Titin

Overview
NameTitin
Smed IDSMED30008578
Length (bp)2486
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Titin (SMED30008578) t-SNE clustered cells

Violin plots show distribution of expression levels for Titin (SMED30008578) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Titin (SMED30008578) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Titin (SMED30008578) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008578

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30008578h1SMcG0005612 Contig22157uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0005612 Contig22157newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0014116 Contig35425uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0014116 Contig35425newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0014116 Contig22157uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0014116 Contig22157newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30008578h1SMcG0014116 dd_Smed_v4_866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008578h1SMcG0014116 dd_Smed_v4_866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008578h1SMcG0014116 dd_Smed_v4_866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30008578h1SMcG0014116 dd_Smed_v4_866_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0014116 Contig14316newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0014116 Contig14316uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0014116 Contig54279newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0014116 Contig54279uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0014116 Contig35635newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008578h1SMcG0014116 Contig35635uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Titin vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 117.472 bits (293), Expect = 4.902e-26
Identity = 112/399 (28.07%), Postives = 184/399 (46.12%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLD------ESVVLNSHLPQEM--TESIAAIEAS---LNTPKTQ----DIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P FV   E+ +  N  + + L  +V   G+PN  + W K+   +          E  +G A L I  T  +DS  Y+  A N  G D T+   +NV ++      E  ++   +P+     + IAA E     L   + Q    D++     + P F K +  L  L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP+  + +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1556 PMFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRD-TTRCKVNVEVEFAEPEPERKLI---IPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSL-RLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRR 1941          

HSP 2 Score: 78.5666 bits (192), Expect = 5.123e-14
Identity = 100/404 (24.75%), Postives = 154/404 (38.12%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL---------------DIQNTEDVDRSNF---RYXXXXXXXS------LPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGS-----ISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            +V  PE  QV  E        G PA   A  + +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  + P+      + GQ    + RV   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L A E   +   ++ QE    ++ L                  ++ED+D  +    RY     + S       P F  K     V EG P  F  ++   P P++ WF N    IPT ++++    S      S LE +R +        + A N  G A + A+L VI
Sbjct: 3232 YVNAPEPPQVLQELQPVTVQSGKPARFCA--VISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIITPLQDTVTSE-GQPARFQCRV---SGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPES--ILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDSEDIDHKSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNN-RPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVI 3598          

HSP 3 Score: 72.4034 bits (176), Expect = 3.571e-12
Identity = 68/263 (25.86%), Postives = 116/263 (44.11%), Query Frame = 2
Query: 1226 IDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATE----ETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            ++ P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +E    ET     +   E  ++++S D+  T   D S    +      + P+F  KP+   + EG    F  +V G P+P + W  +    +P +    Y    +SY  +   CK+          GE  IVV  +NK GE  A+A+L  + E D+   +K
Sbjct:  936 VEIPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT---DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECKLVISMTFADDAGEYTIVV--RNKHGETSASASL--LEEADYELLMK 1182          

HSP 4 Score: 68.9366 bits (167), Expect = 4.684e-11
Identity = 69/251 (27.49%), Postives = 111/251 (44.22%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQE--MTESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+ TV WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     +    E   TE    +E+      +T  T++         P F+   P +  L  G SV    +V    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   LL   +  ++ KSQ
Sbjct:  942 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITK-PVVQKLVEGGSVVFGCQV--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSAS-ASLLEEADYELLMKSQ 1184          

HSP 5 Score: 58.5362 bits (140), Expect = 7.116e-8
Identity = 65/245 (26.53%), Postives = 96/245 (39.18%), Query Frame = 2
Query:  827 TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSR--FNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            T  P+F + P +  V  EG  A+  A +  +G P   V W++DG  ++  +      SF  G A L I    K +SG YS  A N  G                                          T ++ + A   PP FV+ +  +   QG Q V L+ RV  I   + V++++++G  + +   F I  +     L I     ED+G Y   A N  G+A S    LLV  EE V  K
Sbjct:    3 TQAPTFTQ-PLQSVVVLEGSTATFEAHI--SGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSG--------------------------------------QATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ-VRLQVRVTGI--PTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATST-AELLVQGEEEVPAK 202          

HSP 6 Score: 55.0694 bits (131), Expect = 6.800e-7
Identity = 72/278 (25.90%), Postives = 110/278 (39.57%), Query Frame = 2
Query:  746 PPRFSEPNMQQSFRSSRSGSVAHLD---EITD-PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGS-RFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFG------------------MDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQS 1507
            P  F +PNM      SR G    L    E+ + PP F+     +++    D A     VI  G P   V+WYK+ + +   + ++  S E+G   L I      DS  Y C A N  G                  + + S  TL+ +L E +VL S+      E    +E                  PP+F+K +   Y   G  +     + +        + W+K+G+ L  G RF +     GF  L I  ++  D G+Y C A NK+G A+S
Sbjct: 5351 PFNFVDPNM-----DSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSD-AVFKCSVI--GIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLS-SLMEELVLKSNYTDSFFE-FQVVEG-----------------PPRFIKGISDCYAPIGTAAYF---QCLVRGSPRPTVYWYKDGK-LVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAES 5597          

HSP 7 Score: 53.9138 bits (128), Expect = 1.467e-6
Identity = 39/112 (34.82%), Postives = 52/112 (46.43%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER--GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM 1165
            P F+  P   Q   EG       +V   G+P   V W K GVPL  G R+  S+ +  G   L I  TF +D+GEY+ V +N  G    S S L    D  +++ S   QEM
Sbjct: 1082 PYFITKP-VVQKLVEGGSVVFGCQV--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLE-EADYELLMKSQ--QEM 1187          
BLAST of Titin vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 115.546 bits (288), Expect = 2.206e-25
Identity = 105/401 (26.18%), Postives = 173/401 (43.14%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-----------------LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P FV   E+ +  N  + + L  +V   G+PN  + W K+   +          E  +G A L I  T  +DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+    R  Q       LY+                 L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP+  + +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1556 PMFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTR---CKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHL----RYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRR 1941          

HSP 2 Score: 89.7373 bits (221), Expect = 1.808e-17
Identity = 81/301 (26.91%), Postives = 120/301 (39.87%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS-----------------PSTLNVNLDESVVLNSHL----PQEMTESI----------AAIEASLNTPK------------------TQDIHID------APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + S  ++ S +V  + E   PPSF +  +  +    G P +LT R+   G   + V WY+DGV L       TSF    A L IL T    SG+YSC A N  G   +S                 P +++V   ES     H+    P  +T S             I    NTP                   T D+  D      +   PP+FVK +      + G+S+ LE ++       + + WF+N   L+   ++N+ F    A+L I    +ED+GDY C A N  G A  +
Sbjct: 7398 ENSIGTASSKTVFRIQERQLPPSFARQLKDIE-QTVGLPVTLTCRL--NGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKI--SGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCS 7693          

HSP 3 Score: 88.1965 bits (217), Expect = 5.587e-17
Identity = 103/394 (26.14%), Postives = 155/394 (39.34%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN-LTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTS----------------IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
            +V  PE  QV  E        G PA   A +  +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  + P+      +G Q    + RV   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L        +K +    + Q+  SL +         +F+ E   +  S     I+P++ L V  G   RF  +VSG P+P+IQWF N+ L++PT                 I   YS+ +  Y     CK          A N  GEA   ATL+V P+
Sbjct: 3232 YVNAPEPPQVLQELQPVTVQSGKPARFCAVI--SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIITPLQDTVTSEG-QPARFQCRV---SGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEG-----FSKFEENTSNSQWHVSLSV---------SFKKEPLGQKPSF----IQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHAGQY----SCK----------AANSAGEATCAATLTVTPK 3559          

HSP 4 Score: 83.5741 bits (205), Expect = 1.376e-15
Identity = 84/376 (22.34%), Postives = 143/376 (38.03%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRN 2002
             +GDPA+L  +   +G   +T +W+KDG  L  GS++  S     +IL I+ T K+DSGEY+   +N+ G                               ++ +A +N        +D  I PP F K +  + +++G     ++   I      + I+WFK+ + ++   ++   F    A L+I  +   D+G Y C A NKAG  Q +                            L ++                     P+F  KP +  V      +    V G     I+WF +   +   + + V+ D + + LE    K       +    N +G A + ATL V     F   +K+  P ++LRN
Sbjct: 5835 TQGDPATLQVKF--SGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGR------------------------------SSCKARINV-------LDL-IIPPSFTKKLKKMDSIKGS---FIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCS--------------------------GHLTVKEP-------------------PYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQF---IKKPSPVLVLRN 6119          

HSP 5 Score: 82.8037 bits (203), Expect = 2.576e-15
Identity = 87/377 (23.08%), Postives = 145/377 (38.46%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PPSFV+ P+   V   G   + T+  I  G P  +V W+K    L  G R N S E   A L++       SGEY+C+  N  G                                  +AS  T     ++I AP +   FVK +   Y+++ G+ + LE   T   PI+     + W KNG  +    R NI      AIL+I     ED G Y C+  N +G+   +   L++                                               P+F   ++P+ ++V  G+ A    +++G P   + W+  +  + PT+  K++   +++ L F +  I      +  A+N +GE  A+  L+V
Sbjct: 9015 VREPPSFVQKPDPMDVLT-GTNVTFTS--IVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAG----------------------------------KASCTT----HLYIKAPAK---FVKRL-NDYSIEKGKPLILEGTFTGTPPIS-----VTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP---------------------------------------------PYFVKQLEPVKVSV--GDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTV 9294          

HSP 6 Score: 80.4925 bits (197), Expect = 1.462e-14
Identity = 74/273 (27.11%), Postives = 112/273 (41.03%), Query Frame = 2
Query:  764 PNMQQSF-------RSSRSGSVAHLDE--ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            P++Q SF         + +GS   + E  + +P   ++  E  QV   GDPA+L   V  AG P L  +WYKDG PL A  ++  SF+   A L        DSG+Y+    N  G   +S  T    LD  +                                     P F KP+  + ++  G +  L+ ++       + + WFK+G+ +    R+ I F  G A L+II V   D G++ C A N  G   S+   L+V    + VTK
Sbjct: 5228 PDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQV-TAGDPATLEYTV--AGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVG--SSSCETTFTVLDRDIA------------------------------------PFFTKPLRNVDSVVNG-TCRLDCKI--AGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGA-LIVQEPPSFVTK 5455          

HSP 7 Score: 78.5666 bits (192), Expect = 4.510e-14
Identity = 89/389 (22.88%), Postives = 145/389 (37.28%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFVK PE  +V   G   + T+ +   G P   V W++    L  G R N  FE   A L++       SGEY+CV  NN G    +  T  + + E                                      P  F+K +   ++++ G+S+ LE   T  +PI+     + W K+G  +    + NIV      IL+I+     D G Y C   N+AG+   +V   LV+T E                                           P+F  +++P+   V  G+      +V+G P   + W+  +  + PT   + Y   +++ L F +  I         A+N +G A ++ T+  I E    P   R
Sbjct: 7133 VQEPPSFVKEPEPLEVL-PGKNVTFTSVI--RGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQ---ASCTTRLFVKE--------------------------------------PAAFLKRLSD-HSVEPGKSIILESTYTGTLPIS-----VTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGR---DVCGALVSTLEP------------------------------------------PYFVTELEPLEAAV--GDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTA-SSKTVFRIQERQLPPSFAR 7423          

HSP 8 Score: 77.0258 bits (188), Expect = 1.356e-13
Identity = 75/283 (26.50%), Postives = 125/283 (44.17%), Query Frame = 2
Query:  713 KMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKS 1558
            ++Q+ K N+T       P     F S + G+          P F+K      ++  GD A+L+  VI  G P   +QW+ +GV L   + +   F+     L IL+T  ED GEY+C+A N++G    S + L +N       +     + TE+ +A+  SL         +  P  PP F+K +  +   QG  ++   T V    + +  + WFK  + L     + I+ +  G     +     ED+G Y C A N  G++ +    LLV  E+T +T +
Sbjct: 3788 ELQLSKINETLELLSESPVYPTKFDSEKEGT---------GPIFIKEVSNADISM-GDVATLSVTVI--GIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICS-AYLKIN-------SKGEGHKDTETESAVAKSLE-------KLGGPC-PPHFLKELKPIRCAQGLPAIFEYTVV---GEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGES-TCAAELLVLLEDTDMTDT 4038          

HSP 9 Score: 77.0258 bits (188), Expect = 1.704e-13
Identity = 59/227 (25.99%), Postives = 98/227 (43.17%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +P   V+  +   V  E DP +L   V  AG P L V+W KDG  +     F+ SFE   A   I    K+DSG+Y+   +N+FG      S+ +  L    VL+ ++P   T+ +  ++  L                               G S+H+E +V   +PI+      +WFK+G+ ++   ++ +V       L++  +  EDT +Y C   N AG
Sbjct: 6381 VQEPAQIVEKAKSVDV-TEKDPMTLECVV--AGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGS-----SSCDAYLR---VLDQNIPPSFTKKLTKMDKVL-------------------------------GSSIHMECKVSGSLPIS-----AQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAG 6560          

HSP 10 Score: 74.3294 bits (181), Expect = 1.042e-12
Identity = 94/390 (24.10%), Postives = 141/390 (36.15%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQK-VYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP-------ENDFRPELKRT 1978
            PPSF K         EG+   L  RV  AG   +TV WYK+ + +   S    +F+    +L +      D+G Y+C   N+ G      S L                                 T  I I  P +PP F + +  +  +  G+ V L   V       + I+W K GR +    R +  F  G A+L++  V   D+GDY C A N AG            T ++ VT    P  +    ++        VD   F             F  +P ++ V E   A F+ KV G P P ++W   +   +    +  ++  G  + LE +             A N+ GE  +N  L V         E D R  LK+T
Sbjct: 9492 PPSFTKRLSETVEETEGNSFKLEGRV--AGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAG------SALC--------------------------------TSSIVIKEPKKPPVFDQHLTPV-TVSEGEYVQLSCHV--QGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGS----------DTTKSKVTIKDKPAVAPATKKAA-------VDGRLF-------------FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKT 9808          

HSP 11 Score: 72.7886 bits (177), Expect = 3.001e-12
Identity = 88/399 (22.06%), Postives = 153/399 (38.35%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQK---VYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            RSS    +  LD I  PPSF K   + +  +    + +    I AG   +++QW+KD   ++A  ++  SF    A L+I      DSG Y+C A N  G +Q S                HL      ++      +  P++QD++ +  ++          L  L GG +        P+T     I+WFK+ + L++G   ++  D     L++    + D+G Y C   N  G A S     +              +E  Q+++                                P+ L +  G    F  +++G P+ ++ W+L+   +  T+IQK    + DG ++  +    ++      V  A+N  G A  +  L V     F  ELK
Sbjct: 5903 RSSCKARINVLDLII-PPSFTK---KLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCS---------------GHL------TVKEPPYFVEKPQSQDVNPNTRVQ----------LKALVGGTA--------PMT-----IKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFV--------------KEPPQFIKKPS-----------------------------PV-LVLRNGQSTTFECQITGTPKIRVSWYLDGNEI--TAIQKHGISFIDG-LATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELK 6206          

HSP 12 Score: 72.7886 bits (177), Expect = 3.104e-12
Identity = 67/226 (29.65%), Postives = 85/226 (37.61%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIE--WFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            I D P F+K  E  Q A       L  +V    D  +TV W KDG  L  G  +   FE   A L+I     +DSG Y C A N  G    S +T+ V                                          PP FVK +   Y +  G+S  L  ++      S VI+  WFKN + L+      + F    AILDI  V  ED+G Y C A N  G
Sbjct: 4884 IIDKPHFIKELEPVQSAI-NKKVHLECQV--DEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCS-ATVTVR----------------------------------------EPPSFVKKVDPSYLMLPGESARLHCKL----KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVG 5061          

HSP 13 Score: 71.633 bits (174), Expect = 6.933e-12
Identity = 75/295 (25.42%), Postives = 126/295 (42.71%), Query Frame = 2
Query: 1136 VLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQ--GGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATE----ETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            +  + + +E  E +   EA +         ++ P+ PP  V    GL N+    G+SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +E    ET     +   E  ++++S D+  T   D S    +      + P+F  KP+   + EG    F  +V G P+P + W  +    +P +    Y    +SY  +   CK+          GE  IVV  +NK GE  A+A+L  + E D+   +K
Sbjct:  906 ITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVS---GLKNVTVIEGESVTLECHISGY--PSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT---DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECKLVISMTFADDAGEYTIVV--RNKHGETSASASL--LEEADYELLMK 1182          

HSP 14 Score: 71.633 bits (174), Expect = 7.294e-12
Identity = 89/372 (23.92%), Postives = 130/372 (34.95%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHID--APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +PP FV   E  + A  GD  SL  +V  AG P +TV WYK    L     + T F    A L        DSGEY+C A+N+ G   T+ S     + E       LP      +  IE ++  P T    ++  API+                                   + W+++G  L +       F    A L I+      +G Y C A N  G A S+    L A E         P++S                               P FDIKP+++ V  G  A F   V+G    +I W  +   + P     +   G+  +L   +            A N +G+ + +A LSV
Sbjct: 7321 EPPYFVTELEPLEAAV-GDSVSLQCQV--AGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIG---TASSKTVFRIQE-----RQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQ-----------------------------------VCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSA--RLTARE---------PKKS-------------------------------PFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSV 7604          

