 Score: 111.309 bits (277), Expect = 7.335e-27
Identity = 81/240 (33.75%), Postives = 124/240 (51.67%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP---------TEKNP------EHKNEPMHXXXXXXXXXXXXXXXX-----XXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            M    ++ L+ F+D     P+ L + +L+F +D++   G T+P           K P         NEP +     E+ +      S     MEGVIE D     Q MG+ S + TEE  + A   + +A   + +  + EA+ L T+AI+L+P  A+ +AKR   ++KL  PNA I+D + +LELN D A  YKFRG A +LLG +  +  DL  + KLD+ ++  E +K+V P AK I
Sbjct:    5 MQTGDLKKLKYFIDFALENPTFLNMPQLQFVKDFVEKFGGTVPPGQFNGGSAGGKCPFGGVAGAKANEPANAPEDSEDEKSLSDPESDVELDMEGVIEAD-SDPAQPMGNYSKKATEEEVEQASELRAQAASAYGQQKFDEAIALYTKAIELSPGNALFHAKRGQAFLKLKKPNACIRDCDVALELNSDLAAGYKFRGRARRLLGDFELAAHDLRQACKLDFDEETDEWLKEVTPNAKKI 243          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Fly
Match: HIP (gene:FBgn0260484 transcript:FBtr0070600)

HSP 1 Score: 111.309 bits (277), Expect = 7.335e-27
Identity = 81/240 (33.75%), Postives = 124/240 (51.67%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP---------TEKNP------EHKNEPMHXXXXXXXXXXXXXXXX-----XXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            M    ++ L+ F+D     P+ L + +L+F +D++   G T+P           K P         NEP +     E+ +      S     MEGVIE D     Q MG+ S + TEE  + A   + +A   + +  + EA+ L T+AI+L+P  A+ +AKR   ++KL  PNA I+D + +LELN D A  YKFRG A +LLG +  +  DL  + KLD+ ++  E +K+V P AK I
Sbjct:    5 MQTGDLKKLKYFIDFALENPTFLNMPQLQFVKDFVEKFGGTVPPGQFNGGSAGGKCPFGGVAGAKANEPANAPEDSEDEKSLSDPESDVELDMEGVIEAD-SDPAQPMGNYSKKATEEEVEQASELRAQAASAYGQQKFDEAIALYTKAIELSPGNALFHAKRGQAFLKLKKPNACIRDCDVALELNSDLAAGYKFRGRARRLLGDFELAAHDLRQACKLDFDEETDEWLKEVTPNAKKI 243          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0080866)

HSP 1 Score: 51.6026 bits (122), Expect = 1.030e-6
Identity = 27/72 (37.50%), Postives = 42/72 (58.33%), Query Frame = 1
Query:  400 ADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAY 615
            A+ KK    D+++  NY  A+ L T+AI L P  A  Y  RA+CY+ LL  N+A+ D+  ++ ++P    AY
Sbjct:   49 AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAY 120          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Zebrafish
Match: st13 (ST13 Hsp70 interacting protein [Source:ZFIN;Acc:ZDB-GENE-030131-5395])

HSP 1 Score: 177.563 bits (449), Expect = 2.964e-51
Identity = 112/235 (47.66%), Postives = 151/235 (64.26%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEHKN--------------EPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGD-DSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  ++  L+ FV LC   PS+L L E+ FF+ WLL MGA+IP+    +  +               P  E     ESEES++EI  EGVIE D   + Q MGD +++EVTEEM D A+ KK EAID   +G+  +A+ L TEAIKLNP  A+LYAKRAS YVK+  PNAAI+D ++++ +NPDSA  YK+RG A+KLLG W +S  DL ++ KLDY ++A   +K+V+PKA  I
Sbjct:    1 MDPRKVTELKAFVQLCNENPSVLHLPEMSFFKTWLLGMGASIPSPTMNDSSSCKGSCPCDGGAKKAAPKPEPAPPSESEESEIEIDNEGVIEPD-TDDPQEMGDFENLEVTEEMMDQANEKKTEAIDALGDGDLQKALDLFTEAIKLNPKLAILYAKRASVYVKMQKPNAAIRDCDRAISINPDSAQPYKWRGKAHKLLGHWEESARDLAMACKLDYDEEASAMLKEVQPKANKI 234          

HSP 2 Score: 60.4622 bits (145), Expect = 1.341e-9
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGAGP 1113
            +L NDPE++  ++DPEVM A  ++  NPA + KY +NPKI  LI K+ SKF   AGP
Sbjct:  307 NLFNDPEVLMAMQDPEVMAAFQDVAQNPANIAKYQSNPKIMALINKLSSKF---AGP 360          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Zebrafish
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 58.151 bits (139), Expect = 1.038e-8
Identity = 31/104 (29.81%), Postives = 56/104 (53.85%), Query Frame = 1
Query:  382 EEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKL 693
            EE   +A+  K +A D F++ +Y  A+   TEA+ LNP   + Y+ R+  Y++  C   A+ D+ ++LEL+ +    Y  R  +N  LGK+  +  D    +++
Sbjct:   12 EERNASAEKLKEKANDYFKDKDYENAIKYYTEALDLNPTNPIYYSNRSLSYLRTECYGYALADATRALELDKNYLKGYYRRATSNMALGKFKAALKDYETVVRV 115          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Zebrafish
Match: sgtb (small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Source:ZFIN;Acc:ZDB-GENE-040704-72])

HSP 1 Score: 56.9954 bits (136), Expect = 1.648e-8
Identity = 38/117 (32.48%), Postives = 64/117 (54.70%), Query Frame = 1
Query:  400 ADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQ-MKDVEPKAK 747
            A+  KNE  +  +E NY+ AV   T+AI+L+   A+ Y  RA+ + KL     A+ D  +++ ++P  + AY   G+A   + K+ ++    N +L LD  +D Y+  +K VE K K
Sbjct:  101 AEQLKNEGNNHMKEENYSSAVDCYTKAIELDQRNAVYYCNRAAAHSKLENYTEAMGDCERAIAIDPSYSKAYGRMGLALTSMSKYPEAISYFNKALVLDPENDTYKSNLKIVEQKQK 217          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Zebrafish
Match: stip1 (stress-induced phosphoprotein 1 [Source:ZFIN;Acc:ZDB-GENE-041121-17])

HSP 1 Score: 57.7658 bits (138), Expect = 1.670e-8
Identity = 35/101 (34.65%), Postives = 57/101 (56.44%), Query Frame = 1
Query:  394 DAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLD 696
            D A  +KN+  D F++G+Y  A+   +EAIK NP  A L++ RA+CY KLL    A+KD  + + L+      Y  +G A + +  + ++ D    +L+LD
Sbjct:  357 DLALEEKNKGNDAFQKGDYPLAMKHYSEAIKRNPYDAKLFSNRAACYTKLLEFQLALKDCEECINLDSTFIKGYTRKGAALEAMKDFSKAMDVYQKALELD 457          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Zebrafish
Match: zgc:123010 (zgc:123010 [Source:ZFIN;Acc:ZDB-GENE-051120-15])

HSP 1 Score: 55.0694 bits (131), Expect = 8.386e-8
Identity = 35/105 (33.33%), Postives = 54/105 (51.43%), Query Frame = 1
Query:  418 EAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDV 732
            + I   +EG Y +AV+L TEAIK +P     +  R+ CY  L     A+ D+ KS+++ PD    Y  RG A   L ++ ++   +   LKLD   D  E + D+
Sbjct:  190 KGIRFVQEGQYTQAVSLFTEAIKCDPKDYRFFGNRSYCYCCLEQYALALADAEKSIQMAPDWPKGYYRRGSALMGLKRYSEAEKAMEQVLKLD--GDCEEAVNDL 292          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Xenopus
Match: st13 (ST13, Hsp70 interacting protein [Source:NCBI gene;Acc:448412])

HSP 1 Score: 194.512 bits (493), Expect = 2.113e-57
Identity = 116/230 (50.43%), Postives = 153/230 (66.52%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEH----------KNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  +++ L EFV LC+  P++L   EL+FF+DWLLSMGA++P   + E           K E     P K ESEESD+EI  EGVI GD   E Q MGD+ +EVTEEM D A+ KK EAI+   EG   +++ L TEAIKLNP  A+LYAKRAS Y+KL  PNAAI+D ++++ +NPDSA  YK+RG A++LLG W  S  DL ++ KLDY +DA   +K+V+P+A  I
Sbjct:    1 MDPRKVQELREFVRLCESNPNVLHCSELQFFKDWLLSMGASVPAAGSTEPPTDAKEETPVKEERTPSPPPKPESEESDIEIDNEGVIPGDD-DEPQEMGDEDVEVTEEMMDQANEKKVEAINALGEGELQKSIDLFTEAIKLNPRIAILYAKRASVYIKLQKPNAAIRDCSRAIAINPDSAQPYKWRGKAHRLLGHWEDSAHDLAMACKLDYDEDASAMLKEVQPRANKI 229          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Xenopus
Match: st13 (ST13, Hsp70 interacting protein [Source:NCBI gene;Acc:448412])