HSP 15 Score: 70.8626 bits (172), Expect = 1.067e-11
Identity = 60/232 (25.86%), Postives = 95/232 (40.95%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P + V+ PE  +V   GD  +L   V  AG P L+ +W+KDG  L + +++  SF    + L I+     DSG YS   +N  G D  + S L V+ D +V                                    PP F + +     L  G SV +E +V    PI+     + WF  G  +++G ++          L +  +   D+GDY C A N AG  + +
Sbjct: 8826 VLEPATIVEKPESIKVTT-GDTCTLECTV--AGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTAS-LQVS-DRTV------------------------------------PPSFTRKLKETNGL-SGSSVVMECKVYGSPPIS-----VSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECS 9010          

HSP 16 Score: 70.8626 bits (172), Expect = 1.132e-11
Identity = 98/434 (22.58%), Postives = 163/434 (37.56%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTS--IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFR----KLSTLK-KVAVSPELQNAFRK 2077
            S S   +  +T+PP FVK  E  ++   GD + L  ++  AG P + V W+++   L A  ++  +F    A++ +     EDSG++ C A+N  G   TS ST  V + E  V +S  P  + E++   E SL          +    PP                                 + W+K+ R L +  ++ I        + I+ V + D G+Y C A+N+ G              +T V   +L +                                 P F  K  +LTV  G PA     + G     +QW   +  VI  S  I+  + + +++ L+F + +       +   KN  G     ATL V+            +PA+++    P      +  TL+ KVA +PEL   + K
Sbjct: 6654 SDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKI--AGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAG--STSCST-KVIVKEPPVFSSFPP--IVETLKNAEVSL--------ECELSGTPP-------------------------------FEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGS-------------DTCVCTVKLKEP--------------------------------PRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVE-NVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL------------EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYK 6983          

HSP 17 Score: 69.707 bits (169), Expect = 2.404e-11
Identity = 66/259 (25.48%), Postives = 99/259 (38.22%), Query Frame = 2
Query:  809 AHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQY 1585
             HL  + +PP FV+ P+   V N      L A V   G   +T++W+KD   L +G+  +   +     L++      DSG Y C   N+ G   TS +TL V                                          PPQF+K    +  L+ GQS   E ++       + + W+ +G  +    +  I F  G A   I G   E++G Y C ARN AG A  ++   L   E     +   P E V+Y
Sbjct: 6004 GHLT-VKEPPYFVEKPQSQDV-NPNTRVQLKALV--GGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGT-ATSKATLFVK----------------------------------------EPPQFIKKPSPVLVLRNGQSTTFECQIT--GTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSI--ELKVKEPPTFIRELKPVEVVKY 6213          

HSP 18 Score: 68.1662 bits (165), Expect = 7.591e-11
Identity = 59/243 (24.28%), Postives = 93/243 (38.27%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            S S +    + +PPSFVK  +   +   G+ A L  ++   G P + V W+K+   L+  +     F    AILDI     EDSG YSC A N+ G D  S                      TE +                      PP F+K +     ++G  ++ L+  V         I WFK+ + + +  ++ +   +    L+I    S D G+Y C   N+ G+       LL
Sbjct: 4968 SSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKL--KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCS----------------------TEIVIK-------------------EPPSFIKTLEPADIVRGTNAL-LQCEV--SGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLL 5164          

HSP 19 Score: 68.1662 bits (165), Expect = 7.720e-11
Identity = 57/225 (25.33%), Postives = 87/225 (38.67%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFV-KPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP FVK  E  +VA +G+   L  ++  +G P + V W+++   L    ++N SF    A+L I     EDSG+Y C A N  G D +  + L V                                          PP F  KP P       G  V L+  +       +V  W K+ + + N  +F I        L I+ + + D G+Y C A N+ G
Sbjct: 7604 VKEPPKFVKKLEASKVAKQGESIQLECKI--SGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVG-DASCSTALTVKA----------------------------------------PPVFTQKPSP--VGALKGSDVILQCEISGTPPFEVV--WVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVG 7781          

HSP 20 Score: 68.1662 bits (165), Expect = 7.786e-11
Identity = 53/224 (23.66%), Postives = 90/224 (40.18%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  E  ++  + +      ++   G P + V WYKD   +   S+F  SF    A+L++     EDSG+Y+C A +N     +S ++L V          H               + T K  D+H++                 LQG    H              + W+K+ R L +G ++ I+ +     + I+ V + D G+Y C A N  G
Sbjct: 8545 VQEPPRFIKKLEPSRIVKQDEFTRYECKI--GGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEA-HNAAGSASSSTSLKVKEPPIFRKKPH--------------PIETLKGADVHLEC---------------ELQGTPPFH--------------VSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVG 8722          

HSP 21 Score: 68.1662 bits (165), Expect = 8.191e-11
Identity = 69/251 (27.49%), Postives = 111/251 (44.22%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQE--MTESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+ TV WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     +    E   TE    +E+      +T  T++         P F+   P +  L  G SV    +V    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   LL   +  ++ KSQ
Sbjct:  942 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFIT-KPVVQKLVEGGSVVFGCQV--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSAS-ASLLEEADYELLMKSQ 1184          

HSP 22 Score: 67.0106 bits (162), Expect = 1.844e-10
Identity = 86/375 (22.93%), Postives = 136/375 (36.27%), Query Frame = 2
Query:  923 DPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIH----------------IDAPIRPPQFVKPMPGL----------YNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNE---CL-VIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPEN 1951
            D  + V W  +G  +    R   S       L I      D G YSC+  N+ G ++T+ + L+V      +L+  + QE+   +    +S  + + + +H                 ++P+ P +F     G            ++  G    L   VI I      I+WF NG  L     +  VFD     L I+    ED G+Y C A N  G+   +   L + ++      ++      + L+ L                        PHF  ++KPI     +G PA F   V G P P + WF      C  V  T I      G+    + QR         +  A+N LGE+   A L V+ E+
Sbjct: 3686 DSFIDVTWTHEGAKIEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCG-ERTTSAVLSVEGAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPK--IQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAY-LKINSKGEGHKDTETESAVAKSLEKLG-------------------GPCPPHFLKELKPIRCA--QGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQR---EDSGLYICKAENMLGESTCAAELLVLLED 4032          

HSP 23 Score: 66.2402 bits (160), Expect = 2.936e-10
Identity = 84/392 (21.43%), Postives = 138/392 (35.20%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETR--VIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV----IPENDFRPELKRTD 1981
            + + P F K  +  +V  E D   L A V  AG P   + W+KD   L +G ++ T  +     L IL     D+GEY C   N  G   +S  +  V L E                                      PP F+K +    +L+GG +    T    +PIT     + W K+   +       + F+   A L + G+  +  G Y C A+N AG  + +   LL   E   +T+                                           + +++ V +G+PA   VK SG      +WF +   +   S  K+    ++S L+    +           +N +G +   A ++V    IP + F  +LK+ D
Sbjct: 5633 VKESPYFTKEFKPIEVLKEYD-VMLLAEV--AGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVG---SSICSARVTLRE--------------------------------------PPSFIKKIESTSSLRGGTAAFQATLKGSLPIT-----VTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSA--LLSVKEPATITE-------------------------------------------EAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPS-FTKKLKKMD 5929          

HSP 24 Score: 65.855 bits (159), Expect = 3.596e-10
Identity = 63/234 (26.92%), Postives = 90/234 (38.46%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            I +PP FVK  E  +V+  GD ASL  ++  AG P + V WYK    L   + +   F    A L        DSGEY C A+N+ G  + S ST         V    LP   +  +  ++ ++  P   D  I                    G +         PI+     + W+K+G+PL +       F    A L+I        G Y C A N  G A S+   +L
Sbjct: 9201 ILEPPYFVKQLEPVKVSV-GDSASLQCQL--AGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVG--EVSASTF------LTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAI-------------------SGSE---------PIS-----VSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLIL 9390          

HSP 25 Score: 63.929 bits (154), Expect = 1.578e-9
Identity = 55/206 (26.70%), Postives = 77/206 (37.38%), Query Frame = 2
Query:  881 GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQ 1498
            G P +   R+   G   L V WYKDGV L   +   TSF    A L IL T +   G+Y+C A N  G   T+ S+  + L E  V                                    P F    P   +L  G+S   +  V     + + I W K+ R +  G  + +      A L ++ V   D G Y C+A N AG+
Sbjct: 8374 GFPVAFECRI--NGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLG---TASSSAKLILSEHEV------------------------------------PPFFDLKPVSVDLALGESGTFKCHVT--GTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGK 8536          

HSP 26 Score: 63.1586 bits (152), Expect = 2.251e-9
Identity = 71/319 (22.26%), Postives = 112/319 (35.11%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQW 1771
            L  + +PP F++ P  +  A  G+PA+L  +V   G P + + WYK+   L +   +   F+   A L I      D GEYSC A N+ G            +  S VL                            I A   PP F + +  ++   G   V  E R+       L + W+K+G  L +       F    A L I+       G Y C A N  G A S+         + ++++ ++P                                  P FD+KP+++ +  G    F   V+G    +I W
Sbjct: 8257 LVSVLEPPYFIE-PLEHVEAVIGEPATLQCKV--DGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGA-----------VASSAVLV---------------------------IKARKLPPFFARKLKDVHETLGF-PVAFECRI--NGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSA--------KLILSEHEVP----------------------------------PFFDLKPVSVDLALGESGTFKCHVTGTAPIKITW 8489          

HSP 27 Score: 63.1586 bits (152), Expect = 2.348e-9
Identity = 54/228 (23.68%), Postives = 86/228 (37.72%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +P +FV+  E  Q+  +GD   L  +V   G P + + W+ +   +   S+   SF    A+L +     EDSGEY C A+N  G D  S          S+V+    P   T+    IE      K  D+ + A +   PP                                 I WFK+   L +G ++          L I+  ++ D G+Y C   N+ G +
Sbjct: 5539 VKEPATFVEKLEPSQLLKKGDATQLACKV--TGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCS----------SIVIVKESPY-FTKEFKPIEVL----KEYDVMLLAEVAGTPP-------------------------------FEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSS 5718          

HSP 28 Score: 62.003 bits (149), Expect = 5.066e-9
Identity = 89/392 (22.70%), Postives = 148/392 (37.76%), Query Frame = 2
Query:  779 SFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNG---RPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGES-FIVVSAKNKLGEAVANATLSV 1939
            + RS +  SVA +   +     V     + V  EG       + I   D +  V WY     L    ++  ++E G AIL +    K D G Y C   N++G D +        + E  V + +  + M +    I+   +T +  +       RPP+F  P   LYN       ++   V         + W+K+G   +P +N  ++    D+G   L I  V ++D  +Y   ARNK G+             +  VT    P +                  S  R          P F     N   +EG    F ++VSG P P ++W  + + L +  +I+ ++ +G   Y    R  +P ++ +  V+A N  G     A L V
Sbjct: 34116 AIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCK-IENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVRE--VYDYYCRRTMKK----IKRRTDTMRLLE-------RPPEFTLP---LYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKA--------KLTVTLHPPPTD------------------STLR----------PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIH-EGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 34453          

HSP 29 Score: 60.8474 bits (146), Expect = 1.283e-8
Identity = 60/213 (28.17%), Postives = 85/213 (39.91%), Query Frame = 2
Query:  926 PNLTVQWYKDGVPLAAG---SRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAG----QAQSNVVRLLVATEE 1540
            P   V WYK G  +  G    ++    ++G   L I     +D  EY+ VA+N +G D                             A +  +L+ P T     D+ +RP    K +      Q GQSV  E RV  I   +L  +W K+G+PL+ G    I+ +   +  L I   + EDTG Y   A N AG    QA   V RL    +E
Sbjct: 34285 PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCK--------------------------AKLTVTLHPPPT-----DSTLRP--MFKRLLANAECQEGQSVCFEIRVSGIPPPTL--KWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQE 34462          

HSP 30 Score: 60.8474 bits (146), Expect = 1.338e-8
Identity = 50/229 (21.83%), Postives = 82/229 (35.81%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +PP F+K P    V   G   +   ++   G P + V WY DG  + A  +   SF  G A   I     E+SG Y C A+N+ G   T+  ++ + + E                                      PP F++ +  +  ++    V LE  V         + W KN R + +  ++ +        L I      DTG+Y C   N+ G    +
Sbjct: 6101 VKEPPQFIKKPSPVLVLRNGQSTTFECQI--TGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAG---TASCSIELKVKE--------------------------------------PPTFIRELKPVEVVKYSD-VELECEV--TGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCS 6283          

HSP 31 Score: 60.4622 bits (145), Expect = 1.739e-8
Identity = 61/253 (24.11%), Postives = 88/253 (34.78%), Query Frame = 2
Query:  881 GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRS 1630
            G+ A     V   G   + V W KD   + +G ++  S+    A L +L   K DSG+Y+C A N  G D     T  +N+ E ++                                   PP F K +        G S  LE RV    PIT     + W+KN   +       I F     +L +      D G Y C   N AG A        + T   V+ + + P    Q+L  + +   E V  S
Sbjct: 9411 GESADFECHV--TGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDS---CTAQLNIKERLI-----------------------------------PPSFTKRLSETVEETEGNSFKLEGRVAGSQPIT-----VAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSA--------LCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLS 9610          

HSP 32 Score: 59.3066 bits (142), Expect = 4.222e-8
Identity = 64/244 (26.23%), Postives = 97/244 (39.75%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----------IEWFK-NGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            + E   PP F +H     V+ EG+   L+  V   G   + +QW K G  +    R + SF  G A+L++    K DSG+Y C A N  G D T+ S + +    +V                       P T+   +D              L+ +   QS+    RV+  T ++ +          ++W K   R LN G R  I      A L+I      D+G Y C A N+ G+ +SNV
Sbjct: 9583 IKEPKKPPVFDQHLTPVTVS-EGEYVQLSCHV--QGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSD-TTKSKVTIKDKPAVA----------------------PATKKAAVDG------------RLFFVSEPQSI----RVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNV 9784          

HSP 33 Score: 59.3066 bits (142), Expect = 4.258e-8
Identity = 56/244 (22.95%), Postives = 91/244 (37.30%), Query Frame = 2
Query:  779 SFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            S  + ++    HL  I  P  FVK    Y +  +G P  L       G P ++V W K+G+ +    R N +     AIL+I  +  ED+G+Y+C  +N  G D  S   L                                          + PP FVK +  +  +  G S  L+ ++    +  + + W+K    L     + + F    A L    V   D+G+Y C A N  G+  ++
Sbjct: 9094 SNEAGKASCTTHL-YIKAPAKFVKRLNDYSI-EKGKPLILEGTF--TGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI-----------------------------------------LEPPYFVKQLEPV-KVSVGDSASLQCQLAGTPE--IGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSAS 9289          

HSP 34 Score: 56.225 bits (134), Expect = 3.021e-7
Identity = 65/245 (26.53%), Postives = 96/245 (39.18%), Query Frame = 2
Query:  827 TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSR--FNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            T  P+F   P +  V  EG  A+  A +  +G P   V W++DG  ++  +      SF  G A L I    K +SG YS  A N  G   +                                      T ++ + A   PP FV+ +  +   QG Q V L+ RV  I   + V++++++G  + +   F I  +     L I     ED+G Y   A N  G+A S    LLV  EE V  K
Sbjct:    3 TQAPTFT-QPLQSVVVLEGSTATFEAHI--SGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATS--------------------------------------TAELLVKAETAPPNFVQRLQSMTVRQGSQ-VRLQVRVTGI--PTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATST-AELLVQGEEEVPAK 202          

HSP 35 Score: 55.0694 bits (131), Expect = 8.535e-7
Identity = 79/392 (20.15%), Postives = 146/392 (37.24%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNV---NLDESVVLN---SHLPQEMTESIAAIEASLN---------------------TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----IEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            R     EG+ A  +      G+P  TV W + G  L+  +R   +  +  +  +I      D G YS V +N+ G  Q +  TL +    + E  V +      P+   +S  A+++                        T K Q + + AP +  QF+K           ++     ++  + +SS++    + W+K+G+ L     F   +   G   L I  +   D G+Y C    + G +++N+  +  A +      S++ +      +  D + TE         +  E   S P       + TV   + A+F VK +G PRP   W  +   +      K+  D    +LE  +           + KN  G   ++  L++
Sbjct: 35136 RSMTVYEGESARFSCDT--DGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEG-KQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLK----------AEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISE-----TKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 35509          

HSP 36 Score: 53.9138 bits (128), Expect = 1.779e-6
Identity = 39/112 (34.82%), Postives = 52/112 (46.43%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER--GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM 1165
            P F+  P   Q   EG       +V   G+P   V W K GVPL  G R+  S+ +  G   L I  TF +D+GEY+ V +N  G    S S L    D  +++ S   QEM
Sbjct: 1082 PYFITKP-VVQKLVEGGSVVFGCQV--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLE-EADYELLMKSQ--QEM 1187          
BLAST of Titin vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 115.546 bits (288), Expect = 2.583e-25
Identity = 105/401 (26.18%), Postives = 173/401 (43.14%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-----------------LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P FV   E+ +  N  + + L  +V   G+PN  + W K+   +          E  +G A L I  T  +DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+    R  Q       LY+                 L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP+  + +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1510 PMFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTR---CKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHL----RYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRR 1895          

HSP 2 Score: 87.4261 bits (215), Expect = 9.910e-17
Identity = 103/394 (26.14%), Postives = 155/394 (39.34%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN-LTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTS----------------IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
            +V  PE  QV  E        G PA   A +  +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  + P+      +G Q    + RV   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L        +K +    + Q+  SL +         +F+ E   +  S     I+P++ L V  G   RF  +VSG P+P+IQWF N+ L++PT                 I   YS+ +  Y     CK          A N  GEA   ATL+V P+
Sbjct: 3186 YVNAPEPPQVLQELQPVTVQSGKPARFCAVI--SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIITPLQDTVTSEG-QPARFQCRV---SGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEG-----FSKFEENTSNSQWHVSLSV---------SFKKEPLGQKPSF----IQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHAGQY----SCK----------AANSAGEATCAATLTVTPK 3513          

HSP 3 Score: 77.0258 bits (188), Expect = 1.656e-13
Identity = 75/283 (26.50%), Postives = 125/283 (44.17%), Query Frame = 2
Query:  713 KMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKS 1558
            ++Q+ K N+T       P     F S + G+          P F+K      ++  GD A+L+  VI  G P   +QW+ +GV L   + +   F+     L IL+T  ED GEY+C+A N++G    S + L +N       +     + TE+ +A+  SL         +  P  PP F+K +  +   QG  ++   T V    + +  + WFK  + L     + I+ +  G     +     ED+G Y C A N  G++ +    LLV  E+T +T +
Sbjct: 3550 ELQLSKINETLELLSESPVYPTKFDSEKEGT---------GPIFIKEVSNADISM-GDVATLSVTVI--GIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICS-AYLKIN-------SKGEGHKDTETESAVAKSLE-------KLGGPC-PPHFLKELKPIRCAQGLPAIFEYTVV---GEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGES-TCAAELLVLLEDTDMTDT 3800          

HSP 4 Score: 71.633 bits (174), Expect = 6.039e-12
Identity = 72/293 (24.57%), Postives = 126/293 (43.00%), Query Frame = 2
Query: 1136 VLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATE----ETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            +  + + +E  E +   EA +         ++ P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +E    ET     +   E  ++++S D+  T   D S    +      + P+F  KP+   + EG    F  +V G P+P + W  +    +P +    Y    +SY  +   CK+          GE  IVV  +NK GE  A+A+L  + E D+   +K
Sbjct:  860 ITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT---DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECKLVISMTFADDAGEYTIVV--RNKHGETSASASL--LEEADYELLMK 1136          

HSP 5 Score: 67.781 bits (164), Expect = 1.098e-10
Identity = 69/251 (27.49%), Postives = 111/251 (44.22%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQE--MTESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+ TV WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     +    E   TE    +E+      +T  T++         P F+   P +  L  G SV    +V    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   LL   +  ++ KSQ
Sbjct:  896 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFIT-KPVVQKLVEGGSVVFGCQV--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSAS-ASLLEEADYELLMKSQ 1138          

HSP 6 Score: 62.003 bits (149), Expect = 5.272e-9
Identity = 89/392 (22.70%), Postives = 148/392 (37.76%), Query Frame = 2
Query:  779 SFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNG---RPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGES-FIVVSAKNKLGEAVANATLSV 1939
            + RS +  SVA +   +     V     + V  EG       + I   D +  V WY     L    ++  ++E G AIL +    K D G Y C   N++G D +        + E  V + +  + M +    I+   +T +  +       RPP+F  P   LYN       ++   V         + W+K+G   +P +N  ++    D+G   L I  V ++D  +Y   ARNK G+             +  VT    P +                  S  R          P F     N   +EG    F ++VSG P P ++W  + + L +  +I+ ++ +G   Y    R  +P ++ +  V+A N  G     A L V
Sbjct: 25176 AIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCK-IENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVRE--VYDYYCRRTMKK----IKRRTDTMRLLE-------RPPEFTLP---LYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKA--------KLTVTLHPPPTD------------------STLR----------PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIH-EGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 25513          

HSP 7 Score: 60.077 bits (144), Expect = 2.217e-8
Identity = 60/213 (28.17%), Postives = 85/213 (39.91%), Query Frame = 2
Query:  926 PNLTVQWYKDGVPLAAG---SRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAG----QAQSNVVRLLVATEE 1540
            P   V WYK G  +  G    ++    ++G   L I     +D  EY+ VA+N +G D                             A +  +L+ P T     D+ +RP    K +      Q GQSV  E RV  I   +L  +W K+G+PL+ G    I+ +   +  L I   + EDTG Y   A N AG    QA   V RL    +E
Sbjct: 25345 PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCK--------------------------AKLTVTLHPPPT-----DSTLRP--MFKRLLANAECQEGQSVCFEIRVSGIPPPTL--KWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQE 25522          

HSP 8 Score: 55.8398 bits (133), Expect = 4.560e-7
Identity = 65/245 (26.53%), Postives = 97/245 (39.59%), Query Frame = 2
Query:  827 TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSR--FNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            T  P+F + P +  V  EG  A+  A +  +G P   V W++DG  ++  +      SF  G A L I    K +SG YS  A N  G   +                                      T ++ + A   PP FV+ +  +   QG Q V L+ RV  I   + V++++++G  + +   F I  +     L I     ED+G Y   A N  G+A S    LLV  EE V  K
Sbjct:    3 TQAPTFTQ-PLQSVVVLEGSTATFEAHI--SGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATS--------------------------------------TAELLVKAETAPPNFVQRLQSMTVRQGSQ-VRLQVRVTGI--PTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATST-AELLVQGEEEVPAK 202          

HSP 9 Score: 54.6842 bits (130), Expect = 1.107e-6
Identity = 79/392 (20.15%), Postives = 146/392 (37.24%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNV---NLDESVVLN---SHLPQEMTESIAAIEASLN---------------------TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----IEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            R     EG+ A  +      G+P  TV W + G  L+  +R   +  +  +  +I      D G YS V +N+ G  Q +  TL +    + E  V +      P+   +S  A+++                        T K Q + + AP +  QF+K           ++     ++  + +SS++    + W+K+G+ L     F   +   G   L I  +   D G+Y C    + G +++N+  +  A +      S++ +      +  D + TE         +  E   S P       + TV   + A+F VK +G PRP   W  +   +      K+  D    +LE  +           + KN  G   ++  L++
Sbjct: 26196 RSMTVYEGESARFSCDT--DGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEG-KQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLK----------AEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISE-----TKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 26569          

HSP 10 Score: 53.5286 bits (127), Expect = 2.175e-6
Identity = 39/112 (34.82%), Postives = 52/112 (46.43%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER--GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM 1165
            P F+  P   Q   EG       +V   G+P   V W K GVPL  G R+  S+ +  G   L I  TF +D+GEY+ V +N  G    S S L    D  +++ S   QEM
Sbjct: 1036 PYFITKP-VVQKLVEGGSVVFGCQV--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLE-EADYELLMKSQ--QEM 1141          
BLAST of Titin vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 115.546 bits (288), Expect = 2.683e-25
Identity = 105/401 (26.18%), Postives = 173/401 (43.14%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-----------------LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P FV   E+ +  N  + + L  +V   G+PN  + W K+   +          E  +G A L I  T  +DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+    R  Q       LY+                 L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP+  + +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1556 PMFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTR---CKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHL----RYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRR 1941          

HSP 2 Score: 89.7373 bits (221), Expect = 2.124e-17
Identity = 81/301 (26.91%), Postives = 120/301 (39.87%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS-----------------PSTLNVNLDESVVLNSHL----PQEMTESI----------AAIEASLNTPK------------------TQDIHID------APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + S  ++ S +V  + E   PPSF +  +  +    G P +LT R+   G   + V WY+DGV L       TSF    A L IL T    SG+YSC A N  G   +S                 P +++V   ES     H+    P  +T S             I    NTP                   T D+  D      +   PP+FVK +      + G+S+ LE ++       + + WF+N   L+   ++N+ F    A+L I    +ED+GDY C A N  G A  +
Sbjct: 7081 ENSIGTASSKTVFRIQERQLPPSFARQLKDIE-QTVGLPVTLTCRL--NGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKI--SGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCS 7376          

HSP 3 Score: 83.9593 bits (206), Expect = 1.005e-15
Identity = 97/395 (24.56%), Postives = 151/395 (38.23%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK--SQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL--------PHFD----------IKPI-NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +V  PE  QV  E        G PA   A +  +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  + P+      + GQ    + RV   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L A E  +  +   ++  E  ++  S      E +  +  +  +  E   L          FD          IK + N  +  G+ A   V V G P+P+IQWF N  L+ P++  K   DG    L     K+  E      A N  G+ + +A L +
Sbjct: 3232 YVNAPEPPQVLQELQPVTVQSGKPARFCAVI--SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIITPLQDTVTSE-GQPARFQCRV---SGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3592          

HSP 4 Score: 83.1889 bits (204), Expect = 1.744e-15
Identity = 84/376 (22.34%), Postives = 143/376 (38.03%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRN 2002
             +GDPA+L  +   +G   +T +W+KDG  L  GS++  S     +IL I+ T K+DSGEY+   +N+ G                               ++ +A +N        +D  I PP F K +  + +++G     ++   I      + I+WFK+ + ++   ++   F    A L+I  +   D+G Y C A NKAG  Q +                            L ++                     P+F  KP +  V      +    V G     I+WF +   +   + + V+ D + + LE    K       +    N +G A + ATL V     F   +K+  P ++LRN
Sbjct: 5518 TQGDPATLQVKF--SGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGR------------------------------SSCKARINV-------LDL-IIPPSFTKKLKKMDSIKGS---FIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCS--------------------------GHLTVKEP-------------------PYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQF---IKKPSPVLVLRN 5802          

HSP 5 Score: 82.4185 bits (202), Expect = 3.102e-15
Identity = 87/377 (23.08%), Postives = 145/377 (38.46%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PPSFV+ P+   V   G   + T+  I  G P  +V W+K    L  G R N S E   A L++       SGEY+C+  N  G                                  +AS  T     ++I AP +   FVK +   Y+++ G+ + LE   T   PI+     + W KNG  +    R NI      AIL+I     ED G Y C+  N +G+   +   L++                                               P+F   ++P+ ++V  G+ A    +++G P   + W+  +  + PT+  K++   +++ L F +  I      +  A+N +GE  A+  L+V
Sbjct: 8698 VREPPSFVQKPDPMDVLT-GTNVTFTS--IVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAG----------------------------------KASCTT----HLYIKAPAK---FVKRL-NDYSIEKGKPLILEGTFTGTPPIS-----VTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP---------------------------------------------PYFVKQLEPVKVSV--GDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTV 8977          

HSP 6 Score: 79.7221 bits (195), Expect = 2.000e-14
Identity = 74/273 (27.11%), Postives = 112/273 (41.03%), Query Frame = 2
Query:  764 PNMQQSF-------RSSRSGSVAHLDE--ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            P++Q SF         + +GS   + E  + +P   ++  E  QV   GDPA+L   V  AG P L  +WYKDG PL A  ++  SF+   A L        DSG+Y+    N  G   +S  T    LD  +                                     P F KP+  + ++  G +  L+ ++       + + WFK+G+ +    R+ I F  G A L+II V   D G++ C A N  G   S+   L+V    + VTK
Sbjct: 4911 PDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQV-TAGDPATLEYTV--AGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVG--SSSCETTFTVLDRDIA------------------------------------PFFTKPLRNVDSVVNG-TCRLDCKI--AGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGA-LIVQEPPSFVTK 5138          

HSP 7 Score: 78.5666 bits (192), Expect = 4.703e-14
Identity = 89/389 (22.88%), Postives = 145/389 (37.28%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFVK PE  +V   G   + T+ +   G P   V W++    L  G R N  FE   A L++       SGEY+CV  NN G    +  T  + + E                                      P  F+K +   ++++ G+S+ LE   T  +PI+     + W K+G  +    + NIV      IL+I+     D G Y C   N+AG+   +V   LV+T E                                           P+F  +++P+   V  G+      +V+G P   + W+  +  + PT   + Y   +++ L F +  I         A+N +G A ++ T+  I E    P   R
Sbjct: 6816 VQEPPSFVKEPEPLEVL-PGKNVTFTSVI--RGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQ---ASCTTRLFVKE--------------------------------------PAAFLKRLSD-HSVEPGKSIILESTYTGTLPIS-----VTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGR---DVCGALVSTLEP------------------------------------------PYFVTELEPLEAAV--GDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTA-SSKTVFRIQERQLPPSFAR 7106          

HSP 8 Score: 77.0258 bits (188), Expect = 1.513e-13
Identity = 75/283 (26.50%), Postives = 125/283 (44.17%), Query Frame = 2
Query:  713 KMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKS 1558
            ++Q+ K N+T       P     F S + G+          P F+K      ++  GD A+L+  VI  G P   +QW+ +GV L   + +   F+     L IL+T  ED GEY+C+A N++G    S + L +N       +     + TE+ +A+  SL         +  P  PP F+K +  +   QG  ++   T V    + +  + WFK  + L     + I+ +  G     +     ED+G Y C A N  G++ +    LLV  E+T +T +
Sbjct: 3471 ELQLSKINETLELLSESPVYPTKFDSEKEGT---------GPIFIKEVSNADISM-GDVATLSVTVI--GIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICS-AYLKIN-------SKGEGHKDTETESAVAKSLE-------KLGGPC-PPHFLKELKPIRCAQGLPAIFEYTVV---GEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGES-TCAAELLVLLEDTDMTDT 3721          

HSP 9 Score: 76.2554 bits (186), Expect = 2.271e-13
Identity = 59/227 (25.99%), Postives = 98/227 (43.17%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +P   V+  +   V  E DP +L   V  AG P L V+W KDG  +     F+ SFE   A   I    K+DSG+Y+   +N+FG      S+ +  L    VL+ ++P   T+ +  ++  L                               G S+H+E +V   +PI+      +WFK+G+ ++   ++ +V       L++  +  EDT +Y C   N AG
Sbjct: 6064 VQEPAQIVEKAKSVDV-TEKDPMTLECVV--AGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGS-----SSCDAYLR---VLDQNIPPSFTKKLTKMDKVL-------------------------------GSSIHMECKVSGSLPIS-----AQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAG 6243          

HSP 10 Score: 74.3294 bits (181), Expect = 1.115e-12
Identity = 94/390 (24.10%), Postives = 141/390 (36.15%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQK-VYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP-------ENDFRPELKRT 1978
            PPSF K         EG+   L  RV  AG   +TV WYK+ + +   S    +F+    +L +      D+G Y+C   N+ G      S L                                 T  I I  P +PP F + +  +  +  G+ V L   V       + I+W K GR +    R +  F  G A+L++  V   D+GDY C A N AG            T ++ VT    P  +    ++        VD   F             F  +P ++ V E   A F+ KV G P P ++W   +   +    +  ++  G  + LE +             A N+ GE  +N  L V         E D R  LK+T
Sbjct: 9175 PPSFTKRLSETVEETEGNSFKLEGRV--AGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAG------SALC--------------------------------TSSIVIKEPKKPPVFDQHLTPV-TVSEGEYVQLSCHV--QGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGS----------DTTKSKVTIKDKPAVAPATKKAA-------VDGRLF-------------FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKT 9491          

HSP 11 Score: 72.4034 bits (176), Expect = 3.552e-12
Identity = 91/400 (22.75%), Postives = 151/400 (37.75%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPI-NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQK---VYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            RSS    +  LD I  PPSF K   + +  +    + +    I AG   +++QW+KD   ++A  ++  SF    A L+I      DSG Y+C A N  G +Q S                HL      ++      +  P++QD++ +  ++          L  L GG +        P+T     I+WFK+ + L++G   ++  D     L++    + D+G Y C   N  G A S           T+  K                                      P F  KP   L +  G    F  +++G P+ ++ W+L+   +  T+IQK    + DG ++  +    ++      V  A+N  G A  +  L V     F  ELK
Sbjct: 5586 RSSCKARINVLDLII-PPSFTK---KLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCS---------------GHL------TVKEPPYFVEKPQSQDVNPNTRVQ----------LKALVGGTA--------PMT-----IKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKA---------TLFVKEP------------------------------------PQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEI--TAIQKHGISFIDG-LATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELK 5889          

HSP 12 Score: 72.4034 bits (176), Expect = 4.389e-12
Identity = 67/226 (29.65%), Postives = 85/226 (37.61%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIE--WFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            I D P F+K  E  Q A       L  +V    D  +TV W KDG  L  G  +   FE   A L+I     +DSG Y C A N  G    S +T+ V                                          PP FVK +   Y +  G+S  L  ++      S VI+  WFKN + L+      + F    AILDI  V  ED+G Y C A N  G
Sbjct: 4567 IIDKPHFIKELEPVQSAI-NKKVHLECQV--DEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCS-ATVTVR----------------------------------------EPPSFVKKVDPSYLMLPGESARLHCKL----KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVG 4744          

HSP 13 Score: 71.633 bits (174), Expect = 6.989e-12
Identity = 72/293 (24.57%), Postives = 126/293 (43.00%), Query Frame = 2
Query: 1136 VLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATE----ETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            +  + + +E  E +   EA +         ++ P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +E    ET     +   E  ++++S D+  T   D S    +      + P+F  KP+   + EG    F  +V G P+P + W  +    +P +    Y    +SY  +   CK+          GE  IVV  +NK GE  A+A+L  + E D+   +K
Sbjct:  906 ITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT---DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECKLVISMTFADDAGEYTIVV--RNKHGETSASASL--LEEADYELLMK 1182          

HSP 14 Score: 71.2478 bits (173), Expect = 8.070e-12
Identity = 89/372 (23.92%), Postives = 130/372 (34.95%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHID--APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +PP FV   E  + A  GD  SL  +V  AG P +TV WYK    L     + T F    A L        DSGEY+C A+N+ G   T+ S     + E       LP      +  IE ++  P T    ++  API+                                   + W+++G  L +       F    A L I+      +G Y C A N  G A S+    L A E         P++S                               P FDIKP+++ V  G  A F   V+G    +I W  +   + P     +   G+  +L   +            A N +G+ + +A LSV
Sbjct: 7004 EPPYFVTELEPLEAAV-GDSVSLQCQV--AGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIG---TASSKTVFRIQE-----RQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQ-----------------------------------VCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSA--RLTARE---------PKKS-------------------------------PFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSV 7287          