HSP 1 Score: 194.512 bits (493), Expect = 2.315e-57
Identity = 116/230 (50.43%), Postives = 153/230 (66.52%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEH----------KNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  +++ L EFV LC+  P++L   EL+FF+DWLLSMGA++P   + E           K E     P K ESEESD+EI  EGVI GD   E Q MGD+ +EVTEEM D A+ KK EAI+   EG   +++ L TEAIKLNP  A+LYAKRAS Y+KL  PNAAI+D ++++ +NPDSA  YK+RG A++LLG W  S  DL ++ KLDY +DA   +K+V+P+A  I
Sbjct:    1 MDPRKVQELREFVRLCESNPNVLHCSELQFFKDWLLSMGASVPAAGSTEPPTDAKEETPVKEERTPSPPPKPESEESDIEIDNEGVIPGDD-DEPQEMGDEDVEVTEEMMDQANEKKVEAINALGEGELQKSIDLFTEAIKLNPRIAILYAKRASVYIKLQKPNAAIRDCSRAIAINPDSAQPYKWRGKAHRLLGHWEDSAHDLAMACKLDYDEDASAMLKEVQPRANKI 229          

HSP 2 Score: 63.1586 bits (152), Expect = 2.589e-10
Identity = 27/55 (49.09%), Postives = 39/55 (70.91%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGA 1107
            ++L+DPE++  ++DPEVM A  ++  NPA + KY NNPK+  LI K+ SKFG  A
Sbjct:  328 EILSDPEVLAAMQDPEVMAAFQDVAQNPANMSKYQNNPKVMNLITKLSSKFGGSA 382          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Xenopus
Match: st13 (ST13, Hsp70 interacting protein [Source:NCBI gene;Acc:448412])

HSP 1 Score: 186.037 bits (471), Expect = 3.330e-54
Identity = 112/220 (50.91%), Postives = 149/220 (67.73%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  +++ L EFV LC+  P++L   EL+FF+DWLLS    +  ++ P  K E     P K ESEESD+EI  EGVI GD   E Q MGD+ +EVTEEM D A+ KK EAI+   EG   +++ L TEAIKLNP  A+LYAKRAS Y+KL  PNAAI+D ++++ +NPDSA  YK+RG A++LLG W  S  DL ++ KLDY +DA   +K+V+P+A  I
Sbjct:    1 MDPRKVQELREFVRLCESNPNVLHCSELQFFKDWLLSNNNGLCLQETP-VKEERTPSPPPKPESEESDIEIDNEGVIPGDD-DEPQEMGDEDVEVTEEMMDQANEKKVEAINALGEGELQKSIDLFTEAIKLNPRIAILYAKRASVYIKLQKPNAAIRDCSRAIAINPDSAQPYKWRGKAHRLLGHWEDSAHDLAMACKLDYDEDASAMLKEVQPRANKI 218          

HSP 2 Score: 63.1586 bits (152), Expect = 2.542e-10
Identity = 27/55 (49.09%), Postives = 39/55 (70.91%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGA 1107
            ++L+DPE++  ++DPEVM A  ++  NPA + KY NNPK+  LI K+ SKFG  A
Sbjct:  317 EILSDPEVLAAMQDPEVMAAFQDVAQNPANMSKYQNNPKVMNLITKLSSKFGGSA 371          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Xenopus
Match: st13 (ST13, Hsp70 interacting protein [Source:NCBI gene;Acc:448412])

HSP 1 Score: 178.718 bits (452), Expect = 1.223e-51
Identity = 102/237 (43.04%), Postives = 138/237 (58.23%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKN-----------------PEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  +++ L EFV LC+  P++L   EL+FF+DWLLS+ +     +                  PE  NE                     GVI GD   E Q MGD+ +EVTEEM D A+ KK EAI+   EG   +++ L TEAIKLNP  A+LYAKRAS Y+KL  PNAAI+D ++++ +NPDSA  YK+RG A++LLG W  S  DL ++ KLDY +DA   +K+V+P+A  I
Sbjct:    1 MDPRKVQELREFVRLCESNPNVLHCSELQFFKDWLLSIASICQCIQRLLWYELIYLICLWFILPPEIDNE---------------------GVIPGDD-DEPQEMGDEDVEVTEEMMDQANEKKVEAINALGEGELQKSIDLFTEAIKLNPRIAILYAKRASVYIKLQKPNAAIRDCSRAIAINPDSAQPYKWRGKAHRLLGHWEDSAHDLAMACKLDYDEDASAMLKEVQPRANKI 215          

HSP 2 Score: 63.1586 bits (152), Expect = 2.479e-10
Identity = 27/55 (49.09%), Postives = 39/55 (70.91%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGA 1107
            ++L+DPE++  ++DPEVM A  ++  NPA + KY NNPK+  LI K+ SKFG  A
Sbjct:  298 EILSDPEVLAAMQDPEVMAAFQDVAQNPANMSKYQNNPKVMNLITKLSSKFGGSA 352          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Xenopus
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:394990])

HSP 1 Score: 58.9214 bits (141), Expect = 1.014e-8
Identity = 34/101 (33.66%), Postives = 57/101 (56.44%), Query Frame = 1
Query:  394 DAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLD 696
            D A  +K++  + F++G+Y +A+   TEAIK NP  A LY+ RA+CY KLL    A+KD  + + L P     Y  +  A + +  + ++ D    +++LD
Sbjct:  356 DLALEEKSKGNESFQKGDYPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEECIRLEPKFIKGYTRKAAALEAMKDYSKAMDVYQKAMELD 456          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Mouse
Match: St13 (suppression of tumorigenicity 13 [Source:MGI Symbol;Acc:MGI:1917606])

HSP 1 Score: 184.496 bits (467), Expect = 8.169e-54
Identity = 104/222 (46.85%), Postives = 149/222 (67.12%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP--TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  ++  L  FV +C+  PS+L  +E++F R+W+ SMG  +P  T K    +N   + +  +  SEESDLEI  EGVIE D     Q MGD++ E+TEEM D A+ KK  AI+   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++E+NPDSA  YK+RG A++LLG W ++  DL L+ KLDY +DA   +++V+P+A+ I
Sbjct:    1 MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPPATHKAKSEENTKENIKTEELSSEESDLEIDNEGVIEPD-TDAPQEMGDENAEITEEMMDEANEKKGAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLREVQPRAQKI 221          

HSP 2 Score: 57.7658 bits (138), Expect = 1.001e-8
Identity = 23/52 (44.23%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFG 1098
            ++L+DPE++  ++DPEVM A  ++  NP+ + KY +NPK+  LI K+ +KFG
Sbjct:  308 EILSDPEVLAAMQDPEVMVAFQDVAQNPSNMSKYQSNPKVMNLISKLSAKFG 359          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Mouse
Match: St13 (suppression of tumorigenicity 13 [Source:MGI Symbol;Acc:MGI:1917606])

HSP 1 Score: 179.104 bits (453), Expect = 1.204e-51
Identity = 103/231 (44.59%), Postives = 150/231 (64.94%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP-----------TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  ++  L  FV +C+  PS+L  +E++F R+W+ SMG  +P           T++    K    + +  +  SEESDLEI  EGVIE D  +  Q MGD++ E+TEEM D A+ KK  AI+   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++E+NPDSA  YK+RG A++LLG W ++  DL L+ KLDY +DA   +++V+P+A+ I
Sbjct:    1 MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPPATHKAKSEENTKEEKRDKTTEENIKTEELSSEESDLEIDNEGVIEPDTDA-PQEMGDENAEITEEMMDEANEKKGAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLREVQPRAQKI 230          

HSP 2 Score: 57.7658 bits (138), Expect = 1.052e-8
Identity = 23/52 (44.23%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFG 1098
            ++L+DPE++  ++DPEVM A  ++  NP+ + KY +NPK+  LI K+ +KFG
Sbjct:  317 EILSDPEVLAAMQDPEVMVAFQDVAQNPSNMSKYQSNPKVMNLISKLSAKFG 368          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Mouse
Match: St13 (suppression of tumorigenicity 13 [Source:MGI Symbol;Acc:MGI:1917606])