HSP 15 Score: 70.8626 bits (172), Expect = 1.201e-11
Identity = 60/232 (25.86%), Postives = 95/232 (40.95%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P + V+ PE  +V   GD  +L   V  AG P L+ +W+KDG  L + +++  SF    + L I+     DSG YS   +N  G D  + S L V+ D +V                                    PP F + +     L  G SV +E +V    PI+     + WF  G  +++G ++          L +  +   D+GDY C A N AG  + +
Sbjct: 8509 VLEPATIVEKPESIKVTT-GDTCTLECTV--AGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTAS-LQVS-DRTV------------------------------------PPSFTRKLKETNGLS-GSSVVMECKVYGSPPIS-----VSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECS 8693          

HSP 16 Score: 70.4774 bits (171), Expect = 1.329e-11
Identity = 98/434 (22.58%), Postives = 163/434 (37.56%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTS--IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFR----KLSTLK-KVAVSPELQNAFRK 2077
            S S   +  +T+PP FVK  E  ++   GD + L  ++  AG P + V W+++   L A  ++  +F    A++ +     EDSG++ C A+N  G   TS ST  V + E  V +S  P  + E++   E SL          +    PP                                 + W+K+ R L +  ++ I        + I+ V + D G+Y C A+N+ G              +T V   +L +                                 P F  K  +LTV  G PA     + G     +QW   +  VI  S  I+  + + +++ L+F + +       +   KN  G     ATL V+            +PA+++    P      +  TL+ KVA +PEL   + K
Sbjct: 6337 SDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKI--AGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAG--STSCST-KVIVKEPPVFSSFPP--IVETLKNAEVSL--------ECELSGTPP-------------------------------FEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGS-------------DTCVCTVKLKEP--------------------------------PRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVE-NVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL------------EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYK 6666          

HSP 17 Score: 69.3218 bits (168), Expect = 3.176e-11
Identity = 69/260 (26.54%), Postives = 101/260 (38.85%), Query Frame = 2
Query:  809 AHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVK-PMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQY 1585
             HL  + +PP FV+ P+   V N      L A V   G   +T++W+KD   L +G+  +   +     L++      DSG Y C   N+ G   TS +TL V                                          PPQF+K P P L  L+ GQS   E ++       + + W+ +G  +    +  I F  G A   I G   E++G Y C ARN AG A  ++   L   E     +   P E V+Y
Sbjct: 5687 GHLT-VKEPPYFVEKPQSQDV-NPNTRVQLKALV--GGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGT-ATSKATLFVK----------------------------------------EPPQFIKKPSPVLV-LRNGQSTTFECQIT--GTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSI--ELKVKEPPTFIRELKPVEVVKY 5896          

HSP 18 Score: 67.781 bits (164), Expect = 8.986e-11
Identity = 69/251 (27.49%), Postives = 111/251 (44.22%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQE--MTESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+ TV WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     +    E   TE    +E+      +T  T++         P F+   P +  L  G SV    +V    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   LL   +  ++ KSQ
Sbjct:  942 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFIT-KPVVQKLVEGGSVVFGCQV--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSAS-ASLLEEADYELLMKSQ 1184          

HSP 19 Score: 67.781 bits (164), Expect = 9.295e-11
Identity = 59/243 (24.28%), Postives = 93/243 (38.27%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            S S +    + +PPSFVK  +   +   G+ A L  ++   G P + V W+K+   L+  +     F    AILDI     EDSG YSC A N+ G D  S                      TE +                      PP F+K +     ++G  ++ L+  V         I WFK+ + + +  ++ +   +    L+I    S D G+Y C   N+ G+       LL
Sbjct: 4651 SSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKL--KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCS----------------------TEIVIK-------------------EPPSFIKTLEPADIVRGTNAL-LQCEV--SGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLL 4847          

HSP 20 Score: 67.781 bits (164), Expect = 9.697e-11
Identity = 57/225 (25.33%), Postives = 87/225 (38.67%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFV-KPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP FVK  E  +VA +G+   L  ++  +G P + V W+++   L    ++N SF    A+L I     EDSG+Y C A N  G D +  + L V                                          PP F  KP P       G  V L+  +       +V  W K+ + + N  +F I        L I+ + + D G+Y C A N+ G
Sbjct: 7287 VKEPPKFVKKLEASKVAKQGESIQLECKI--SGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVG-DASCSTALTVKA----------------------------------------PPVFTQKPSP--VGALKGSDVILQCEISGTPPFEVV--WVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVG 7464          

HSP 21 Score: 67.3958 bits (163), Expect = 1.218e-10
Identity = 53/224 (23.66%), Postives = 90/224 (40.18%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  E  ++  + +      ++   G P + V WYKD   +   S+F  SF    A+L++     EDSG+Y+C A +N     +S ++L V          H               + T K  D+H++                 LQG    H              + W+K+ R L +G ++ I+ +     + I+ V + D G+Y C A N  G
Sbjct: 8228 VQEPPRFIKKLEPSRIVKQDEFTRYECKI--GGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEA-HNAAGSASSSTSLKVKEPPIFRKKPH--------------PIETLKGADVHLEC---------------ELQGTPPFH--------------VSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVG 8405          

HSP 22 Score: 66.2402 bits (160), Expect = 3.010e-10
Identity = 84/392 (21.43%), Postives = 138/392 (35.20%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETR--VIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV----IPENDFRPELKRTD 1981
            + + P F K  +  +V  E D   L A V  AG P   + W+KD   L +G ++ T  +     L IL     D+GEY C   N  G   +S  +  V L E                                      PP F+K +    +L+GG +    T    +PIT     + W K+   +       + F+   A L + G+  +  G Y C A+N AG  + +   LL   E   +T+                                           + +++ V +G+PA   VK SG      +WF +   +   S  K+    ++S L+    +           +N +G +   A ++V    IP + F  +LK+ D
Sbjct: 5316 VKESPYFTKEFKPIEVLKEYD-VMLLAEV--AGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVG---SSICSARVTLRE--------------------------------------PPSFIKKIESTSSLRGGTAAFQATLKGSLPIT-----VTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSA--LLSVKEPATITE-------------------------------------------EAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPS-FTKKLKKMD 5612          

HSP 23 Score: 65.4698 bits (158), Expect = 4.633e-10
Identity = 63/234 (26.92%), Postives = 90/234 (38.46%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            I +PP FVK  E  +V+  GD ASL  ++  AG P + V WYK    L   + +   F    A L        DSGEY C A+N+ G  + S ST         V    LP   +  +  ++ ++  P   D  I                    G +         PI+     + W+K+G+PL +       F    A L+I        G Y C A N  G A S+   +L
Sbjct: 8884 ILEPPYFVKQLEPVKVSV-GDSASLQCQL--AGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVG--EVSASTF------LTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAI-------------------SGSE---------PIS-----VSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLIL 9073          

HSP 24 Score: 63.5438 bits (153), Expect = 2.016e-9
Identity = 55/206 (26.70%), Postives = 77/206 (37.38%), Query Frame = 2
Query:  881 GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQ 1498
            G P +   R+   G   L V WYKDGV L   +   TSF    A L IL T +   G+Y+C A N  G   T+ S+  + L E  V                                    P F    P   +L  G+S   +  V     + + I W K+ R +  G  + +      A L ++ V   D G Y C+A N AG+
Sbjct: 8057 GFPVAFECRI--NGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLG---TASSSAKLILSEHEV------------------------------------PPFFDLKPVSVDLALGESGTFKCHVT--GTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGK 8219          

HSP 25 Score: 63.1586 bits (152), Expect = 2.533e-9
Identity = 69/319 (21.63%), Postives = 111/319 (34.80%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQW 1771
            L  + +PP F++ P  +  A  G+PA+L  +V   G P + + WYK+   L +   +   F+   A L I      D GEYSC A N+ G   +S   +                                      I A   PP F + +  ++   G   V  E R+       L + W+K+G  L +       F    A L I+       G Y C A N  G A S+         + ++++ ++P                                  P FD+KP+++ +  G    F   V+G    +I W
Sbjct: 7940 LVSVLEPPYFIE-PLEHVEAVIGEPATLQCKV--DGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLV--------------------------------------IKARKLPPFFARKLKDVHETLGF-PVAFECRI--NGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSA--------KLILSEHEVP----------------------------------PFFDLKPVSVDLALGESGTFKCHVTGTAPIKITW 8172          

HSP 26 Score: 62.7734 bits (151), Expect = 3.024e-9
Identity = 54/228 (23.68%), Postives = 86/228 (37.72%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +P +FV+  E  Q+  +GD   L  +V   G P + + W+ +   +   S+   SF    A+L +     EDSGEY C A+N  G D  S          S+V+    P   T+    IE      K  D+ + A +   PP                                 I WFK+   L +G ++          L I+  ++ D G+Y C   N+ G +
Sbjct: 5222 VKEPATFVEKLEPSQLLKKGDATQLACKV--TGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCS----------SIVIVKESPY-FTKEFKPIEVL----KEYDVMLLAEVAGTPP-------------------------------FEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSS 5401          

HSP 27 Score: 62.003 bits (149), Expect = 5.464e-9
Identity = 89/392 (22.70%), Postives = 148/392 (37.76%), Query Frame = 2
Query:  779 SFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNG---RPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGES-FIVVSAKNKLGEAVANATLSV 1939
            + RS +  SVA +   +     V     + V  EG       + I   D +  V WY     L    ++  ++E G AIL +    K D G Y C   N++G D +        + E  V + +  + M +    I+   +T +  +       RPP+F  P   LYN       ++   V         + W+K+G   +P +N  ++    D+G   L I  V ++D  +Y   ARNK G+             +  VT    P +                  S  R          P F     N   +EG    F ++VSG P P ++W  + + L +  +I+ ++ +G   Y    R  +P ++ +  V+A N  G     A L V
Sbjct: 32475 AIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCK-IENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVRE--VYDYYCRRTMKK----IKRRTDTMRLLE-------RPPEFTLP---LYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKA--------KLTVTLHPPPTD------------------STLR----------PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIH-EGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 32812          

HSP 28 Score: 60.4622 bits (145), Expect = 1.845e-8
Identity = 60/213 (28.17%), Postives = 85/213 (39.91%), Query Frame = 2
Query:  926 PNLTVQWYKDGVPLAAG---SRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAG----QAQSNVVRLLVATEE 1540
            P   V WYK G  +  G    ++    ++G   L I     +D  EY+ VA+N +G D                             A +  +L+ P T     D+ +RP    K +      Q GQSV  E RV  I   +L  +W K+G+PL+ G    I+ +   +  L I   + EDTG Y   A N AG    QA   V RL    +E
Sbjct: 32644 PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCK--------------------------AKLTVTLHPPPT-----DSTLRP--MFKRLLANAECQEGQSVCFEIRVSGIPPPTL--KWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQE 32821          

HSP 29 Score: 60.4622 bits (145), Expect = 1.892e-8
Identity = 50/229 (21.83%), Postives = 82/229 (35.81%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +PP F+K P    V   G   +   ++   G P + V WY DG  + A  +   SF  G A   I     E+SG Y C A+N+ G   T+  ++ + + E                                      PP F++ +  +  ++    V LE  V         + W KN R + +  ++ +        L I      DTG+Y C   N+ G    +
Sbjct: 5784 VKEPPQFIKKPSPVLVLRNGQSTTFECQI--TGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAG---TASCSIELKVKE--------------------------------------PPTFIRELKPVEVVK-YSDVELECEV--TGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCS 5966          

HSP 30 Score: 60.077 bits (144), Expect = 2.240e-8
Identity = 53/210 (25.24%), Postives = 73/210 (34.76%), Query Frame = 2
Query:  881 GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            G+ A     V   G   + V W KD   + +G ++  S+    A L +L   K DSG+Y+C A N  G D     T  +N+ E ++                                   PP F K +        G S  LE RV    PIT     + W+KN   +       I F     +L +      D G Y C   N AG A
Sbjct: 9094 GESADFECHV--TGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDS---CTAQLNIKERLI-----------------------------------PPSFTKRLSETVEETEGNSFKLEGRVAGSQPIT-----VAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSA 9258          

HSP 31 Score: 58.9214 bits (141), Expect = 5.531e-8
Identity = 56/244 (22.95%), Postives = 91/244 (37.30%), Query Frame = 2
Query:  779 SFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            S  + ++    HL  I  P  FVK    Y +  +G P  L       G P ++V W K+G+ +    R N +     AIL+I  +  ED+G+Y+C  +N  G D  S   L                                          + PP FVK +  +  +  G S  L+ ++    +  + + W+K    L     + + F    A L    V   D+G+Y C A N  G+  ++
Sbjct: 8777 SNEAGKASCTTHL-YIKAPAKFVKRLNDYSI-EKGKPLILEGTF--TGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI-----------------------------------------LEPPYFVKQLEPV-KVSVGDSASLQCQLAGTPE--IGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSAS 8972          

HSP 32 Score: 58.5362 bits (140), Expect = 6.225e-8
Identity = 64/244 (26.23%), Postives = 97/244 (39.75%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----------IEWFK-NGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            + E   PP F +H     V+ EG+   L+  V   G   + +QW K G  +    R + SF  G A+L++    K DSG+Y C A N  G D T+ S + +    +V                       P T+   +D              L+ +   QS+    RV+  T ++ +          ++W K   R LN G R  I      A L+I      D+G Y C A N+ G+ +SNV
Sbjct: 9266 IKEPKKPPVFDQHLTPVTVS-EGEYVQLSCHV--QGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSD-TTKSKVTIKDKPAVA----------------------PATKKAAVDG------------RLFFVSEPQSI----RVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNV 9467          

HSP 33 Score: 55.8398 bits (133), Expect = 4.025e-7
Identity = 65/245 (26.53%), Postives = 96/245 (39.18%), Query Frame = 2
Query:  827 TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSR--FNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            T  P+F   P +  V  EG  A+  A +  +G P   V W++DG  ++  +      SF  G A L I    K +SG YS  A N  G   +                                      T ++ + A   PP FV+ +  +   QG Q V L+ RV  I   + V++++++G  + +   F I  +     L I     ED+G Y   A N  G+A S    LLV  EE V  K
Sbjct:    3 TQAPTFT-QPLQSVVVLEGSTATFEAHI--SGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATS--------------------------------------TAELLVKAETAPPNFVQRLQSMTVRQGSQ-VRLQVRVTGI--PTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATST-AELLVQGEEEVPAK 202          

HSP 34 Score: 54.6842 bits (130), Expect = 1.045e-6
Identity = 79/392 (20.15%), Postives = 146/392 (37.24%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNV---NLDESVVLN---SHLPQEMTESIAAIEASLN---------------------TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----IEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            R     EG+ A  +      G+P  TV W + G  L+  +R   +  +  +  +I      D G YS V +N+ G  Q +  TL +    + E  V +      P+   +S  A+++                        T K Q + + AP +  QF+K           ++     ++  + +SS++    + W+K+G+ L     F   +   G   L I  +   D G+Y C    + G +++N+  +  A +      S++ +      +  D + TE         +  E   S P       + TV   + A+F VK +G PRP   W  +   +      K+  D    +LE  +           + KN  G   ++  L++
Sbjct: 33495 RSMTVYEGESARFSCDT--DGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEG-KQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLK----------AEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISE-----TKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 33868          

HSP 35 Score: 53.5286 bits (127), Expect = 1.935e-6
Identity = 39/112 (34.82%), Postives = 52/112 (46.43%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER--GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM 1165
            P F+  P   Q   EG       +V   G+P   V W K GVPL  G R+  S+ +  G   L I  TF +D+GEY+ V +N  G    S S L    D  +++ S   QEM
Sbjct: 1082 PYFITKP-VVQKLVEGGSVVFGCQV--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLE-EADYELLMKSQ--QEM 1187          
BLAST of Titin vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 115.546 bits (288), Expect = 2.683e-25
Identity = 105/401 (26.18%), Postives = 173/401 (43.14%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-----------------LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P FV   E+ +  N  + + L  +V   G+PN  + W K+   +          E  +G A L I  T  +DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+    R  Q       LY+                 L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP+  + +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1556 PMFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTR---CKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHL----RYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRR 1941          

HSP 2 Score: 89.7373 bits (221), Expect = 2.124e-17
Identity = 81/301 (26.91%), Postives = 120/301 (39.87%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS-----------------PSTLNVNLDESVVLNSHL----PQEMTESI----------AAIEASLNTPK------------------TQDIHID------APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + S  ++ S +V  + E   PPSF +  +  +    G P +LT R+   G   + V WY+DGV L       TSF    A L IL T    SG+YSC A N  G   +S                 P +++V   ES     H+    P  +T S             I    NTP                   T D+  D      +   PP+FVK +      + G+S+ LE ++       + + WF+N   L+   ++N+ F    A+L I    +ED+GDY C A N  G A  +
Sbjct: 7081 ENSIGTASSKTVFRIQERQLPPSFARQLKDIE-QTVGLPVTLTCRL--NGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKI--SGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCS 7376          

HSP 3 Score: 83.9593 bits (206), Expect = 1.005e-15
Identity = 97/395 (24.56%), Postives = 151/395 (38.23%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK--SQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL--------PHFD----------IKPI-NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +V  PE  QV  E        G PA   A +  +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  + P+      + GQ    + RV   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L A E  +  +   ++  E  ++  S      E +  +  +  +  E   L          FD          IK + N  +  G+ A   V V G P+P+IQWF N  L+ P++  K   DG    L     K+  E      A N  G+ + +A L +
Sbjct: 3232 YVNAPEPPQVLQELQPVTVQSGKPARFCAVI--SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIITPLQDTVTSE-GQPARFQCRV---SGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3592          