HSP 1 Score: 82.8037 bits (203), Expect = 1.145e-18
Identity = 45/82 (54.88%), Postives = 57/82 (69.51%), Query Frame = 1
Query:  316 GVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAA 561
            GVIE D  +  Q MGD++ E+TEEM D A+ KK  AI+   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAA
Sbjct:   49 GVIEPDTDA-PQEMGDENAEITEEMMDEANEKKGAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAA 129          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Mouse
Match: Stip1 (stress-induced phosphoprotein 1 [Source:MGI Symbol;Acc:MGI:109130])

HSP 1 Score: 62.003 bits (149), Expect = 6.382e-10
Identity = 37/103 (35.92%), Postives = 58/103 (56.31%), Query Frame = 1
Query:  394 DAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYS 702
            D A  +KN+  + F++G+Y +A+   TEAIK NP  A LY+ RA+CY KLL    A+KD  + ++L P     Y  +  A + +  + ++ D    +L LD S
Sbjct:  358 DLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSS 460          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Mouse
Match: Sgtb (small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Source:MGI Symbol;Acc:MGI:2444615])

HSP 1 Score: 56.225 bits (134), Expect = 2.442e-8
Identity = 36/106 (33.96%), Postives = 58/106 (54.72%), Query Frame = 1
Query:  400 ADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYE 717
            AD  K+E  +  +E NYA AV   T+AI+L+P  A+ Y  RA+   KL     AIKD  K++ ++   + AY   G+A   + K+ ++      +L LD  +D+Y+
Sbjct:   85 ADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYK 190          
BLAST of ST13 Hsp70 interacting protein vs. UniProt/SwissProt
Match: sp|Q5ZLF0|F10A1_CHICK (Hsc70-interacting protein OS=Gallus gallus OX=9031 GN=ST13 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.345e-53
Identity = 113/232 (48.71%), Postives = 153/232 (65.95%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTE------------KNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  ++  L  FV LC+  P +L  +EL F R+W+ SMG TIP              K  E   EP+  +  + ESEESDLEI  EGVIE D   + Q MGD+++EVTEEM D A+ KK EAI+   EG+  +AV L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++++NPDSA  YK+RG A++LLG W ++  DL L+ KLDY +DA   +K+V+P+A+ I
Sbjct:    1 MDSRKLGELRAFVRLCKQNPGLLHTEELGFLREWVESMGGTIPPAPASTSTDETSKGKAEEQPEEPV--KSPEPESEESDLEIDNEGVIEPD-NDDPQEMGDENVEVTEEMMDQANEKKMEAINALSEGDLQKAVNLFTDAIKLNPCLAILYAKRASVFVKLQKPNAAIRDCDRAIKINPDSAQTYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKI 229          

HSP 2 Score: 61.2326 bits (147), Expect = 5.624e-9
Identity = 25/52 (48.08%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFG 1098
            ++L+DPE++  ++DPEVM A  ++  NPA + KY NNPK+  LI K+ +KFG
Sbjct:  307 EILSDPEVLAAMQDPEVMAAFQDVAQNPANMSKYQNNPKVMSLITKLSAKFG 358          
BLAST of ST13 Hsp70 interacting protein vs. UniProt/SwissProt
Match: sp|Q5RF31|F10A1_PONAB (Hsc70-interacting protein OS=Pongo abelii OX=9601 GN=ST13 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 5.323e-51
Identity = 106/232 (45.69%), Postives = 150/232 (64.66%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP------------TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  ++  L  FV +C+  PS+L  +E++F R+W+ SMG  +P             E+ P+ K      +  +  SEESDLEI  EGVIE D  +  Q MGD++ E+TEEM D A+ KK  AI+   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++E+NPDSA  YK+RG A++LLG W ++  DL L+ KLDY +DA   +K+V+PKA+ I
Sbjct:    1 MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDA-PQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPKAQKI 231          

HSP 2 Score: 58.5362 bits (140), Expect = 4.091e-8
Identity = 24/52 (46.15%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFG 1098
            ++L+DPE++  ++DPEVM A  ++  NPA + KY +NPK+  LI K+ +KFG
Sbjct:  315 EILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFG 366          
BLAST of ST13 Hsp70 interacting protein vs. UniProt/SwissProt
Match: sp|P50503|F10A1_RAT (Hsc70-interacting protein OS=Rattus norvegicus OX=10116 GN=St13 PE=1 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 7.583e-51
Identity = 103/231 (44.59%), Postives = 149/231 (64.50%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP-----------TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  ++  L  FV +C+  PS+L  +E++F R+W+ SMG  +P           T++    K    + +  +  SEESDLEI  EGVIE D  +  Q MGD++ E+TE M D A+ KK  AID   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++E+NPDSA  YK+RG A++LLG W ++  DL L+ KLDY +DA   +++V+P+A+ I
Sbjct:    1 MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPPATHKAKSEENTKEEKRDKTTEDNIKTEEPSSEESDLEIDNEGVIEADTDA-PQEMGDENAEITEAMMDEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDEDASAMLREVQPRAQKI 230          

HSP 2 Score: 60.077 bits (144), Expect = 1.608e-8
Identity = 24/52 (46.15%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFG 1098
            ++L+DPE++  ++DPEVM A  ++  NP+ + KY NNPK+  LI K+ +KFG
Sbjct:  314 EILSDPEVLAAMQDPEVMVAFQDVAQNPSNMSKYQNNPKVMNLISKLSAKFG 365          
BLAST of ST13 Hsp70 interacting protein vs. UniProt/SwissProt
Match: sp|Q99L47|F10A1_MOUSE (Hsc70-interacting protein OS=Mus musculus OX=10090 GN=St13 PE=1 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 8.424e-51
Identity = 103/231 (44.59%), Postives = 150/231 (64.94%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP-----------TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  ++  L  FV +C+  PS+L  +E++F R+W+ SMG  +P           T++    K    + +  +  SEESDLEI  EGVIE D  +  Q MGD++ E+TEEM D A+ KK  AI+   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++E+NPDSA  YK+RG A++LLG W ++  DL L+ KLDY +DA   +++V+P+A+ I
Sbjct:    1 MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPPATHKAKSEENTKEEKRDKTTEENIKTEELSSEESDLEIDNEGVIEPDTDA-PQEMGDENAEITEEMMDEANEKKGAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLREVQPRAQKI 230          

HSP 2 Score: 57.7658 bits (138), Expect = 7.362e-8
Identity = 23/52 (44.23%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFG 1098
            ++L+DPE++  ++DPEVM A  ++  NP+ + KY +NPK+  LI K+ +KFG
Sbjct:  317 EILSDPEVLAAMQDPEVMVAFQDVAQNPSNMSKYQSNPKVMNLISKLSAKFG 368          
BLAST of ST13 Hsp70 interacting protein vs. UniProt/SwissProt
Match: sp|P50502|F10A1_HUMAN (Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 1.088e-50
Identity = 105/232 (45.26%), Postives = 150/232 (64.66%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP------------TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  ++  L  FV +C+  PS+L  +E++F R+W+ SMG  +P             E+ P+ K      +  +  SEESDLEI  EGVIE D  +  Q MGD++ E+TEEM D A+ KK  AI+   +G   +A+ L T+AIKLNP  A+LYAKRAS +VKL  PNAAI+D ++++E+NPDSA  YK+RG A++LLG W ++  DL L+ KLDY +DA   +K+V+P+A+ I
Sbjct:    1 MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDA-PQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKI 231          

HSP 2 Score: 58.5362 bits (140), Expect = 4.019e-8
Identity = 24/52 (46.15%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFG 1098
            ++L+DPE++  ++DPEVM A  ++  NPA + KY +NPK+  LI K+ +KFG
Sbjct:  315 EILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFG 366          
BLAST of ST13 Hsp70 interacting protein vs. TrEMBL
Match: A0A3R7FQH7 (Hsc70-interacting protein OS=Clonorchis sinensis OX=79923 GN=ST13 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 4.517e-62
Identity = 121/226 (53.54%), Postives = 149/226 (65.93%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP--TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSED----QYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  Q++LL+ FVDL + KP IL L EL FFRDWL S+GATIP  T     H   P    P  +   E   + S       +IV+ D    Q MGDDS+EVTEEM DAA+ K++EA  K   G+   AV L TEAIKLNP  A+LYA+RASC++KL  P AA+KD  K+L LNPDSA  YK+RG A+K+LG W ++++D   SLKLDYS+DAYE MKDVEPK K I
Sbjct:    1 MDSGQLKLLKGFVDLLKKKPDILHLPELAFFRDWLHSLGATIPQPTTGETSHSPSPKARSPEVDSGAEESTDESEIDFPGEEIVAADNDPEQEMGDDSLEVTEEMIDAANDKRSEAQAKMSSGDLEAAVALFTEAIKLNPTSALLYARRASCFIKLKKPCAALKDCEKALHLNPDSAAPYKWRGFAHKMLGHWEEAFNDFQTSLKLDYSEDAYEAMKDVEPKHKRI 226          

HSP 2 Score: 66.2402 bits (160), Expect = 5.272e-8
Identity = 28/49 (57.14%), Postives = 39/49 (79.59%), Query Frame = 1
Query:  946 LLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSK 1092
            L NDPEL+  ++DPEVMKA  E+ +NPAA+ KY +NPK+ K+++KMQ K
Sbjct:  282 LFNDPELIAAIQDPEVMKAFGEVSSNPAAMHKYKDNPKVKKVLEKMQDK 330          
BLAST of ST13 Hsp70 interacting protein vs. TrEMBL
Match: A0A4S2LD23 (TPR_REGION domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008113 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 9.362e-62
Identity = 119/226 (52.65%), Postives = 149/226 (65.93%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP--TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSED----QYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  Q++LL+ FVDL + KP IL L EL FFRDWL S+GAT+P  T     H   P    P  +   E   + S       +IV+ D    Q MGDDS+EVT+EM DAA+ K++EA  K   G+   AV L TEAIKLNP  A+LYA+RASC++KL  P AA+KD  K+L LNPDSA  YK+RG A+K+LG W ++++D   SLKLDYS+DAYE MKDVEPK K I
Sbjct:    1 MDSGQLKLLQGFVDLLKKKPEILHLPELAFFRDWLHSLGATLPQPTTGETSHSPPPKAHSPEVDSGAEESTDESEIEFPGEEIVAADNDPEQEMGDDSLEVTDEMIDAANDKRSEAQAKMSSGDLEAAVALFTEAIKLNPTSALLYARRASCFIKLKKPCAALKDCEKALHLNPDSAAPYKWRGFAHKMLGHWEEAFNDFQTSLKLDYSEDAYEAMKDVEPKHKRI 226          

HSP 2 Score: 66.2402 bits (160), Expect = 3.761e-8
Identity = 28/49 (57.14%), Postives = 39/49 (79.59%), Query Frame = 1
Query:  946 LLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSK 1092
            L NDPEL+  ++DPEVMKA  E+ +NPAA+ KY +NPK+ K+++KMQ K
Sbjct:  282 LFNDPELIAAIQDPEVMKAFGEVSSNPAAMHKYKDNPKVKKVLEKMQDK 330          
BLAST of ST13 Hsp70 interacting protein vs. TrEMBL
Match: A0A3B3RHB7 (TPR_REGION domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 3.366e-60
Identity = 157/340 (46.18%), Postives = 216/340 (63.53%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWL-LSMGATIPTEKNPEHKNEPMHXXXXXXXXXXXXXXXX---XXGVIEGDIVSEDQYMGD-DSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFG 1098
            MD ++I  L+ FV LC   PS+L L EL FFR WL  S+  T PT K       P      K    ES+        +GVIE D   E Q M D DS+EVT+EM D A+ KK EAI    +G   +A+ L TEAIKLNP  A+LYAKRAS Y+++  PNAA++D N+++ +NPDSA  YK+RG A++LLG W ++  DL ++ KLDY ++A   +K+V+PKA  I EH+RKYERK+EE+++Q+++ERV+KA+EEHE+A++                GAG      G+GDL +DPE++  +KDPEVM A  ++  NPA + KY NNPK+  LI K+ +KFG
Sbjct:    1 MDPQKISELKTFVQLCTGNPSVLHLPELGFFRSWLERSVHHTPPTSKEETSSAPPPCSAAPKPPLSESEESELEIDKDGVIEPD-TDEPQEMVDLDSVEVTDEMMDQANEKKMEAITALGDGELDKALGLFTEAIKLNPRLAILYAKRASVYIQMQKPNAAVRDCNRAISINPDSAQPYKWRGKAHRLLGHWEEAAKDLAMACKLDYDEEASALLKEVQPKANRIAEHRRKYERKREEREVQQQKERVKKAREEHERAQRVGERDTVDIVMAPPTGGAGGFPGMAGMGDLFSDPEVLTAMKDPEVMAAFQDVAQNPANMAKYQNNPKVMALITKLSAKFG 339          
BLAST of ST13 Hsp70 interacting protein vs. TrEMBL
Match: A0A5J4NKI8 (Suppressor of tumorigenicity protein 13 OS=Paragonimus westermani OX=34504 GN=DEA37_0014237 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 1.744e-59
Identity = 112/224 (50.00%), Postives = 149/224 (66.52%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSED----QYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            M+++Q+ LL EF+ L   KP  L L EL FF+DWLLS GA +P+ ++         +    +   E     S     + DIV ED    Q MGD+S+EVT+EM + A+ K++EA  K  EG++  AV L TEAIKLNP  A+LYA+RASC++KL  P AA++D +K++ LNPDSA  YK+RG ANKLLG W +++DDL LSLKLDYS+DAYE MK+VEP  K I
Sbjct:    1 MEEKQLRLLREFIALLNAKPETLDLPELSFFKDWLLSHGAKLPSHED-SGAGSAKSDASEVDSGAEDSTSESEVDFGDVDIVPEDTDPCQEMGDESVEVTDEMIEEANDKRSEAQSKMSEGDFEGAVALFTEAIKLNPHSALLYARRASCFIKLKKPCAAVRDCDKAISLNPDSAAPYKWRGFANKLLGNWERAFDDLQLSLKLDYSEDAYEAMKEVEPMHKRI 223          

HSP 2 Score: 62.3882 bits (150), Expect = 6.909e-7
Identity = 33/80 (41.25%), Postives = 46/80 (57.50%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGA---GPMNFDEPTPPTKPAATCDDLD 1173
            +L  DPELV  L+DPEVM A +    +PA +  Y NNPK+ K+++++ +KFG  A   G M F E      P  +  DLD
Sbjct:  278 NLFGDPELVAALQDPEVMAAFSNTSPSPADMHMYQNNPKVKKVLERVMNKFGGSAGMPGGMPFGESPDFNMPTQSTPDLD 357          
BLAST of ST13 Hsp70 interacting protein vs. TrEMBL
Match: A0A3B3RHY2 (TPR_REGION domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 2.505e-59
Identity = 158/359 (44.01%), Postives = 219/359 (61.00%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP----------TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXX----GVIEGDIVSEDQYMGD-DSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLND----PELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGAGP 1113
            MD ++I  L+ FV LC   PS+L L EL FFR WL S+GATIP          + K  E  + P       +       E  +E    GVIE D   E Q M D DS+EVT+EM D A+ KK EAI    +G   +A+ L TEAIKLNP  A+LYAKRAS Y+++  PNAA++D N+++ +NPDSA  YK+RG A++LLG W ++  DL ++ KLDY ++A   +K+V+PKA  I EH+RKYERK+EE+++Q+++ERV+KA+EEHE+A++    + Q     G   G   G         + D    PE++  +KDPEVM A  ++  NPA + KY NNPK+  LI K+ +KFG   GP
Sbjct:    1 MDPQKISELKTFVQLCTGNPSVLHLPELGFFRSWLESLGATIPAASKNEAPPASSKKEETSSAPPPCSAAPKPPLSESEESELEIDKDGVIEPD-TDEPQEMVDLDSVEVTDEMMDQANEKKMEAITALGDGELDKALGLFTEAIKLNPRLAILYAKRASVYIQMQKPNAAVRDCNRAISINPDSAQPYKWRGKAHRLLGHWEEAAKDLAMACKLDYDEEASALLKEVQPKANRIAEHRRKYERKREEREVQQQKERVKKAREEHERAQREEEARQQSSGAGGGFPGFPGGAGGFPGMAGMGDLFSDPEVLTAMKDPEVMAAFQDVAQNPANMAKYQNNPKVMALITKLSAKFG---GP 355          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Cavefish
Match: st13 (ST13 Hsp70 interacting protein [Source:ZFIN;Acc:ZDB-GENE-030131-5395])