HSP 4 Score: 83.1889 bits (204), Expect = 1.744e-15
Identity = 84/376 (22.34%), Postives = 143/376 (38.03%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRN 2002
             +GDPA+L  +   +G   +T +W+KDG  L  GS++  S     +IL I+ T K+DSGEY+   +N+ G                               ++ +A +N        +D  I PP F K +  + +++G     ++   I      + I+WFK+ + ++   ++   F    A L+I  +   D+G Y C A NKAG  Q +                            L ++                     P+F  KP +  V      +    V G     I+WF +   +   + + V+ D + + LE    K       +    N +G A + ATL V     F   +K+  P ++LRN
Sbjct: 5518 TQGDPATLQVKF--SGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGR------------------------------SSCKARINV-------LDL-IIPPSFTKKLKKMDSIKGS---FIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCS--------------------------GHLTVKEP-------------------PYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQF---IKKPSPVLVLRN 5802          

HSP 5 Score: 82.4185 bits (202), Expect = 3.102e-15
Identity = 87/377 (23.08%), Postives = 145/377 (38.46%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PPSFV+ P+   V   G   + T+  I  G P  +V W+K    L  G R N S E   A L++       SGEY+C+  N  G                                  +AS  T     ++I AP +   FVK +   Y+++ G+ + LE   T   PI+     + W KNG  +    R NI      AIL+I     ED G Y C+  N +G+   +   L++                                               P+F   ++P+ ++V  G+ A    +++G P   + W+  +  + PT+  K++   +++ L F +  I      +  A+N +GE  A+  L+V
Sbjct: 8698 VREPPSFVQKPDPMDVLT-GTNVTFTS--IVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAG----------------------------------KASCTT----HLYIKAPAK---FVKRL-NDYSIEKGKPLILEGTFTGTPPIS-----VTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP---------------------------------------------PYFVKQLEPVKVSV--GDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTV 8977          

HSP 6 Score: 79.7221 bits (195), Expect = 2.000e-14
Identity = 74/273 (27.11%), Postives = 112/273 (41.03%), Query Frame = 2
Query:  764 PNMQQSF-------RSSRSGSVAHLDE--ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            P++Q SF         + +GS   + E  + +P   ++  E  QV   GDPA+L   V  AG P L  +WYKDG PL A  ++  SF+   A L        DSG+Y+    N  G   +S  T    LD  +                                     P F KP+  + ++  G +  L+ ++       + + WFK+G+ +    R+ I F  G A L+II V   D G++ C A N  G   S+   L+V    + VTK
Sbjct: 4911 PDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQV-TAGDPATLEYTV--AGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVG--SSSCETTFTVLDRDIA------------------------------------PFFTKPLRNVDSVVNG-TCRLDCKI--AGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGA-LIVQEPPSFVTK 5138          

HSP 7 Score: 78.5666 bits (192), Expect = 4.703e-14
Identity = 89/389 (22.88%), Postives = 145/389 (37.28%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFVK PE  +V   G   + T+ +   G P   V W++    L  G R N  FE   A L++       SGEY+CV  NN G    +  T  + + E                                      P  F+K +   ++++ G+S+ LE   T  +PI+     + W K+G  +    + NIV      IL+I+     D G Y C   N+AG+   +V   LV+T E                                           P+F  +++P+   V  G+      +V+G P   + W+  +  + PT   + Y   +++ L F +  I         A+N +G A ++ T+  I E    P   R
Sbjct: 6816 VQEPPSFVKEPEPLEVL-PGKNVTFTSVI--RGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQ---ASCTTRLFVKE--------------------------------------PAAFLKRLSD-HSVEPGKSIILESTYTGTLPIS-----VTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGR---DVCGALVSTLEP------------------------------------------PYFVTELEPLEAAV--GDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTA-SSKTVFRIQERQLPPSFAR 7106          

HSP 8 Score: 77.0258 bits (188), Expect = 1.513e-13
Identity = 75/283 (26.50%), Postives = 125/283 (44.17%), Query Frame = 2
Query:  713 KMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKS 1558
            ++Q+ K N+T       P     F S + G+          P F+K      ++  GD A+L+  VI  G P   +QW+ +GV L   + +   F+     L IL+T  ED GEY+C+A N++G    S + L +N       +     + TE+ +A+  SL         +  P  PP F+K +  +   QG  ++   T V    + +  + WFK  + L     + I+ +  G     +     ED+G Y C A N  G++ +    LLV  E+T +T +
Sbjct: 3471 ELQLSKINETLELLSESPVYPTKFDSEKEGT---------GPIFIKEVSNADISM-GDVATLSVTVI--GIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICS-AYLKIN-------SKGEGHKDTETESAVAKSLE-------KLGGPC-PPHFLKELKPIRCAQGLPAIFEYTVV---GEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGES-TCAAELLVLLEDTDMTDT 3721          

HSP 9 Score: 76.2554 bits (186), Expect = 2.271e-13
Identity = 59/227 (25.99%), Postives = 98/227 (43.17%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +P   V+  +   V  E DP +L   V  AG P L V+W KDG  +     F+ SFE   A   I    K+DSG+Y+   +N+FG      S+ +  L    VL+ ++P   T+ +  ++  L                               G S+H+E +V   +PI+      +WFK+G+ ++   ++ +V       L++  +  EDT +Y C   N AG
Sbjct: 6064 VQEPAQIVEKAKSVDV-TEKDPMTLECVV--AGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGS-----SSCDAYLR---VLDQNIPPSFTKKLTKMDKVL-------------------------------GSSIHMECKVSGSLPIS-----AQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAG 6243          

HSP 10 Score: 74.3294 bits (181), Expect = 1.115e-12
Identity = 94/390 (24.10%), Postives = 141/390 (36.15%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQK-VYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP-------ENDFRPELKRT 1978
            PPSF K         EG+   L  RV  AG   +TV WYK+ + +   S    +F+    +L +      D+G Y+C   N+ G      S L                                 T  I I  P +PP F + +  +  +  G+ V L   V       + I+W K GR +    R +  F  G A+L++  V   D+GDY C A N AG            T ++ VT    P  +    ++        VD   F             F  +P ++ V E   A F+ KV G P P ++W   +   +    +  ++  G  + LE +             A N+ GE  +N  L V         E D R  LK+T
Sbjct: 9175 PPSFTKRLSETVEETEGNSFKLEGRV--AGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAG------SALC--------------------------------TSSIVIKEPKKPPVFDQHLTPV-TVSEGEYVQLSCHV--QGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGS----------DTTKSKVTIKDKPAVAPATKKAA-------VDGRLF-------------FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKT 9491          

HSP 11 Score: 72.4034 bits (176), Expect = 3.552e-12
Identity = 91/400 (22.75%), Postives = 151/400 (37.75%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPI-NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQK---VYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            RSS    +  LD I  PPSF K   + +  +    + +    I AG   +++QW+KD   ++A  ++  SF    A L+I      DSG Y+C A N  G +Q S                HL      ++      +  P++QD++ +  ++          L  L GG +        P+T     I+WFK+ + L++G   ++  D     L++    + D+G Y C   N  G A S           T+  K                                      P F  KP   L +  G    F  +++G P+ ++ W+L+   +  T+IQK    + DG ++  +    ++      V  A+N  G A  +  L V     F  ELK
Sbjct: 5586 RSSCKARINVLDLII-PPSFTK---KLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCS---------------GHL------TVKEPPYFVEKPQSQDVNPNTRVQ----------LKALVGGTA--------PMT-----IKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKA---------TLFVKEP------------------------------------PQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEI--TAIQKHGISFIDG-LATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELK 5889          

HSP 12 Score: 72.4034 bits (176), Expect = 4.389e-12
Identity = 67/226 (29.65%), Postives = 85/226 (37.61%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIE--WFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            I D P F+K  E  Q A       L  +V    D  +TV W KDG  L  G  +   FE   A L+I     +DSG Y C A N  G    S +T+ V                                          PP FVK +   Y +  G+S  L  ++      S VI+  WFKN + L+      + F    AILDI  V  ED+G Y C A N  G
Sbjct: 4567 IIDKPHFIKELEPVQSAI-NKKVHLECQV--DEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCS-ATVTVR----------------------------------------EPPSFVKKVDPSYLMLPGESARLHCKL----KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVG 4744          

HSP 13 Score: 71.633 bits (174), Expect = 6.989e-12
Identity = 72/293 (24.57%), Postives = 126/293 (43.00%), Query Frame = 2
Query: 1136 VLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATE----ETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            +  + + +E  E +   EA +         ++ P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +E    ET     +   E  ++++S D+  T   D S    +      + P+F  KP+   + EG    F  +V G P+P + W  +    +P +    Y    +SY  +   CK+          GE  IVV  +NK GE  A+A+L  + E D+   +K
Sbjct:  906 ITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT---DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECKLVISMTFADDAGEYTIVV--RNKHGETSASASL--LEEADYELLMK 1182          

HSP 14 Score: 71.2478 bits (173), Expect = 8.070e-12
Identity = 89/372 (23.92%), Postives = 130/372 (34.95%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHID--APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +PP FV   E  + A  GD  SL  +V  AG P +TV WYK    L     + T F    A L        DSGEY+C A+N+ G   T+ S     + E       LP      +  IE ++  P T    ++  API+                                   + W+++G  L +       F    A L I+      +G Y C A N  G A S+    L A E         P++S                               P FDIKP+++ V  G  A F   V+G    +I W  +   + P     +   G+  +L   +            A N +G+ + +A LSV
Sbjct: 7004 EPPYFVTELEPLEAAV-GDSVSLQCQV--AGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIG---TASSKTVFRIQE-----RQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQ-----------------------------------VCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSA--RLTARE---------PKKS-------------------------------PFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSV 7287          

HSP 15 Score: 70.8626 bits (172), Expect = 1.201e-11
Identity = 60/232 (25.86%), Postives = 95/232 (40.95%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P + V+ PE  +V   GD  +L   V  AG P L+ +W+KDG  L + +++  SF    + L I+     DSG YS   +N  G D  + S L V+ D +V                                    PP F + +     L  G SV +E +V    PI+     + WF  G  +++G ++          L +  +   D+GDY C A N AG  + +
Sbjct: 8509 VLEPATIVEKPESIKVTT-GDTCTLECTV--AGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTAS-LQVS-DRTV------------------------------------PPSFTRKLKETNGLS-GSSVVMECKVYGSPPIS-----VSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECS 8693          

HSP 16 Score: 70.4774 bits (171), Expect = 1.329e-11
Identity = 98/434 (22.58%), Postives = 163/434 (37.56%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTS--IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFR----KLSTLK-KVAVSPELQNAFRK 2077
            S S   +  +T+PP FVK  E  ++   GD + L  ++  AG P + V W+++   L A  ++  +F    A++ +     EDSG++ C A+N  G   TS ST  V + E  V +S  P  + E++   E SL          +    PP                                 + W+K+ R L +  ++ I        + I+ V + D G+Y C A+N+ G              +T V   +L +                                 P F  K  +LTV  G PA     + G     +QW   +  VI  S  I+  + + +++ L+F + +       +   KN  G     ATL V+            +PA+++    P      +  TL+ KVA +PEL   + K
Sbjct: 6337 SDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKI--AGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAG--STSCST-KVIVKEPPVFSSFPP--IVETLKNAEVSL--------ECELSGTPP-------------------------------FEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGS-------------DTCVCTVKLKEP--------------------------------PRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVE-NVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL------------EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYK 6666          

HSP 17 Score: 69.3218 bits (168), Expect = 3.176e-11
Identity = 69/260 (26.54%), Postives = 101/260 (38.85%), Query Frame = 2
Query:  809 AHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVK-PMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQY 1585
             HL  + +PP FV+ P+   V N      L A V   G   +T++W+KD   L +G+  +   +     L++      DSG Y C   N+ G   TS +TL V                                          PPQF+K P P L  L+ GQS   E ++       + + W+ +G  +    +  I F  G A   I G   E++G Y C ARN AG A  ++   L   E     +   P E V+Y
Sbjct: 5687 GHLT-VKEPPYFVEKPQSQDV-NPNTRVQLKALV--GGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGT-ATSKATLFVK----------------------------------------EPPQFIKKPSPVLV-LRNGQSTTFECQIT--GTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSI--ELKVKEPPTFIRELKPVEVVKY 5896          

HSP 18 Score: 67.781 bits (164), Expect = 8.986e-11
Identity = 69/251 (27.49%), Postives = 111/251 (44.22%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQE--MTESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+ TV WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     +    E   TE    +E+      +T  T++         P F+   P +  L  G SV    +V    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   LL   +  ++ KSQ
Sbjct:  942 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFIT-KPVVQKLVEGGSVVFGCQV--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSAS-ASLLEEADYELLMKSQ 1184          

HSP 19 Score: 67.781 bits (164), Expect = 9.295e-11
Identity = 59/243 (24.28%), Postives = 93/243 (38.27%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            S S +    + +PPSFVK  +   +   G+ A L  ++   G P + V W+K+   L+  +     F    AILDI     EDSG YSC A N+ G D  S                      TE +                      PP F+K +     ++G  ++ L+  V         I WFK+ + + +  ++ +   +    L+I    S D G+Y C   N+ G+       LL
Sbjct: 4651 SSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKL--KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCS----------------------TEIVIK-------------------EPPSFIKTLEPADIVRGTNAL-LQCEV--SGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLL 4847          

HSP 20 Score: 67.781 bits (164), Expect = 9.697e-11
Identity = 57/225 (25.33%), Postives = 87/225 (38.67%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFV-KPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP FVK  E  +VA +G+   L  ++  +G P + V W+++   L    ++N SF    A+L I     EDSG+Y C A N  G D +  + L V                                          PP F  KP P       G  V L+  +       +V  W K+ + + N  +F I        L I+ + + D G+Y C A N+ G
Sbjct: 7287 VKEPPKFVKKLEASKVAKQGESIQLECKI--SGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVG-DASCSTALTVKA----------------------------------------PPVFTQKPSP--VGALKGSDVILQCEISGTPPFEVV--WVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVG 7464          

HSP 21 Score: 67.3958 bits (163), Expect = 1.218e-10
Identity = 53/224 (23.66%), Postives = 90/224 (40.18%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  E  ++  + +      ++   G P + V WYKD   +   S+F  SF    A+L++     EDSG+Y+C A +N     +S ++L V          H               + T K  D+H++                 LQG    H              + W+K+ R L +G ++ I+ +     + I+ V + D G+Y C A N  G
Sbjct: 8228 VQEPPRFIKKLEPSRIVKQDEFTRYECKI--GGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEA-HNAAGSASSSTSLKVKEPPIFRKKPH--------------PIETLKGADVHLEC---------------ELQGTPPFH--------------VSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVG 8405          

HSP 22 Score: 66.2402 bits (160), Expect = 3.010e-10
Identity = 84/392 (21.43%), Postives = 138/392 (35.20%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETR--VIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV----IPENDFRPELKRTD 1981
            + + P F K  +  +V  E D   L A V  AG P   + W+KD   L +G ++ T  +     L IL     D+GEY C   N  G   +S  +  V L E                                      PP F+K +    +L+GG +    T    +PIT     + W K+   +       + F+   A L + G+  +  G Y C A+N AG  + +   LL   E   +T+                                           + +++ V +G+PA   VK SG      +WF +   +   S  K+    ++S L+    +           +N +G +   A ++V    IP + F  +LK+ D
Sbjct: 5316 VKESPYFTKEFKPIEVLKEYD-VMLLAEV--AGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVG---SSICSARVTLRE--------------------------------------PPSFIKKIESTSSLRGGTAAFQATLKGSLPIT-----VTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSA--LLSVKEPATITE-------------------------------------------EAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPS-FTKKLKKMD 5612          

HSP 23 Score: 65.4698 bits (158), Expect = 4.633e-10
Identity = 63/234 (26.92%), Postives = 90/234 (38.46%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            I +PP FVK  E  +V+  GD ASL  ++  AG P + V WYK    L   + +   F    A L        DSGEY C A+N+ G  + S ST         V    LP   +  +  ++ ++  P   D  I                    G +         PI+     + W+K+G+PL +       F    A L+I        G Y C A N  G A S+   +L
Sbjct: 8884 ILEPPYFVKQLEPVKVSV-GDSASLQCQL--AGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVG--EVSASTF------LTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAI-------------------SGSE---------PIS-----VSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLIL 9073          

HSP 24 Score: 63.5438 bits (153), Expect = 2.016e-9
Identity = 55/206 (26.70%), Postives = 77/206 (37.38%), Query Frame = 2
Query:  881 GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQ 1498
            G P +   R+   G   L V WYKDGV L   +   TSF    A L IL T +   G+Y+C A N  G   T+ S+  + L E  V                                    P F    P   +L  G+S   +  V     + + I W K+ R +  G  + +      A L ++ V   D G Y C+A N AG+
Sbjct: 8057 GFPVAFECRI--NGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLG---TASSSAKLILSEHEV------------------------------------PPFFDLKPVSVDLALGESGTFKCHVT--GTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGK 8219          

HSP 25 Score: 63.1586 bits (152), Expect = 2.533e-9
Identity = 69/319 (21.63%), Postives = 111/319 (34.80%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQW 1771
            L  + +PP F++ P  +  A  G+PA+L  +V   G P + + WYK+   L +   +   F+   A L I      D GEYSC A N+ G   +S   +                                      I A   PP F + +  ++   G   V  E R+       L + W+K+G  L +       F    A L I+       G Y C A N  G A S+         + ++++ ++P                                  P FD+KP+++ +  G    F   V+G    +I W
Sbjct: 7940 LVSVLEPPYFIE-PLEHVEAVIGEPATLQCKV--DGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLV--------------------------------------IKARKLPPFFARKLKDVHETLGF-PVAFECRI--NGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSA--------KLILSEHEVP----------------------------------PFFDLKPVSVDLALGESGTFKCHVTGTAPIKITW 8172          