HSP 1 Score: 160.999 bits (406), Expect = 3.326e-45
Identity = 100/231 (43.29%), Postives = 143/231 (61.90%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLS--------MGATIPTEKNPEHKNEPMHXXXXXXXXXXXXX--XXXXXGVIEGDIVSEDQYMGD-DSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD +++  L+ FV LC   P++L L E+ FFR W L            + P +  P     P  +      SE  +   EI MEGVIE D  +  Q MGD +++EVTEEM D A+ KK EAI    +G   +A+ L T+AIKLNP  A+LYAKRAS Y+K+  PNAAI+D ++++++NPDSA +YK+RG A++LLG W ++  DL ++ KLDY +DA   +K+V+P+A  I
Sbjct:    1 MDPKKVSELKAFVQLCTDNPAVLHLPEMGFFRTWSLHKLVCVFHFAQGSCPCDAGPRFTAAPPPKAEPAPPSESEESDLEIDMEGVIEPDTEAA-QEMGDYENLEVTEEMIDQANEKKGEAIGALGDGELQKALDLFTDAIKLNPKSAILYAKRASVYIKMQKPNAAIRDCDRAIDINPDSAQSYKWRGKAHRLLGHWEEAAKDLAMACKLDYDEDASAMLKEVQPRANKI 230          

HSP 2 Score: 48.9062 bits (115), Expect = 5.905e-6
Identity = 23/46 (50.00%), Postives = 30/46 (65.22%), Query Frame = 1
Query:  976 LKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGAGP 1113
             +DPEVM A  ++  NPA + KY +NPKI  LI K+ SKF   +GP
Sbjct:  306 FQDPEVMAAFQDVAQNPANISKYQSNPKIMALINKLSSKF---SGP 348          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Cavefish
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:103034548])

HSP 1 Score: 58.9214 bits (141), Expect = 5.688e-9
Identity = 32/108 (29.63%), Postives = 59/108 (54.63%), Query Frame = 1
Query:  382 EEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSD 705
            EE    A+  K +A + F+E +Y  A+   TEA++LNP  A+ Y+ R+  Y++  C   A+ D+ ++LE++ +    Y  R  +N  LGK+  +  D    +++  +D
Sbjct:   15 EERSGRAEELKEKANNYFKEKDYENAIKYYTEALELNPSNAIYYSNRSLAYLRTECYGYALADATRALEIDKNYIKGYYRRATSNMALGKFKAALKDYETVVRVRPND 122          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Cavefish
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:103039937])

HSP 1 Score: 58.5362 bits (140), Expect = 7.071e-9
Identity = 39/112 (34.82%), Postives = 63/112 (56.25%), Query Frame = 1
Query:  394 DAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDY-SDDAYEQMK 726
            D A  +KN+  + F++G+Y  A+   TEAIK NP  A L++ RA+CY KLL    A+KD  + + L+P     Y  +  A + +  + ++ D    +L+LD  S +A E M+
Sbjct:  357 DLALEEKNKGNEAFQKGDYPVAMKHYTEAIKRNPNDAKLFSNRAACYTKLLEFQLALKDCEECINLDPAFIKGYTRKAAALEAMKDFSKAMDAYQKALELDSNSKEATEGMQ 468          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Cavefish
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:103039937])

HSP 1 Score: 58.151 bits (139), Expect = 8.190e-9
Identity = 39/112 (34.82%), Postives = 63/112 (56.25%), Query Frame = 1
Query:  394 DAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDY-SDDAYEQMK 726
            D A  +KN+  + F++G+Y  A+   TEAIK NP  A L++ RA+CY KLL    A+KD  + + L+P     Y  +  A + +  + ++ D    +L+LD  S +A E M+
Sbjct:  357 DLALEEKNKGNEAFQKGDYPVAMKHYTEAIKRNPNDAKLFSNRAACYTKLLEFQLALKDCEECINLDPAFIKGYTRKAAALEAMKDFSKAMDAYQKALELDSNSKEATEGMQ 468          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Cavefish
Match: dnaaf4 (dynein axonemal assembly factor 4 [Source:NCBI gene;Acc:103026332])

HSP 1 Score: 53.9138 bits (128), Expect = 1.491e-7
Identity = 37/101 (36.63%), Postives = 57/101 (56.44%), Query Frame = 1
Query:  433 FREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLEL-------NPDSAL-AYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDA 711
            FR GNY  AV     AIKLN     L++ RA+C++KL   + AI+DS+++LEL       N  + L A+  RG A   L  +++   D + +LK+D ++ A
Sbjct:  297 FRTGNYQAAVNAYDLAIKLNRRIPALFSNRAACHLKLRNLHKAIEDSSQALELLTPAVTDNAAARLKAHVRRGTAFCELELYVEGLQDYHAALKIDPNNQA 397          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005301.1 (pep scaffold:Pmarinus_7.0:GL479298:6911:18901:-1 gene:ENSPMAG00000004792.1 transcript:ENSPMAT00000005301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.555 bits (436), Expect = 8.497e-52
Identity = 100/223 (44.84%), Postives = 135/223 (60.54%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPT---EKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSED----QYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPK 741
            M+ E++  L+ FV LC   P +L   EL FF+ WL SMGA +P    E +      P       E   E + E S   + +  +V ED    Q MGD  +EV+EEM D A+ KK EA+    +G   +A+ L TEAIKLNP  A+LYAKRAS YVKL  PNAAI+D ++++ +NPDSA +YK+RGIA  LLG W +S  DL ++ KLDY +DA   +K++ PK
Sbjct:    1 MEPEKLSQLKAFVLLCSQNPGVLHKPELHFFKQWLESMGAQVPAAPEEPSAAKPAPPKTAARPPEPEPERESEESDLDIDDDGVVEEDHDPPQDMGDAEVEVSEEMMDQANEKKGEAMSALADGELQKAIELFTEAIKLNPSSAILYAKRASVYVKLEKPNAAIRDGDRAISINPDSAQSYKWRGIARWLLGHWEESSKDLAMACKLDYDEDASRILKEITPK 223          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Sea Lamprey
Match: sgta (small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha [Source:ZFIN;Acc:ZDB-GENE-030131-8811])

HSP 1 Score: 51.6026 bits (122), Expect = 1.612e-7
Identity = 29/94 (30.85%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  433 FREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAY 714
             RE  Y+EAV   T AI+L+   A+ +  RA+ Y KL     A++D  +++ ++P+ + AY   G+A   LGK  ++ +    +++LD  ++ Y
Sbjct:  104 MREERYSEAVECYTHAIELHQQNAVYFCNRAAAYSKLSNYVGAVQDCERAIVIDPNYSKAYGRMGLALTSLGKHEEAVEFYRRAVELDPDNEGY 197          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002911.1 (pep scaffold:Pmarinus_7.0:GL478619:21387:64649:1 gene:ENSPMAG00000002653.1 transcript:ENSPMAT00000002911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 2.270e-6
Identity = 30/90 (33.33%), Postives = 45/90 (50.00%), Query Frame = 1
Query:  433 FREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYS 702
            F    Y +A+   T+AI  N + A  Y  RA C+VKL     A+ D   +LEL+  S   + F G +   L    ++YD+   +L+L YS
Sbjct:   49 FGNRKYDDAIQCYTKAITRNSLVAAYYTNRALCFVKLQQWEKAVSDCKHALELDSQSVKGHFFMGQSQLEL----ENYDEAIANLQLAYS 134          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Sea Lamprey
Match: stip1 (stress-induced phosphoprotein 1 [Source:ZFIN;Acc:ZDB-GENE-041121-17])

HSP 1 Score: 48.1358 bits (113), Expect = 2.437e-6
Identity = 27/88 (30.68%), Postives = 46/88 (52.27%), Query Frame = 1
Query:  433 FREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLD 696
            F  G+Y  A+   +EA++ NP  A LY+ RA+CY KL     A+KD    + L+P     Y  +  A + +  + ++ D    +++LD
Sbjct:  378 FTNGDYPMAMKHYSEALRRNPNDAKLYSNRAACYTKLAEFQLALKDCEDCIRLDPTFIKGYTRKAAALEAMKDFAKAMDVYQKAIELD 465          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Yeast
Match: STI1 (Hsp90 cochaperone; regulates spatial organization of amyloid-like proteins in the cytosol, thereby buffering the proteotoxicity caused by amyloid-like proteins; interacts with the Ssa group of the cytosolic Hsp70 chaperones and activates Ssa1p ATPase activity; interacts with Hsp90 chaperones and inhibits their ATPase activity; homolog of mammalian Hop [Source:SGD;Acc:S000005553])