HSP 26 Score: 62.7734 bits (151), Expect = 3.024e-9
Identity = 54/228 (23.68%), Postives = 86/228 (37.72%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +P +FV+  E  Q+  +GD   L  +V   G P + + W+ +   +   S+   SF    A+L +     EDSGEY C A+N  G D  S          S+V+    P   T+    IE      K  D+ + A +   PP                                 I WFK+   L +G ++          L I+  ++ D G+Y C   N+ G +
Sbjct: 5222 VKEPATFVEKLEPSQLLKKGDATQLACKV--TGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCS----------SIVIVKESPY-FTKEFKPIEVL----KEYDVMLLAEVAGTPP-------------------------------FEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSS 5401          

HSP 27 Score: 62.003 bits (149), Expect = 5.464e-9
Identity = 89/392 (22.70%), Postives = 148/392 (37.76%), Query Frame = 2
Query:  779 SFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNG---RPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGES-FIVVSAKNKLGEAVANATLSV 1939
            + RS +  SVA +   +     V     + V  EG       + I   D +  V WY     L    ++  ++E G AIL +    K D G Y C   N++G D +        + E  V + +  + M +    I+   +T +  +       RPP+F  P   LYN       ++   V         + W+K+G   +P +N  ++    D+G   L I  V ++D  +Y   ARNK G+             +  VT    P +                  S  R          P F     N   +EG    F ++VSG P P ++W  + + L +  +I+ ++ +G   Y    R  +P ++ +  V+A N  G     A L V
Sbjct: 32475 AIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCK-IENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVRE--VYDYYCRRTMKK----IKRRTDTMRLLE-------RPPEFTLP---LYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKA--------KLTVTLHPPPTD------------------STLR----------PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIH-EGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 32812          

HSP 28 Score: 60.4622 bits (145), Expect = 1.845e-8
Identity = 60/213 (28.17%), Postives = 85/213 (39.91%), Query Frame = 2
Query:  926 PNLTVQWYKDGVPLAAG---SRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAG----QAQSNVVRLLVATEE 1540
            P   V WYK G  +  G    ++    ++G   L I     +D  EY+ VA+N +G D                             A +  +L+ P T     D+ +RP    K +      Q GQSV  E RV  I   +L  +W K+G+PL+ G    I+ +   +  L I   + EDTG Y   A N AG    QA   V RL    +E
Sbjct: 32644 PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCK--------------------------AKLTVTLHPPPT-----DSTLRP--MFKRLLANAECQEGQSVCFEIRVSGIPPPTL--KWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQE 32821          

HSP 29 Score: 60.4622 bits (145), Expect = 1.892e-8
Identity = 50/229 (21.83%), Postives = 82/229 (35.81%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +PP F+K P    V   G   +   ++   G P + V WY DG  + A  +   SF  G A   I     E+SG Y C A+N+ G   T+  ++ + + E                                      PP F++ +  +  ++    V LE  V         + W KN R + +  ++ +        L I      DTG+Y C   N+ G    +
Sbjct: 5784 VKEPPQFIKKPSPVLVLRNGQSTTFECQI--TGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAG---TASCSIELKVKE--------------------------------------PPTFIRELKPVEVVK-YSDVELECEV--TGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCS 5966          

HSP 30 Score: 60.077 bits (144), Expect = 2.240e-8
Identity = 53/210 (25.24%), Postives = 73/210 (34.76%), Query Frame = 2
Query:  881 GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            G+ A     V   G   + V W KD   + +G ++  S+    A L +L   K DSG+Y+C A N  G D     T  +N+ E ++                                   PP F K +        G S  LE RV    PIT     + W+KN   +       I F     +L +      D G Y C   N AG A
Sbjct: 9094 GESADFECHV--TGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDS---CTAQLNIKERLI-----------------------------------PPSFTKRLSETVEETEGNSFKLEGRVAGSQPIT-----VAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSA 9258          

HSP 31 Score: 58.9214 bits (141), Expect = 5.531e-8
Identity = 56/244 (22.95%), Postives = 91/244 (37.30%), Query Frame = 2
Query:  779 SFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            S  + ++    HL  I  P  FVK    Y +  +G P  L       G P ++V W K+G+ +    R N +     AIL+I  +  ED+G+Y+C  +N  G D  S   L                                          + PP FVK +  +  +  G S  L+ ++    +  + + W+K    L     + + F    A L    V   D+G+Y C A N  G+  ++
Sbjct: 8777 SNEAGKASCTTHL-YIKAPAKFVKRLNDYSI-EKGKPLILEGTF--TGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI-----------------------------------------LEPPYFVKQLEPV-KVSVGDSASLQCQLAGTPE--IGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSAS 8972          

HSP 32 Score: 58.5362 bits (140), Expect = 6.225e-8
Identity = 64/244 (26.23%), Postives = 97/244 (39.75%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----------IEWFK-NGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            + E   PP F +H     V+ EG+   L+  V   G   + +QW K G  +    R + SF  G A+L++    K DSG+Y C A N  G D T+ S + +    +V                       P T+   +D              L+ +   QS+    RV+  T ++ +          ++W K   R LN G R  I      A L+I      D+G Y C A N+ G+ +SNV
Sbjct: 9266 IKEPKKPPVFDQHLTPVTVS-EGEYVQLSCHV--QGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSD-TTKSKVTIKDKPAVA----------------------PATKKAAVDG------------RLFFVSEPQSI----RVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNV 9467          

HSP 33 Score: 55.8398 bits (133), Expect = 4.025e-7
Identity = 65/245 (26.53%), Postives = 96/245 (39.18%), Query Frame = 2
Query:  827 TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSR--FNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            T  P+F   P +  V  EG  A+  A +  +G P   V W++DG  ++  +      SF  G A L I    K +SG YS  A N  G   +                                      T ++ + A   PP FV+ +  +   QG Q V L+ RV  I   + V++++++G  + +   F I  +     L I     ED+G Y   A N  G+A S    LLV  EE V  K
Sbjct:    3 TQAPTFT-QPLQSVVVLEGSTATFEAHI--SGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATS--------------------------------------TAELLVKAETAPPNFVQRLQSMTVRQGSQ-VRLQVRVTGI--PTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATST-AELLVQGEEEVPAK 202          

HSP 34 Score: 54.6842 bits (130), Expect = 1.045e-6
Identity = 79/392 (20.15%), Postives = 146/392 (37.24%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNV---NLDESVVLN---SHLPQEMTESIAAIEASLN---------------------TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----IEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            R     EG+ A  +      G+P  TV W + G  L+  +R   +  +  +  +I      D G YS V +N+ G  Q +  TL +    + E  V +      P+   +S  A+++                        T K Q + + AP +  QF+K           ++     ++  + +SS++    + W+K+G+ L     F   +   G   L I  +   D G+Y C    + G +++N+  +  A +      S++ +      +  D + TE         +  E   S P       + TV   + A+F VK +G PRP   W  +   +      K+  D    +LE  +           + KN  G   ++  L++
Sbjct: 33495 RSMTVYEGESARFSCDT--DGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEG-KQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLK----------AEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISE-----TKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 33868          

HSP 35 Score: 53.5286 bits (127), Expect = 1.935e-6
Identity = 39/112 (34.82%), Postives = 52/112 (46.43%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER--GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM 1165
            P F+  P   Q   EG       +V   G+P   V W K GVPL  G R+  S+ +  G   L I  TF +D+GEY+ V +N  G    S S L    D  +++ S   QEM
Sbjct: 1082 PYFITKP-VVQKLVEGGSVVFGCQV--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLE-EADYELLMKSQ--QEM 1187          
BLAST of Titin vs. Ensembl Celegans
Match: ketn-1 (KETtiN (Drosophila actin-binding) homolog; Kettin [Source:UniProtKB/TrEMBL;Acc:Q9NL87])

HSP 1 Score: 202.986 bits (515), Expect = 2.036e-53
Identity = 130/377 (34.48%), Postives = 191/377 (50.66%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS--------PS---TLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXX-----XXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            EGD   L  RV P  DP L V+W ++G PL   SRF  +FE GF  LDILY + ED+G+Y  V +N+ G  ++         PS   T   + ++   L SH  Q    S A ++ + N     DI+ ++  R P+F   +  +  L+ G+    ET+V PI D  L +EWFK+ +P+  G RF    D GFA LD++  + +DTG+Y C A N+ GQ   +  +L       V+T SQ+P       Q L + N +  D  N  + E+      + +  P F I   NL V E  PARF   V+GYPRP++ WF+N    +     K+  DG + YL   + +I     +V  A+N  GE ++ ATL +   +DFR
Sbjct: 3836 EGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSKTKITVLPRPSLDYTSQTHGNQQDSLESHFKQ---HSQAKLQLTAN-----DIYNESDKRAPEFRTQLQNIGVLE-GEFCRFETQVAPINDPYLKVEWFKDKKPVLLGHRFRSTLDFGFACLDLLYALPDDTGEYHCVATNRHGQTMIS-AKLACQGASHVITDSQMP-------QGLRVSNVKK-DNKNIYWSEQGGAVQPKQKQAPQFTIPLRNLQVTENQPARFECAVTGYPRPKVTWFINGNQCLHGHRFKLNFDG-LHYLTVSKSRISDAGEVVAIARNTEGETISTATLDIFQNDDFR 4193          

HSP 2 Score: 165.622 bits (418), Expect = 1.719e-41
Identity = 118/359 (32.87%), Postives = 180/359 (50.14%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEA-SLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGY--PRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRC--KIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG P  L A+V P  D  LTVQW+ +G PLA G RF T  + G+  LDILY F +D+GE++CVA+N+ G  QT  +   V    ++  +S  P E  + I  +EA     P+  D   DA    PQF++P+  +  ++  QS H +T+V P TD +L I+WFK+G+PL N  RF +  D G+  LDI   + ED+G Y   A N  G A+  V   L  T   V+      ++S Q +Q ++       +  + ++   +    L   D       V EG P+ F  +   +  P+  +QW+LN   +  +S + + +D  +  L+ Q    +  GE  +VV  KN  GE   +  LS 
Sbjct: 2273 EGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQTI-ANFTVLPRGTIYTDSQHP-ESWQKIQVLEAPRAAAPEKPDAEHDA----PQFIEPLDSIDRME-FQSAHFQTKVTPQTDPNLRIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHTVPEDSGVYSVKASNAKGDAE--VQAQLTVTGNAVILGDTQHEQSWQKIQLIEAPRAPGEEEPDVKHGPPKFVTQLHSLD------GVVEGQPSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVV--KNSEGEDRTSGQLSC 2614          

HSP 3 Score: 160.614 bits (405), Expect = 8.303e-40
Identity = 119/374 (31.82%), Postives = 187/374 (50.00%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPM-PGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN-LTVEEGNPARFLVKVSGYPRP--QIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIV-VSAKNKLGEAVANATLSV 1939
            PP+F ++    + A EG    L  R+IP  DP + V W ++G PL   SRF  +    +  LDIL  + EDSG Y+C A + FG   TS  T+     +S++L++ +     + +  IE   N  K + +  +     P+FV  +   L  LQ G  +HLE +V P  D+ L ++WF NG+PL NG RF    D G+  LDI+   ++DTG++ C ARN  G+AQ+ +    V    T+ T SQ P ES Q +Q L+       ++ +  +         P F I+P++ +   E   A F  KV+    P  +IQWF +   ++ ++  K+ +D     L+     +P +S +  V A N  G+A   A L+V
Sbjct: 2125 PPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYTCKAVSAFGEAATS-CTVKCAAGKSLLLDT-MHDASWKRVQEIE---NREKLEAVDAEPEKTAPKFVTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQT-IANFTVLPRGTIYTDSQHP-ESWQKIQVLEAPRAAAPEKPDAEH-------DAPQF-IEPLDSIDRMEFQSAHFQTKVTPQTDPNLRIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHT-VPEDSGVYSVKASNAKGDAEVQAQLTV 2482          

HSP 4 Score: 149.058 bits (375), Expect = 2.973e-36
Identity = 125/423 (29.55%), Postives = 200/423 (47.28%), Query Frame = 2
Query:  695 FEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTV--EEGNPARFLVKVS--GYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
             EAP +K++        PPRF                   + ++T P S V          E  PA   A V P  DP LT+ W+ +G P++A SR     + G+ I+DI  T   DSGE+ CVAKN  G +  S +T+ V   E ++ +S  PQ + + I  IEA    P+ +    D     P  V  +     L+ G S HL+T+  P+ D S+ +EW K+G+P+ +  R+ +V D GFA+LDI+ ++  D G+Y     N +G+A S      V+    ++ + Q  Q++    ++++I   ED  R      E+E  E+ P F I+P++  V  EEG  A F  +       + Q+QW+ +   L   + I+ + S G +  LE            +  A N++GEAV +  L+  P+
Sbjct: 3164 IEAPKQKLEEADPEPKGPPRF-------------------IQQLTSPGSLV----------ENQPAHFEATVEPVDDPTLTINWFLNGEPMSASSRVKMINDFGWVIMDIAQTEPRDSGEWKCVAKNAAG-EAVSTATIEVQGKEVILQDSLQPQSL-DRIRQIEAGKPAPEERP---DQQFEAPAIVNALQVQGALEEGGSAHLQTQFTPVADPSIKVEWLKDGQPIFHSNRYKMVHDFGFAVLDILHLLKHDAGEYTFRVSNNSGEA-STSTSFEVSESSGLILQPQNEQKA----KAVEI--LEDNLRRRPEEIEQELKEATPVF-IEPLSAPVETEEGGRAHFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYV-VLEISPTYPEDNGEYICRAVNRVGEAVTSTKLTCTPK 3543          

HSP 5 Score: 147.517 bits (371), Expect = 1.075e-35
Identity = 85/209 (40.67%), Postives = 111/209 (53.11%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTES---IAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            EG  A  TAR  P  D  L VQWY DG PL  GSR  T    G+ +L+I  T+ ED+GEY C A N  G   TS + L     E ++  + LP+ M  +   IA IEA    P  +D   DA   PP+F   + G   LQ GQ  HLE +V P+ D  LVIEWF NG+P+N+  R   + D GF +L +     +D+G + C A N+ G
Sbjct: 3462 EGGRAHFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYVVLEISPTYPEDNGEYICRAVNRVGEAVTS-TKLTCTPKEGIISATQLPERMANAGRRIAEIEAP--RPAREDAP-DADHGPPKFTSALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHG 3666          

HSP 6 Score: 142.895 bits (359), Expect = 2.976e-34
Identity = 84/244 (34.43%), Postives = 133/244 (54.51%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASL--NTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA-QSNVVRLLVATEETVVTKSQLPQESVQYLQSLD 1600
            E +     AR++PA D  +TV+WY +G PL A  RF+  F+ G+  LD+LY + +DSG Y+ VA+N  G +  S   L V  ++ + L  H P+ + E I  +E        + +D   DA    P+F+  +P +  L   +++H++ R  P+ D ++VIEWF NGRPL  G R   + + GF  LDI G I+ED+G Y   A N  G+A +  V+ +  A +    T+ Q     + YL++L+
Sbjct: 1342 ENERVHFEARILPANDVKMTVEWYHNGNPLPAAHRFHPMFDFGYVALDLLYAYPQDSGTYTLVARNELG-EARSNVELVVGTEKVLYLEPHHPEGL-ERIKELEQDRRQGIAEVEDRTCDA---APKFLNDLPDI-QLNEHENIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQCVITVTPAGQILSDTQHQESLGKINYLENLN 1579          

HSP 7 Score: 139.428 bits (350), Expect = 3.470e-33
Identity = 103/382 (26.96%), Postives = 168/382 (43.98%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHI-----DAP-----IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            P F+   + +    E   +   AR+ P  DP L V W KDG PL   +R       G   L +  T+ ED+G Y+CV  N+ G  Q+S     V +D   + + H      +S+  I        +  IHI     + P     +  P+F + + G   +   + VH E R++P  D  + +EW+ NG PL    RF+ +FD G+  LD++    +D+G Y   ARN+ G+A+SN V L+V TE+ +  +   P E ++ ++ L+    + +     R       ++ P F  D+  I L   E             P   I+WF+N   ++  S  K  ++     L+ +           V A N LGEA+    ++V P
Sbjct: 1190 PKFLSQIQPFHCEQELGRSFFEARIQPINDPTLRVSWLKDGQPLPNANRIQIFQNFGVVSLSLHPTYPEDAGVYTCVLFNSHGQAQSSAELTTVWIDTLQLDSKH-----ADSLPII----GYLDSHQIHIGPQSVERPEEFNSLEAPKFARELAGKIEVMENERVHFEARILPANDVKMTVEWYHNGNPLPAAHRFHPMFDFGYVALDLLYAYPQDSGTYTLVARNELGEARSN-VELVVGTEKVLYLEPHHP-EGLERIKELEQDRRQGIAEVEDR-----TCDAAPKFLNDLPDIQLNEHENIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQCVITVTP 1555          