HSP 1 Score: 48.521 bits (114), Expect = 1.346e-6
Identity = 32/109 (29.36%), Postives = 59/109 (54.13%), Query Frame = 1
Query:  388 MQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPI-YAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDA 711
            M   AD  K +    F   +Y +A+ L T+AI+++     +LY+ R++CY  L   + A+ D+N+ +++NP  +  Y   G A+  LG   ++  +   +L+LD S+ A
Sbjct:    1 MSLTADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKA 109          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Yeast
Match: TOM71 (Mitochondrial outer membrane protein; probable minor component of the TOM (translocase of outer membrane) complex responsible for recognition and import of mitochondrially directed proteins; TOM71 has a paralog, TOM70, that arose from the whole genome duplication [Source:SGD;Acc:S000001159])

HSP 1 Score: 48.1358 bits (113), Expect = 1.757e-6
Identity = 33/105 (31.43%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  412 KNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLN-LSLKLDYSDDAYEQM 723
            KN     F   N+ EA+     AI+L+P   + Y+  ++CY+        I+ + K+LE+ PD + A   R  AN+ LG +  +  DL+ LSL  D+   + E M
Sbjct:  131 KNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPM 235          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Yeast
Match: TOM70 (Component of the TOM (translocase of outer membrane) complex; involved in the recognition and initial import steps for all mitochondrially directed proteins; acts as a receptor for incoming precursor proteins; TOM70 has a paralog, TOM71, that arose from the whole genome duplication [Source:SGD;Acc:S000005065])

HSP 1 Score: 46.595 bits (109), Expect = 6.335e-6
Identity = 38/119 (31.93%), Postives = 62/119 (52.10%), Query Frame = 1
Query:  376 VTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKL--NPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLN-LSLKLDYSDDAYEQM 723
              EE    A A K++    FR   Y +A+     A++L  +P++   Y+  ++CYV +      ++ S K+LEL PD +     R  AN+ LGK+  +  DL+ LSL  D++D + E M
Sbjct:   91 TAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDPVF---YSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPM 206          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Nematostella
Match: EDO49749 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFM8])

HSP 1 Score: 176.022 bits (445), Expect = 1.221e-52
Identity = 100/218 (45.87%), Postives = 137/218 (62.84%), Query Frame = 1
Query:   91 KMDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKA 744
            K   EQ++ L EFV LC++ P I+   +L FFR+WL S+GA +P    P     P  EE +  + E +    S  GVIE D V E   MGDDSIEVTEEM   A+  + +A++   EGN  EA+ L T+AI  NP  A L+AKRASC++++  PNAAI+D +K+ ++NPDSA  YK+RG A++ LG W ++  DL  +LKLD+ +   E  KDV PKA
Sbjct:    5 KFTNEQLKGLYEFVMLCKMHPEIIHDKKLAFFREWLESLGAKLPDPPMPSQPEAPPQEENMDSKPEPNKEAPSPTGVIEPD-VDEPVPMGDDSIEVTEEMMGEANDLRMKAMEAMNEGNLEEAIKLFTDAIMKNPHSAPLFAKRASCFIRMKKPNAAIRDCDKAAQINPDSAQIYKWRGRAHEFLGHWEKADKDLAQALKLDFDEQVNEWFKDVHPKA 221          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Nematostella
Match: EDO31207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYL2])

HSP 1 Score: 55.4546 bits (132), Expect = 3.511e-8
Identity = 37/105 (35.24%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  382 EEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLD 696
            +E+   A+ +K++  D FR G+Y E++   T +I+L P  A  Y  RA   +KL     AI+D N  + L PD+  A+  R IA K  GK   +  DLN  L+++
Sbjct:  209 QELTFLANREKDKGNDAFRSGDYKESLVYYTRSIELKPTAAS-YNNRAMAEIKLSEYAKAIEDCNTVIFLEPDNLKAFLRRAIAQKQTGKVQAAKKDLNKVLEIE 312          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Nematostella
Match: EDO31474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXS7])

HSP 1 Score: 43.1282 bits (100), Expect = 9.882e-6
Identity = 23/63 (36.51%), Postives = 37/63 (58.73%), Query Frame = 1
Query:  409 KKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNP 597
            K   A D   +G++ +AV L +EAIKL+P   +LY  R++  ++      A++D  K+ ELNP
Sbjct:    2 KAKWAGDACSKGDFQKAVELYSEAIKLDPNNHVLYGNRSAACIRTWQLEQALEDGKKAAELNP 64          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Medaka
Match: st13 (ST13 Hsp70 interacting protein [Source:NCBI gene;Acc:101172581])

HSP 1 Score: 186.808 bits (473), Expect = 5.738e-55
Identity = 110/229 (48.03%), Postives = 145/229 (63.32%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIP--------TEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGD-DSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAKLI 753
            MD  ++  L+ FV+LC+  P IL L E+ FFR WL +MGA IP         ++NP+  N                LEI  +GVIE D + E Q M D DSIEVTEEM D A+ KK EAID   EG+  +A+ L TEAIKLNP  A+LYAKRAS Y+K+  PNAAI+D ++++ +NPDSA  YK+RG A++LLG W ++  DL  + KLDY +DA   +K+V+PKA  I
Sbjct:    1 MDSRKVAELKAFVNLCESSPEILHLPEMSFFRSWLQNMGAKIPPLTKTEGGCKRNPDFCN---FNASFFSSFVVFCLEIDQDGVIEPDTI-EPQEMDDLDSIEVTEEMMDQANEKKVEAIDALGEGDLQKALDLFTEAIKLNPRLAILYAKRASVYIKMQKPNAAIRDCDRAISINPDSAQPYKWRGKAHRLLGHWEEAAKDLATACKLDYDEDASAMLKEVQPKANKI 225          

HSP 2 Score: 64.6994 bits (156), Expect = 4.406e-11
Identity = 30/57 (52.63%), Postives = 37/57 (64.91%), Query Frame = 1
Query:  943 DLLNDPELVEDLKDPEVMKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGAGP 1113
            DLL DPE++  +KDPEVM A  ++  NPA + KY NNPKI  L  K+ SKFG    P
Sbjct:  301 DLLKDPEVLNAMKDPEVMAAFQDVAQNPANISKYQNNPKIMALASKLSSKFGAPPQP 357          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Medaka
Match: stip1 (stress induced phosphoprotein 1 [Source:NCBI gene;Acc:101163839])

HSP 1 Score: 62.003 bits (149), Expect = 5.778e-10
Identity = 36/97 (37.11%), Postives = 56/97 (57.73%), Query Frame = 1
Query:  412 KNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYS 702
            KN+  D F++G+Y  A+   +EAIK NP  A LY+ RA+CY KLL    A+KD    ++L+P     Y  +G A + +  + ++ D    +L+LD S
Sbjct:  363 KNKGNDAFQKGDYPLAMKHYSEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEACIKLDPTFIKGYTRKGAALEAMKDYSKAMDAYQKALELDSS 459          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Medaka
Match: sgta (small glutamine rich tetratricopeptide repeat containing alpha [Source:NCBI gene;Acc:101156880])

HSP 1 Score: 58.9214 bits (141), Expect = 2.907e-9
Identity = 39/132 (29.55%), Postives = 69/132 (52.27%), Query Frame = 1
Query:  379 TEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAY--------EQMKDVEPKAKL 750
            TEE +  A+  K++  D+ +  N+A AV   ++AI LNP  A+ Y  RA+ + KL     A++D  +++ ++P+ + AY   G+A   L K  ++      +L+LD  +D Y        E+M+   P A +
Sbjct:   81 TEEQRAEAERLKSDGNDQMKVENFAAAVEFYSKAIALNPQNAVYYCNRAAAFSKLGNYAGAVQDCEQAIGIDPNYSKAYGRMGLALASLNKHTEAVGYYKKALELDPDNDTYKTNLKIAEEKMETSSPTAGM 212          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Medaka
Match: sgta (small glutamine rich tetratricopeptide repeat containing alpha [Source:NCBI gene;Acc:101156880])

HSP 1 Score: 58.9214 bits (141), Expect = 3.351e-9
Identity = 39/132 (29.55%), Postives = 69/132 (52.27%), Query Frame = 1
Query:  379 TEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAY--------EQMKDVEPKAKL 750
            TEE +  A+  K++  D+ +  N+A AV   ++AI LNP  A+ Y  RA+ + KL     A++D  +++ ++P+ + AY   G+A   L K  ++      +L+LD  +D Y        E+M+   P A +
Sbjct:   85 TEEQRAEAERLKSDGNDQMKVENFAAAVEFYSKAIALNPQNAVYYCNRAAAFSKLGNYAGAVQDCEQAIGIDPNYSKAYGRMGLALASLNKHTEAVGYYKKALELDPDNDTYKTNLKIAEEKMETSSPTAGM 216          
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Medaka
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:101158545])