HSP 8 Score: 135.191 bits (339), Expect = 7.177e-32
Identity = 83/230 (36.09%), Postives = 124/230 (53.91%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVAN--EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            +PP+FV  P +  + +  EG+P  L  +V P  D +L + W +DG  L  G RF T ++ GF  LDIL  + +D+G Y+C A+N+ G  +T  +T+     ++++     P+     I  IEA    P  Q++  D P +PP FVK +        G +V+LE +V P  D+SL  EW  NG+PL    RF +  D G+  L+I+    ED G Y    RN+AG+AQS V
Sbjct: 1593 EPPTFVV-PLQADLGDVEEGEPIHLECQVNPINDNSLKIIWLRDGQSLPHGHRFRTFYDFGFVSLDILGFYAQDAGTYTCRAENSLGQAETV-ATIRCAPKDAILGAVQHPRSYAR-IQEIEAP--KPAPQEVP-DLPHQPPAFVKQLGPAIQCMEGDNVYLEAQVTPTDDNSLTYEWLVNGQPLMKAHRFVLSQDFGYIALNILYCYPEDNGTYTLVVRNRAGEAQSTV 1816          

HSP 9 Score: 130.954 bits (328), Expect = 1.274e-30
Identity = 121/427 (28.34%), Postives = 197/427 (46.14%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF--LVKVSGYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFI-VVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPS 2089
            PP FV          EG P+   A+ IP  DP  +VQWY +G PL+A SR     + G   LD+ YT  ED+GEYS V KN+ G D+TS   L+     +++ ++   Q   + I  IEA    P+      + P+   P FV+P+  + +L  G    LE R++P+ D +L ++WF N +PL      +   D G   L I  V +  TG Y C A N +G A ++   + V   E ++  +  P  S+Q +Q L+ I     +D     YE+ +  +   +++       V EG       LV+ SG P  +++W LN   L      ++ Y  G+ + L      +P +S +    A N  GEA  +AT++                 IL  +++P  + ++  L+   +  E++   +K KP+
Sbjct: 2521 PPKFVTQLHSLDGVVEGQPSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVVKNSEGEDRTS-GQLSCTTRAAILGDTQHEQSW-QRIQEIEA----PRAPGAEPEGPVYEKPSFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYARHTGVYSCKAWNDSGNAVTS-ANVGVQGSEGLLLDTSHPA-SLQKIQELEAIDKYARLDAPEREYEKPQWVQGFENYE------NVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGN-AILTIVHV-LPHDSGVYTCRAWNTQGEASTSATVTTAGYE-----------KILYDSQHPVSWERIQELEAPKIVEEIEEIVQKEKPN 2920          

HSP 10 Score: 125.561 bits (314), Expect = 6.742e-29
Identity = 79/214 (36.92%), Postives = 114/214 (53.27%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            +E     L A+V P  D  L  +W  +G PL A SR+    + GF  LDI Y   EDSG+Y+ V  N+ G  +TS     V+  +S++ ++  P+ +   I  +E  L   K  D   DA  +PP F + + G    L+ GQSVH++  V PI D SL IEWF +GRPL  G R   + D G+  L+ + +  EDTG Y C A N  G+A +++
Sbjct: 1874 HESQTLHLEAQVTPIDDNTLRYEWLFNGNPLKASSRYRVLNDFGFVSLDIDYIIAEDSGKYTLVVYNSAGRAETS-CEFQVDRLKSILSDTAHPESL-RRIREME-QLQPAKPSDD--DAAAQPPVFTQQLTGPTEPLKEGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIGEATTDI 2082          

HSP 11 Score: 123.25 bits (308), Expect = 3.844e-28
Identity = 89/265 (33.58%), Postives = 133/265 (50.19%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIR---PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDI 1603
            + + PSFV+  +      EG  A L AR++P  DPNL VQW+ +  PL   +  +TS + G   L I   +   +G YSC A N+ G   TS + + V   E ++L++  P  + + I  +EA     +     +DAP R    PQ+V+      N+  GQ+V L   V P  D  L +EW  NG PL N  RF   ++ G AIL I+ V+  D+G Y C A N  G+A ++   +  A  E ++  SQ P   E +Q L++  I
Sbjct: 2650 VYEKPSFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYARHTGVYSCKAWNDSGNAVTS-ANVGVQGSEGLLLDTSHPASL-QKIQELEAIDKYAR-----LDAPEREYEKPQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTSAT-VTTAGYEKILYDSQHPVSWERIQELEAPKI 2906          

HSP 12 Score: 122.479 bits (306), Expect = 6.212e-28
Identity = 103/334 (30.84%), Postives = 144/334 (43.11%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXX------------XXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVI 1795
            PSF +        NE D  +    + P GDP L VQW  +G P+   +R + + E G A L I +    D+GEY CVA N  G   TS   +                       A+E+S          IDAP    Q V     + N+  G S+HLE RV PI D  L +EW +NG PL    RF   F+ GF  LDI+    ED GDY    RN  G+A+S        T+ TV     LP+ S+ Y  S    N +D   S+F+   +              ++  P F  +  N+ V EG   RF  +V+    P  +++WF ++  V+
Sbjct: 3720 PSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKG-SATSVGKI-----------------------AVESS--------TQIDAPQVVQQLVD---SVENILEGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSK-------TKITV-----LPRPSLDYT-SQTHGNQQDSLESHFKQHSQAKLQLTANDIYNESDKRAPEFRTQLQNIGVLEGEFCRFETQVAPINDPYLKVEWFKDKKPVL 4005          

HSP 13 Score: 120.168 bits (300), Expect = 2.688e-27
Identity = 96/363 (26.45%), Postives = 167/363 (46.01%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT---VEEGNPARFLVKVSGYPRPQ--IQWFLN-ECLVIPTSIQKVYSDGSISY-LEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            EG    +   V P  DP+L ++W+ DG PL  GSR  T  + G+  L+ L+   ED+G Y+C A N  G      +T ++ L+     N +L      S   I+   N    ++   +   +PP F + +    + Q GQS+ LE R+IP+ D ++ + W +NG+PL    RF    +  +  LDI+ +  ED+G Y C A +  G+A ++      A +  ++           + +  +I+N E ++  +      E  ++ P F +  +N +   ++EG P     +V      Q  +QWF N + L      +  +  G ++  + +   +  GE   V  A+N LGEA   A  +V+P
Sbjct: 2008 EGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIGE-----ATTDIFLECKPRRNIYLDTHHESSWQKIQEIENRVDEREPTPELTFQPPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYTCKAVSAFGEAATSCTVKCAAGKSLLLDT----MHDASWKRVQEIENREKLEAVD-----AEPEKTAPKF-VTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACV--ARNSLGEAQTIANFTVLP 2353          

HSP 14 Score: 117.472 bits (293), Expect = 2.187e-26
Identity = 106/371 (28.57%), Postives = 161/371 (43.40%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF--LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +V+  E Y+   EG   +L   V P+GDP+L ++W  +G PL   +RF   +E G AIL I++    DSG Y+C A N  G   TS +T+     E ++ +S  P    E I  +EA    PK  ++I        P F+  +    N+  G  +HLE+   P  D  L + W KNG+PL          + G+A LDI     +  G Y     N  G+A S    + VA    ++  ++  +ES + +Q L+     + +     Y+       +   D K  N    EG+   F  L+     PR Q+QW  N   +   S   +  D  I  L+        E    +   N  GEAV++ATL  
Sbjct: 2787 PQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTS-ATVTTAGYEKILYDSQHPVSW-ERIQELEA----PKIVEEIEEIVQKEKPNFLTQLESAENVPEGVPLHLESTFQPARDPELKVVWQKNGQPLGASQLVQTKHELGWATLDISSANEDHNGVYTLTITNSEGEAVS-TASIRVAGTGPILGNTRH-EESWKRIQILEAPKEAEPEAPAPVYDHPAITTQI---DDKECN----EGDHVHFEALITPVNDPRLQVQWIRNGVPLAHGSKYAIQQDFGICTLDVAYTYPEDEGVYQLRIWNPEGEAVSSATLKC 3142          

HSP 15 Score: 101.293 bits (251), Expect = 2.016e-21
Identity = 69/241 (28.63%), Postives = 112/241 (46.47%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRP-PQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL 1597
            EG  A L  +V P  DP L ++W+ +G P+   +R     + GF +L +     +DSG ++C A N  G D+ S + L V     V        E  E I  +E  ++ PK +D+++ A   P P F + +  L  L    +      + PI D +L ++W  NG P+    R +   + G A L I  +I+ D G+Y C A N  G A S  V  +     T +   Q+ Q+ V  ++++
Sbjct: 3598 EGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHGSDEVS-TELKVVGGGGVSYEWQSTAERKERITELEDWIHRPK-EDLNLPAVDYPAPSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKGSATS--VGKIAVESSTQIDAPQVVQQLVDSVENI 3834          

HSP 16 Score: 98.5969 bits (244), Expect = 1.452e-20
Identity = 92/353 (26.06%), Postives = 143/353 (40.51%), Query Frame = 2
Query:  887 PASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRC--KIPGESFIVVSAKNKLGEAVANATLSV 1939
            PA  + ++   G+P  T+QW+KDG PL    RF    E G   L        D+G Y  VAKN  G +    + LNVNL ++         +  E     EA   T + Q I +D                    G+      +     D +  I W++N  P+ +   + I   +G AIL I    +ED  +Y   A N AG+A S+V  L++      + KS + +      QS D                 +     PHF  K  +++  +G+  +F  +V G P P +QW      +  ++  K+  DG  + LE  R      GE  IV+  +N  G A + A L++
Sbjct: 4661 PAEFSCQI--GGEPKPTIQWFKDGQPLPNDDRFQVVEEGGAYKLKFSNIISTDAGIYEIVAKNGVG-EARCKARLNVNLQKT--------GKGAEEGPRYEAPRFTSQIQPIVVDE-------------------GKGAQFSAQFSGFPDPT--IRWYRNNEPVKHADGYEISQSKGEAILRISAARNEDVAEYKVEASNPAGKA-SSVANLVLTPRSGRIAKSTISRGGSASYQSSD-----------------KAAADSPHFIAKLSDISARQGHTVKFSAEVDGNPEPTVQWQFKGKPISASNNVKISRDGKRAILELARVTPDSAGEYQIVI--RNDKGAATSQAKLTL 4961          

HSP 17 Score: 95.9005 bits (237), Expect = 9.113e-20
Identity = 67/218 (30.73%), Postives = 96/218 (44.04%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            R Q   EG    L  ++ P  DP+L V W  DG  L +  ++  +   GFA LDI  T   DSG YSC A N  G  +   + + V   +      H  Q   E +  I+ + +   +QD+        P+F+  +   +  Q       E R+ PI D +L + W K+G+PL N  R  I  + G   L +     ED G Y C   N  GQAQS+ 
Sbjct: 1072 RSQEVFEGQQIHLETKLTPINDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLGESENQATIIIVPKSDLQQFEQHR-QLDVEDVREIQFAHS---SQDL-------TPKFLSQIQPFHCEQELGRSFFEARIQPINDPTLRVSWLKDGQPLPNANRIQIFQNFGVVSLSLHPTYPEDAGVYTCVLFNSHGQAQSSA 1278          

HSP 18 Score: 85.8853 bits (211), Expect = 1.007e-16
Identity = 72/256 (28.12%), Postives = 113/256 (44.14%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQ---DIHIDAP-----IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDV 1621
            EG  A L  +  P  DPNL + W  +G  + A SR  T  + G A L+I      D GEY+ VA N  G  + S +        +V+ +    Q+          +  +   Q     H+D P     +R  +  +          GQ +HLET++ PI D  L + W  +G  L +  ++      GFA LDI    S D+G Y C A NK G++++    +       +V KS L Q+  Q+ Q LD+++  ++
Sbjct:  950 EGQSARLEIKYTPVEDPNLRIAWLLNGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANI-------AVIGHGSFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNFHSDLRSQEVFE----------GQQIHLETKLTPINDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLGESENQATII-------IVPKSDL-QQFEQHRQ-LDVEDVREI 1179          

HSP 19 Score: 67.3958 bits (163), Expect = 4.975e-11
Identity = 92/375 (24.53%), Postives = 156/375 (41.60%), Query Frame = 2
Query:  920 GDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRP--PQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDII--GVISEDTGDYFCFARNKAGQAQSNVVRL-------LVATEETVVTKSQLPQESVQYLQSLDIQNTE------DVDRS----NFRYXXXXXXXSLPHFD-----IKPI------NLTVEEGNPARFLVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            G P+  ++W KDG  ++    +    +     L I      DSG ++  A N+ G  Q++           +++ +  P  +  + +A+ AS   P+T       P+ P  P F+K +     L+ G  V  E RVI +   +  IEW KNG+PL N  R  I  D+   I+ +I   + ++D G+Y   A N  G+A S    L         + E+T +TK +      Q L+   +   +      D D+     ++   E E    L   D      KPI       L + EG  A     + G P+P+IQW  N   L +     ++   GS++ L+             V+++N+ G+  ++A + V P
Sbjct:   43 GHPDPAIKWLKDGHNVSMCPDYRIEEDGLKHRLVIPQVQAADSGRFTAQASNSAGTKQST----------CILICAPAPTPVPGAKSAV-ASPAPPQT-------PVGPSAPIFLKELRH-QPLKPGAGVTFEGRVIAVPPPN--IEWMKNGKPLQN-YRAKIEHDQKTGIISLIIPQMFNDDAGEYTIKATNVHGEAISGAQLLPREQYDRWFSNEQTRLTKDRKQGLLSQTLRPSSVAQKQMQKQGYDTDQGSVDMHWTISESETEPELSALDARGVGTKPIIRTPLRGLRLTEGTDAILQANIVGNPKPRIQWLFNGRPLQVSGPRMQMTYKGSMAVLKISMVTTEEAGDYTVASENRFGKVESSARIEVYP 395          

HSP 20 Score: 67.3958 bits (163), Expect = 5.017e-11
Identity = 89/369 (24.12%), Postives = 146/369 (39.57%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ--NTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQ--WFL--NECLVIPTS--IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            +GD   L  +    G   ++ +W+KD  P+++G  +    +     L I     ++ G Y C A N  G   T    + VN  +     +H        +  +E S  TP  Q   + A    P+F   +     L  GQS  LE +  P+ D +L I W  NG+ +    R     D G A L+I  V   D G+Y   A N  G+A+ +    ++     +  +    Q      QS   Q      +D  NF            H D++  +  V EG       K++    P ++  W L  NE   +P++   ++  S G  S L+  +            A NKLGE+   AT+ ++P++D +
Sbjct:  819 DGDSVKLYCKAAGEG---VSFKWFKDNEPISSGGSYAVDNKGNETTLHINNATMKEGGWYRCDATNKHGT-TTLKGRVVVNSRQKFNGPAHREMITLRKVDKVERS-RTPVNQLQDVSASKSSPKFEGSLQS-QQLVEGQSARLEIKYTPVEDPNLRIAWLLNGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANIAVIGHGSFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNF------------HSDLR--SQEVFEGQQIHLETKLTPINDPDLRVVWLLDGNE---LPSNDKYRQTLSHGFAS-LDIPQTSSNDSGLYSCRAFNKLGESENQATIIIVPKSDLQ 1163          
BLAST of Titin vs. Ensembl Celegans
Match: ketn-1 (KETtiN (Drosophila actin-binding) homolog; Kettin [Source:UniProtKB/TrEMBL;Acc:Q9NL87])

HSP 1 Score: 202.986 bits (515), Expect = 2.146e-53
Identity = 130/377 (34.48%), Postives = 191/377 (50.66%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS--------PS---TLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXX-----XXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            EGD   L  RV P  DP L V+W ++G PL   SRF  +FE GF  LDILY + ED+G+Y  V +N+ G  ++         PS   T   + ++   L SH  Q    S A ++ + N     DI+ ++  R P+F   +  +  L+ G+    ET+V PI D  L +EWFK+ +P+  G RF    D GFA LD++  + +DTG+Y C A N+ GQ   +  +L       V+T SQ+P       Q L + N +  D  N  + E+      + +  P F I   NL V E  PARF   V+GYPRP++ WF+N    +     K+  DG + YL   + +I     +V  A+N  GE ++ ATL +   +DFR
Sbjct: 3836 EGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSKTKITVLPRPSLDYTSQTHGNQQDSLESHFKQ---HSQAKLQLTAN-----DIYNESDKRAPEFRTQLQNIGVLE-GEFCRFETQVAPINDPYLKVEWFKDKKPVLLGHRFRSTLDFGFACLDLLYALPDDTGEYHCVATNRHGQTMIS-AKLACQGASHVITDSQMP-------QGLRVSNVKK-DNKNIYWSEQGGAVQPKQKQAPQFTIPLRNLQVTENQPARFECAVTGYPRPKVTWFINGNQCLHGHRFKLNFDG-LHYLTVSKSRISDAGEVVAIARNTEGETISTATLDIFQNDDFR 4193          

HSP 2 Score: 165.622 bits (418), Expect = 1.924e-41
Identity = 118/359 (32.87%), Postives = 180/359 (50.14%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEA-SLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGY--PRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRC--KIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG P  L A+V P  D  LTVQW+ +G PLA G RF T  + G+  LDILY F +D+GE++CVA+N+ G  QT  +   V    ++  +S  P E  + I  +EA     P+  D   DA    PQF++P+  +  ++  QS H +T+V P TD +L I+WFK+G+PL N  RF +  D G+  LDI   + ED+G Y   A N  G A+  V   L  T   V+      ++S Q +Q ++       +  + ++   +    L   D       V EG P+ F  +   +  P+  +QW+LN   +  +S + + +D  +  L+ Q    +  GE  +VV  KN  GE   +  LS 
Sbjct: 2273 EGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQTI-ANFTVLPRGTIYTDSQHP-ESWQKIQVLEAPRAAAPEKPDAEHDA----PQFIEPLDSIDRME-FQSAHFQTKVTPQTDPNLRIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHTVPEDSGVYSVKASNAKGDAE--VQAQLTVTGNAVILGDTQHEQSWQKIQLIEAPRAPGEEEPDVKHGPPKFVTQLHSLD------GVVEGQPSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVV--KNSEGEDRTSGQLSC 2614          