HSP 1 Score: 58.151 bits (139), Expect = 8.997e-9
Identity = 35/110 (31.82%), Postives = 62/110 (56.36%), Query Frame = 1
Query:  376 VTEE-MQDAADAK---KNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKL 693
            VTEE M +AA+     K +A + F+E +Y  A+   +EA++LNP  A+ Y+ R+  Y++  C   A+ D+ K+LE++ +    Y  R  +N  LGK+  +  D    +++
Sbjct:    8 VTEEKMAEAANEAELLKEKANNYFKEKDYENAIKFYSEALELNPSNAIYYSNRSLAYLRTECYGYALADATKALEVDKNYIKGYYRRATSNMALGKFKAALKDYETVVRV 117          
BLAST of ST13 Hsp70 interacting protein vs. Planmine SMEST
Match: SMESG000060756.1 (SMESG000060756.1)

HSP 1 Score: 278.1 bits (710), Expect = 1.577e-92
Identity = 152/218 (69.72%), Postives = 158/218 (72.48%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAK 747
            MD E+IELLEEFVDLCQI+PSILQL                                                  VIEGDIVSEDQYM DDS+EV E+MQDAA+ KKN+AIDKFREGNYAEAVTLL EAIKLNPIYAMLYAKRASCYVKLL PNAAIKDSNKSLELNPD ALAYKFR IANKLLGKWIQSY D NLSLKLDYSDDAYEQMKDVEPKAK
Sbjct:    1 MDNEKIELLEEFVDLCQIRPSILQL--------------------------------------------------VIEGDIVSEDQYMEDDSLEVNEKMQDAAEEKKNKAIDKFREGNYAEAVTLLIEAIKLNPIYAMLYAKRASCYVKLLYPNAAIKDSNKSLELNPDFALAYKFREIANKLLGKWIQSYYDSNLSLKLDYSDDAYEQMKDVEPKAK 168          
BLAST of ST13 Hsp70 interacting protein vs. Planmine SMEST
Match: SMESG000078709.1 (SMESG000078709.1)

HSP 1 Score: 260.381 bits (664), Expect = 3.250e-86
Identity = 141/208 (67.79%), Postives = 148/208 (71.15%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYE 717
            MD EQIELLEEFVDLCQI+PSILQL                                                  VIEGDIVSEDQYMGDD IEVTEEMQDAAD KKNEA DKFR+GNYAEAVTLLTEAIKLNP YAMLYAKRAS YVK+LCPNA IKDS+K+LELNPDSALAYKF+GIANKLLGKWI+SY D NLSLKLDYSDD YE
Sbjct:    1 MDNEQIELLEEFVDLCQIQPSILQL--------------------------------------------------VIEGDIVSEDQYMGDDFIEVTEEMQDAADEKKNEATDKFRDGNYAEAVTLLTEAIKLNPSYAMLYAKRASFYVKILCPNATIKDSSKTLELNPDSALAYKFKGIANKLLGKWIKSYYDSNLSLKLDYSDDPYE 158          
BLAST of ST13 Hsp70 interacting protein vs. Planmine SMEST
Match: SMESG000041826.1 (SMESG000041826.1)

HSP 1 Score: 258.84 bits (660), Expect = 4.582e-85
Identity = 144/218 (66.06%), Postives = 154/218 (70.64%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAK 747
            MD EQI LLEEF DLC+I+  ILQL                                                  VIE D+VSEDQYMG+DSIEVTEE+QD    KKNE I+K+REGNYAEAVTLLTEAIKLNPIYAMLYAKRAS +VKLLCPNAAIKDSNKS +LNPDSALAYKF+GIANKLLGKWIQSY DLNLSLKLDYSDDAYEQMKDVEPKAK
Sbjct:    1 MDNEQIGLLEEFFDLCKIQSFILQL--------------------------------------------------VIEDDMVSEDQYMGNDSIEVTEEIQDK---KKNEPIEKYREGNYAEAVTLLTEAIKLNPIYAMLYAKRASYHVKLLCPNAAIKDSNKSHKLNPDSALAYKFKGIANKLLGKWIQSYYDLNLSLKLDYSDDAYEQMKDVEPKAK 165          
BLAST of ST13 Hsp70 interacting protein vs. Planmine SMEST
Match: SMESG000013728.1 (SMESG000013728.1)

HSP 1 Score: 244.973 bits (624), Expect = 2.366e-80
Identity = 133/193 (68.91%), Postives = 134/193 (69.43%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDD 672
            MD EQIELLEEFVDLCQI+PSILQL                                                  VIEGDIVSEDQYMGDDSIEVTEEMQDAAD KKNEAID  REGNYAEAV LLTEAIKLNPIYAMLYAKRAS YVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIAN  LGKWIQSY D
Sbjct:    1 MDNEQIELLEEFVDLCQIQPSILQL--------------------------------------------------VIEGDIVSEDQYMGDDSIEVTEEMQDAADEKKNEAIDTLREGNYAEAVNLLTEAIKLNPIYAMLYAKRASFYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANNFLGKWIQSYYD 143          
BLAST of ST13 Hsp70 interacting protein vs. Planmine SMEST
Match: SMESG000014790.1 (SMESG000014790.1)

HSP 1 Score: 240.35 bits (612), Expect = 5.666e-78
Identity = 136/218 (62.39%), Postives = 140/218 (64.22%), Query Frame = 1
Query:   94 MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEHKNEPMHXXXXXXXXXXXXXXXXXXGVIEGDIVSEDQYMGDDSIEVTEEMQDAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKLLCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKLDYSDDAYEQMKDVEPKAK 747
            MD EQIELLEEFVDLCQI+ SILQL                                                  VIE DI+SEDQ+M DDSIEVTEEMQ                GNYA+A TLLTE IKLNPIYAMLYAKRASCYVKLLC NAAIKDSNKSL LNPDSALAYKFRGIANKL GKWIQSY D NLSLKLDYSDDAYEQ KDVEPKAK
Sbjct:    1 MDYEQIELLEEFVDLCQIQSSILQL--------------------------------------------------VIECDILSEDQFMWDDSIEVTEEMQ----------------GNYAKAATLLTETIKLNPIYAMLYAKRASCYVKLLCSNAAIKDSNKSLALNPDSALAYKFRGIANKLFGKWIQSYYDSNLSLKLDYSDDAYEQRKDVEPKAK 152          
The following BLAST results are available for this feature:
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ST132.265e-5145.26ST13 Hsp70 interacting protein [Source:HGNC Symbol... [more]
ST136.192e-4544.98ST13 Hsp70 interacting protein [Source:HGNC Symbol... [more]
ST138.592e-4052.67ST13 Hsp70 interacting protein [Source:HGNC Symbol... [more]
ST131.291e-3254.87ST13 Hsp70 interacting protein [Source:HGNC Symbol... [more]
STIP17.404e-1035.92stress induced phosphoprotein 1 [Source:HGNC Symbo... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hip-16.386e-4241.13Hsp-70 Interacting Protein homolog [Source:UniPro... [more]
hip-16.386e-4241.13Hsp-70 Interacting Protein homolog [Source:UniPro... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HIP-R7.335e-2733.75gene:FBgn0029676 transcript:FBtr0070597[more]
HIP-R7.335e-2733.75gene:FBgn0029676 transcript:FBtr0070598[more]
HIP-R7.335e-2733.75gene:FBgn0029676 transcript:FBtr0333764[more]
HIP7.335e-2733.75gene:FBgn0260484 transcript:FBtr0070600[more]
Tpr21.030e-637.50gene:FBgn0032586 transcript:FBtr0080866[more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
st132.964e-5147.66ST13 Hsp70 interacting protein [Source:ZFIN;Acc:ZD... [more]
ppp5c1.038e-829.81protein phosphatase 5, catalytic subunit [Source:Z... [more]
sgtb1.648e-832.48small glutamine-rich tetratricopeptide repeat (TPR... [more]
stip11.670e-834.65stress-induced phosphoprotein 1 [Source:ZFIN;Acc:Z... [more]
zgc:1230108.386e-833.33zgc:123010 [Source:ZFIN;Acc:ZDB-GENE-051120-15][more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
st132.113e-5750.43ST13, Hsp70 interacting protein [Source:NCBI gene;... [more]
st132.315e-5750.43ST13, Hsp70 interacting protein [Source:NCBI gene;... [more]
st133.330e-5450.91ST13, Hsp70 interacting protein [Source:NCBI gene;... [more]
st131.223e-5143.04ST13, Hsp70 interacting protein [Source:NCBI gene;... [more]
stip11.014e-833.66stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
St138.169e-5446.85suppression of tumorigenicity 13 [Source:MGI Symbo... [more]
St131.204e-5144.59suppression of tumorigenicity 13 [Source:MGI Symbo... [more]
St131.145e-1854.88suppression of tumorigenicity 13 [Source:MGI Symbo... [more]
Stip16.382e-1035.92stress-induced phosphoprotein 1 [Source:MGI Symbol... [more]
Sgtb2.442e-833.96small glutamine-rich tetratricopeptide repeat (TPR... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZLF0|F10A1_CHICK2.345e-5348.71Hsc70-interacting protein OS=Gallus gallus OX=9031... [more]
sp|Q5RF31|F10A1_PONAB5.323e-5145.69Hsc70-interacting protein OS=Pongo abelii OX=9601 ... [more]
sp|P50503|F10A1_RAT7.583e-5144.59Hsc70-interacting protein OS=Rattus norvegicus OX=... [more]
sp|Q99L47|F10A1_MOUSE8.424e-5144.59Hsc70-interacting protein OS=Mus musculus OX=10090... [more]
sp|P50502|F10A1_HUMAN1.088e-5045.26Hsc70-interacting protein OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7FQH74.517e-6253.54Hsc70-interacting protein OS=Clonorchis sinensis O... [more]
A0A4S2LD239.362e-6252.65TPR_REGION domain-containing protein OS=Opisthorch... [more]
A0A3B3RHB73.366e-6046.18TPR_REGION domain-containing protein OS=Paramormyr... [more]
A0A5J4NKI81.744e-5950.00Suppressor of tumorigenicity protein 13 OS=Paragon... [more]
A0A3B3RHY22.505e-5944.01TPR_REGION domain-containing protein OS=Paramormyr... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
st133.326e-4543.29ST13 Hsp70 interacting protein [Source:ZFIN;Acc:ZD... [more]
ppp5c5.688e-929.63protein phosphatase 5 catalytic subunit [Source:NC... [more]
stip17.071e-934.82stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
stip18.190e-934.82stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
dnaaf41.491e-736.63dynein axonemal assembly factor 4 [Source:NCBI gen... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000005301.18.497e-5244.84pep scaffold:Pmarinus_7.0:GL479298:6911:18901:-1 g... [more]
sgta1.612e-730.85small glutamine-rich tetratricopeptide repeat (TPR... [more]
ENSPMAT00000002911.12.270e-633.33pep scaffold:Pmarinus_7.0:GL478619:21387:64649:1 g... [more]
stip12.437e-630.68stress-induced phosphoprotein 1 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
STI11.346e-629.36Hsp90 cochaperone; regulates spatial organization ... [more]
TOM711.757e-631.43Mitochondrial outer membrane protein; probable min... [more]
TOM706.335e-631.93Component of the TOM (translocase of outer membran... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO497491.221e-5245.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312073.511e-835.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314749.882e-636.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
st135.738e-5548.03ST13 Hsp70 interacting protein [Source:NCBI gene;A... [more]
stip15.778e-1037.11stress induced phosphoprotein 1 [Source:NCBI gene;... [more]
sgta2.907e-929.55small glutamine rich tetratricopeptide repeat cont... [more]
sgta3.351e-929.55small glutamine rich tetratricopeptide repeat cont... [more]
ppp5c8.997e-931.82protein phosphatase 5 catalytic subunit [Source:NC... [more]
back to top
BLAST of ST13 Hsp70 interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060756.11.577e-9269.72SMESG000060756.1[more]
SMESG000078709.13.250e-8667.79SMESG000078709.1[more]
SMESG000041826.14.582e-8566.06SMESG000041826.1[more]
SMESG000013728.12.366e-8068.91SMESG000013728.1[more]
SMESG000014790.15.666e-7862.39SMESG000014790.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008579 ID=SMED30008579|Name=ST13 Hsp70 interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1296bp
GAAAACTCTAATATTTGTTTAACTATACTTCAAATTAAGTCATTTTATTT
TATTTTCAAACTGATTTTGAGTTGTAATTAAATACATACTAAAATGGATA
AAGAACAAATAGAATTATTGGAAGAATTTGTTGATCTTTGCCAAATCAAG
CCATCTATTTTACAATTAGATGAATTAAAATTCTTTAGAGATTGGCTACT
TAGCATGGGAGCTACTATTCCTACTGAAAAAAATCCTGAACATAAAAATG
AACCAATGCATGAAGAGCCAGTCAAAGAAGAAAGTGAAGAATCTGATTTA
GAGATTTCAATGGAAGGAGTTATTGAAGGTGACATTGTGTCAGAAGATCA
GTATATGGGGGATGATTCTATTGAGGTTACTGAAGAGATGCAGGATGCAG
CTGATGCGAAAAAGAACGAAGCAATAGATAAATTTAGAGAGGGAAATTAT
GCTGAAGCTGTTACTTTGCTAACCGAAGCAATTAAGCTTAATCCTATTTA
TGCAATGCTCTATGCTAAAAGAGCAAGTTGCTATGTTAAATTACTCTGTC
CAAATGCAGCTATTAAAGATTCAAATAAAAGCCTTGAATTGAATCCGGAT
TCCGCTCTTGCTTATAAGTTCAGGGGAATAGCAAACAAATTGTTGGGCAA
ATGGATCCAATCCTACGATGATTTGAATCTTTCTTTGAAATTAGATTACT
CTGATGATGCATATGAACAGATGAAAGATGTTGAACCAAAAGCTAAATTA
ATTCGTGAGCATAAGCGAAAATATGAGCGTAAGAAAGAAGAAAAGAAACT
ACAAGAACGACAGGAAAGAGTTCGTAAAGCTCAAGAAGAGCATGAAAAGG
CTAAGAAGGCAAGTTCTCATCAACACCAGCATCAACATGGTGATGGATGT
GGTGAAGGTGCCGGTTTCGGGGGAATGCCGGGAGGTCTTGGAGATTTGCT
TAATGATCCAGAACTAGTTGAAGATTTGAAAGATCCTGAAGTGATGAAAG
CTTTGACTGAAATAATAACCAATCCTGCAGCGTTAATGAAGTACCACAAT
AATCCCAAAATTGCCAAGCTAATCCAAAAAATGCAAAGCAAATTCGGTGA
AGGGGCTGGTCCAATGAATTTTGATGAGCCGACTCCACCAACTAAGCCAG
CTGCCACATGTGACGATTTGGACTAGACTTGGAGAATTGGATGTGTTATT
TGGTTATTATGTAATTGTGGGATTTCAAATAAATTTGATTACGCAACTTG
TTTATATTGTCATTACTCACAGTTTATATTAATGTTTCTTATTTTA
back to top

protein sequence of SMED30008579-orf-1

>SMED30008579-orf-1 ID=SMED30008579-orf-1|Name=SMED30008579-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MDKEQIELLEEFVDLCQIKPSILQLDELKFFRDWLLSMGATIPTEKNPEH
KNEPMHEEPVKEESEESDLEISMEGVIEGDIVSEDQYMGDDSIEVTEEMQ
DAADAKKNEAIDKFREGNYAEAVTLLTEAIKLNPIYAMLYAKRASCYVKL
LCPNAAIKDSNKSLELNPDSALAYKFRGIANKLLGKWIQSYDDLNLSLKL
DYSDDAYEQMKDVEPKAKLIREHKRKYERKKEEKKLQERQERVRKAQEEH
EKAKKASSHQHQHQHGDGCGEGAGFGGMPGGLGDLLNDPELVEDLKDPEV
MKALTEIITNPAALMKYHNNPKIAKLIQKMQSKFGEGAGPMNFDEPTPPT
KPAATCDDLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000120progenitor cell
PLANA:0000240body wall musculature
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041243STI1
IPR006636STI1_HS-bd
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 80..119
NoneNo IPR availableGENE3DG3DSA:1.10.260.100coord: 145..202
e-value: 3.6E-19
score: 70.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 88..129
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 200..223
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 88..130
NoneNo IPR availablePANTHERPTHR45883:SF2HSC70-INTERACTING PROTEINcoord: 1..199
NoneNo IPR availablePANTHERPTHR45883FAMILY NOT NAMEDcoord: 1..199
IPR006636Heat shock chaperonin-bindingSMARTSM00727CBMcoord: 151..190
e-value: 6.2E-5
score: 32.4
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 1..100
e-value: 5.3E-29
score: 103.0
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 2..75
IPR041243STI1 domainPFAMPF17830STI1coord: 142..193
e-value: 4.9E-12
score: 45.6
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 1..67
score: 9.429