HSP 3 Score: 160.229 bits (404), Expect = 8.974e-40
Identity = 119/374 (31.82%), Postives = 187/374 (50.00%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPM-PGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN-LTVEEGNPARFLVKVSGYPRP--QIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIV-VSAKNKLGEAVANATLSV 1939
            PP+F ++    + A EG    L  R+IP  DP + V W ++G PL   SRF  +    +  LDIL  + EDSG Y+C A + FG   TS  T+     +S++L++ +     + +  IE   N  K + +  +     P+FV  +   L  LQ G  +HLE +V P  D+ L ++WF NG+PL NG RF    D G+  LDI+   ++DTG++ C ARN  G+AQ+ +    V    T+ T SQ P ES Q +Q L+       ++ +  +         P F I+P++ +   E   A F  KV+    P  +IQWF +   ++ ++  K+ +D     L+     +P +S +  V A N  G+A   A L+V
Sbjct: 2125 PPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYTCKAVSAFGEAATS-CTVKCAAGKSLLLDT-MHDASWKRVQEIE---NREKLEAVDAEPEKTAPKFVTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQT-IANFTVLPRGTIYTDSQHP-ESWQKIQVLEAPRAAAPEKPDAEH-------DAPQF-IEPLDSIDRMEFQSAHFQTKVTPQTDPNLRIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHT-VPEDSGVYSVKASNAKGDAEVQAQLTV 2482          

HSP 4 Score: 149.058 bits (375), Expect = 3.102e-36
Identity = 125/423 (29.55%), Postives = 200/423 (47.28%), Query Frame = 2
Query:  695 FEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTV--EEGNPARFLVKVS--GYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
             EAP +K++        PPRF                   + ++T P S V          E  PA   A V P  DP LT+ W+ +G P++A SR     + G+ I+DI  T   DSGE+ CVAKN  G +  S +T+ V   E ++ +S  PQ + + I  IEA    P+ +    D     P  V  +     L+ G S HL+T+  P+ D S+ +EW K+G+P+ +  R+ +V D GFA+LDI+ ++  D G+Y     N +G+A S      V+    ++ + Q  Q++    ++++I   ED  R      E+E  E+ P F I+P++  V  EEG  A F  +       + Q+QW+ +   L   + I+ + S G +  LE            +  A N++GEAV +  L+  P+
Sbjct: 3164 IEAPKQKLEEADPEPKGPPRF-------------------IQQLTSPGSLV----------ENQPAHFEATVEPVDDPTLTINWFLNGEPMSASSRVKMINDFGWVIMDIAQTEPRDSGEWKCVAKNAAG-EAVSTATIEVQGKEVILQDSLQPQSL-DRIRQIEAGKPAPEERP---DQQFEAPAIVNALQVQGALEEGGSAHLQTQFTPVADPSIKVEWLKDGQPIFHSNRYKMVHDFGFAVLDILHLLKHDAGEYTFRVSNNSGEA-STSTSFEVSESSGLILQPQNEQKA----KAVEI--LEDNLRRRPEEIEQELKEATPVF-IEPLSAPVETEEGGRAHFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYV-VLEISPTYPEDNGEYICRAVNRVGEAVTSTKLTCTPK 3543          

HSP 5 Score: 147.132 bits (370), Expect = 1.132e-35
Identity = 85/209 (40.67%), Postives = 111/209 (53.11%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTES---IAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            EG  A  TAR  P  D  L VQWY DG PL  GSR  T    G+ +L+I  T+ ED+GEY C A N  G   TS + L     E ++  + LP+ M  +   IA IEA    P  +D   DA   PP+F   + G   LQ GQ  HLE +V P+ D  LVIEWF NG+P+N+  R   + D GF +L +     +D+G + C A N+ G
Sbjct: 3462 EGGRAHFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYVVLEISPTYPEDNGEYICRAVNRVGEAVTS-TKLTCTPKEGIISATQLPERMANAGRRIAEIEAP--RPAREDAP-DADHGPPKFTSALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHG 3666          

HSP 6 Score: 142.895 bits (359), Expect = 3.025e-34
Identity = 84/244 (34.43%), Postives = 133/244 (54.51%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASL--NTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA-QSNVVRLLVATEETVVTKSQLPQESVQYLQSLD 1600
            E +     AR++PA D  +TV+WY +G PL A  RF+  F+ G+  LD+LY + +DSG Y+ VA+N  G +  S   L V  ++ + L  H P+ + E I  +E        + +D   DA    P+F+  +P +  L   +++H++ R  P+ D ++VIEWF NGRPL  G R   + + GF  LDI G I+ED+G Y   A N  G+A +  V+ +  A +    T+ Q     + YL++L+
Sbjct: 1342 ENERVHFEARILPANDVKMTVEWYHNGNPLPAAHRFHPMFDFGYVALDLLYAYPQDSGTYTLVARNELG-EARSNVELVVGTEKVLYLEPHHPEGL-ERIKELEQDRRQGIAEVEDRTCDA---APKFLNDLPDI-QLNEHENIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQCVITVTPAGQILSDTQHQESLGKINYLENLN 1579          

HSP 7 Score: 139.428 bits (350), Expect = 3.683e-33
Identity = 103/382 (26.96%), Postives = 168/382 (43.98%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHI-----DAP-----IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            P F+   + +    E   +   AR+ P  DP L V W KDG PL   +R       G   L +  T+ ED+G Y+CV  N+ G  Q+S     V +D   + + H      +S+  I        +  IHI     + P     +  P+F + + G   +   + VH E R++P  D  + +EW+ NG PL    RF+ +FD G+  LD++    +D+G Y   ARN+ G+A+SN V L+V TE+ +  +   P E ++ ++ L+    + +     R       ++ P F  D+  I L   E             P   I+WF+N   ++  S  K  ++     L+ +           V A N LGEA+    ++V P
Sbjct: 1190 PKFLSQIQPFHCEQELGRSFFEARIQPINDPTLRVSWLKDGQPLPNANRIQIFQNFGVVSLSLHPTYPEDAGVYTCVLFNSHGQAQSSAELTTVWIDTLQLDSKH-----ADSLPII----GYLDSHQIHIGPQSVERPEEFNSLEAPKFARELAGKIEVMENERVHFEARILPANDVKMTVEWYHNGNPLPAAHRFHPMFDFGYVALDLLYAYPQDSGTYTLVARNELGEARSN-VELVVGTEKVLYLEPHHP-EGLERIKELEQDRRQGIAEVEDR-----TCDAAPKFLNDLPDIQLNEHENIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQCVITVTP 1555          

HSP 8 Score: 135.191 bits (339), Expect = 7.615e-32
Identity = 83/230 (36.09%), Postives = 124/230 (53.91%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVAN--EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            +PP+FV  P +  + +  EG+P  L  +V P  D +L + W +DG  L  G RF T ++ GF  LDIL  + +D+G Y+C A+N+ G  +T  +T+     ++++     P+     I  IEA    P  Q++  D P +PP FVK +        G +V+LE +V P  D+SL  EW  NG+PL    RF +  D G+  L+I+    ED G Y    RN+AG+AQS V
Sbjct: 1593 EPPTFVV-PLQADLGDVEEGEPIHLECQVNPINDNSLKIIWLRDGQSLPHGHRFRTFYDFGFVSLDILGFYAQDAGTYTCRAENSLGQAETV-ATIRCAPKDAILGAVQHPRSYAR-IQEIEAP--KPAPQEVP-DLPHQPPAFVKQLGPAIQCMEGDNVYLEAQVTPTDDNSLTYEWLVNGQPLMKAHRFVLSQDFGYIALNILYCYPEDNGTYTLVVRNRAGEAQSTV 1816          

HSP 9 Score: 130.954 bits (328), Expect = 1.411e-30
Identity = 121/427 (28.34%), Postives = 197/427 (46.14%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF--LVKVSGYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFI-VVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPS 2089
            PP FV          EG P+   A+ IP  DP  +VQWY +G PL+A SR     + G   LD+ YT  ED+GEYS V KN+ G D+TS   L+     +++ ++   Q   + I  IEA    P+      + P+   P FV+P+  + +L  G    LE R++P+ D +L ++WF N +PL      +   D G   L I  V +  TG Y C A N +G A ++   + V   E ++  +  P  S+Q +Q L+ I     +D     YE+ +  +   +++       V EG       LV+ SG P  +++W LN   L      ++ Y  G+ + L      +P +S +    A N  GEA  +AT++                 IL  +++P  + ++  L+   +  E++   +K KP+
Sbjct: 2521 PPKFVTQLHSLDGVVEGQPSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVVKNSEGEDRTS-GQLSCTTRAAILGDTQHEQSW-QRIQEIEA----PRAPGAEPEGPVYEKPSFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYARHTGVYSCKAWNDSGNAVTS-ANVGVQGSEGLLLDTSHPA-SLQKIQELEAIDKYARLDAPEREYEKPQWVQGFENYE------NVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGN-AILTIVHV-LPHDSGVYTCRAWNTQGEASTSATVTTAGYE-----------KILYDSQHPVSWERIQELEAPKIVEEIEEIVQKEKPN 2920          

HSP 10 Score: 125.561 bits (314), Expect = 7.152e-29
Identity = 79/214 (36.92%), Postives = 114/214 (53.27%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            +E     L A+V P  D  L  +W  +G PL A SR+    + GF  LDI Y   EDSG+Y+ V  N+ G  +TS     V+  +S++ ++  P+ +   I  +E  L   K  D   DA  +PP F + + G    L+ GQSVH++  V PI D SL IEWF +GRPL  G R   + D G+  L+ + +  EDTG Y C A N  G+A +++
Sbjct: 1874 HESQTLHLEAQVTPIDDNTLRYEWLFNGNPLKASSRYRVLNDFGFVSLDIDYIIAEDSGKYTLVVYNSAGRAETS-CEFQVDRLKSILSDTAHPESL-RRIREME-QLQPAKPSDD--DAAAQPPVFTQQLTGPTEPLKEGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIGEATTDI 2082          

HSP 11 Score: 122.865 bits (307), Expect = 3.975e-28
Identity = 89/265 (33.58%), Postives = 133/265 (50.19%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIR---PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDI 1603
            + + PSFV+  +      EG  A L AR++P  DPNL VQW+ +  PL   +  +TS + G   L I   +   +G YSC A N+ G   TS + + V   E ++L++  P  + + I  +EA     +     +DAP R    PQ+V+      N+  GQ+V L   V P  D  L +EW  NG PL N  RF   ++ G AIL I+ V+  D+G Y C A N  G+A ++   +  A  E ++  SQ P   E +Q L++  I
Sbjct: 2650 VYEKPSFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYARHTGVYSCKAWNDSGNAVTS-ANVGVQGSEGLLLDTSHPASL-QKIQELEAIDKYAR-----LDAPEREYEKPQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTSAT-VTTAGYEKILYDSQHPVSWERIQELEAPKI 2906          

HSP 12 Score: 122.094 bits (305), Expect = 6.820e-28
Identity = 103/334 (30.84%), Postives = 144/334 (43.11%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXX------------XXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVI 1795
            PSF +        NE D  +    + P GDP L VQW  +G P+   +R + + E G A L I +    D+GEY CVA N  G   TS   +                       A+E+S          IDAP    Q V     + N+  G S+HLE RV PI D  L +EW +NG PL    RF   F+ GF  LDI+    ED GDY    RN  G+A+S        T+ TV     LP+ S+ Y  S    N +D   S+F+   +              ++  P F  +  N+ V EG   RF  +V+    P  +++WF ++  V+
Sbjct: 3720 PSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKG-SATSVGKI-----------------------AVESS--------TQIDAPQVVQQLVD---SVENILEGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSK-------TKITV-----LPRPSLDYT-SQTHGNQQDSLESHFKQHSQAKLQLTANDIYNESDKRAPEFRTQLQNIGVLEGEFCRFETQVAPINDPYLKVEWFKDKKPVL 4005          

HSP 13 Score: 120.168 bits (300), Expect = 2.851e-27
Identity = 96/363 (26.45%), Postives = 167/363 (46.01%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT---VEEGNPARFLVKVSGYPRPQ--IQWFLN-ECLVIPTSIQKVYSDGSISY-LEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            EG    +   V P  DP+L ++W+ DG PL  GSR  T  + G+  L+ L+   ED+G Y+C A N  G      +T ++ L+     N +L      S   I+   N    ++   +   +PP F + +    + Q GQS+ LE R+IP+ D ++ + W +NG+PL    RF    +  +  LDI+ +  ED+G Y C A +  G+A ++      A +  ++    +   S + +Q ++       +R      + E  ++ P F +  +N +   ++EG P     +V      Q  +QWF N + L      +  +  G ++  + +   +  GE   V  A+N LGEA   A  +V+P
Sbjct: 2008 EGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIG-----EATTDIFLECKPRRNIYLDTHHESSWQKIQEIENRVDEREPTPELTFQPPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYTCKAVSAFGEAATSCTVKCAAGKSLLL--DTMHDASWKRVQEIE-------NREKLEAVDAEPEKTAPKF-VTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACV--ARNSLGEAQTIANFTVLP 2353          

HSP 14 Score: 117.087 bits (292), Expect = 2.380e-26
Identity = 106/371 (28.57%), Postives = 161/371 (43.40%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF--LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +V+  E Y+   EG   +L   V P+GDP+L ++W  +G PL   +RF   +E G AIL I++    DSG Y+C A N  G   TS +T+     E ++ +S  P    E I  +EA    PK  ++I        P F+  +    N+  G  +HLE+   P  D  L + W KNG+PL          + G+A LDI     +  G Y     N  G+A S    + VA    ++  ++  +ES + +Q L+     + +     Y+       +   D K  N    EG+   F  L+     PR Q+QW  N   +   S   +  D  I  L+        E    +   N  GEAV++ATL  
Sbjct: 2787 PQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTS-ATVTTAGYEKILYDSQHPVSW-ERIQELEA----PKIVEEIEEIVQKEKPNFLTQLESAENVPEGVPLHLESTFQPARDPELKVVWQKNGQPLGASQLVQTKHELGWATLDISSANEDHNGVYTLTITNSEGEAVS-TASIRVAGTGPILGNTRH-EESWKRIQILEAPKEAEPEAPAPVYDHPAITTQI---DDKECN----EGDHVHFEALITPVNDPRLQVQWIRNGVPLAHGSKYAIQQDFGICTLDVAYTYPEDEGVYQLRIWNPEGEAVSSATLKC 3142          

HSP 15 Score: 101.293 bits (251), Expect = 2.212e-21
Identity = 69/241 (28.63%), Postives = 112/241 (46.47%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRP-PQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL 1597
            EG  A L  +V P  DP L ++W+ +G P+   +R     + GF +L +     +DSG ++C A N  G D+ S + L V     V        E  E I  +E  ++ PK +D+++ A   P P F + +  L  L    +      + PI D +L ++W  NG P+    R +   + G A L I  +I+ D G+Y C A N  G A S  V  +     T +   Q+ Q+ V  ++++
Sbjct: 3598 EGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHGSDEVS-TELKVVGGGGVSYEWQSTAERKERITELEDWIHRPK-EDLNLPAVDYPAPSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKGSATS--VGKIAVESSTQIDAPQVVQQLVDSVENI 3834          

HSP 16 Score: 98.2117 bits (243), Expect = 1.553e-20
Identity = 92/353 (26.06%), Postives = 143/353 (40.51%), Query Frame = 2
Query:  887 PASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRC--KIPGESFIVVSAKNKLGEAVANATLSV 1939
            PA  + ++   G+P  T+QW+KDG PL    RF    E G   L        D+G Y  VAKN  G +    + LNVNL ++         +  E     EA   T + Q I +D                    G+      +     D +  I W++N  P+ +   + I   +G AIL I    +ED  +Y   A N AG+A S+V  L++      + KS + +      QS D                 +     PHF  K  +++  +G+  +F  +V G P P +QW      +  ++  K+  DG  + LE  R      GE  IV+  +N  G A + A L++
Sbjct: 4620 PAEFSCQI--GGEPKPTIQWFKDGQPLPNDDRFQVVEEGGAYKLKFSNIISTDAGIYEIVAKNGVG-EARCKARLNVNLQKT--------GKGAEEGPRYEAPRFTSQIQPIVVDE-------------------GKGAQFSAQFSGFPDPT--IRWYRNNEPVKHADGYEISQSKGEAILRISAARNEDVAEYKVEASNPAGKA-SSVANLVLTPRSGRIAKSTISRGGSASYQSSD-----------------KAAADSPHFIAKLSDISARQGHTVKFSAEVDGNPEPTVQWQFKGKPISASNNVKISRDGKRAILELARVTPDSAGEYQIVI--RNDKGAATSQAKLTL 4920          

HSP 17 Score: 95.9005 bits (237), Expect = 9.747e-20
Identity = 67/218 (30.73%), Postives = 96/218 (44.04%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            R Q   EG    L  ++ P  DP+L V W  DG  L +  ++  +   GFA LDI  T   DSG YSC A N  G  +   + + V   +      H  Q   E +  I+ + +   +QD+        P+F+  +   +  Q       E R+ PI D +L + W K+G+PL N  R  I  + G   L +     ED G Y C   N  GQAQS+ 
Sbjct: 1072 RSQEVFEGQQIHLETKLTPINDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLGESENQATIIIVPKSDLQQFEQHR-QLDVEDVREIQFAHS---SQDL-------TPKFLSQIQPFHCEQELGRSFFEARIQPINDPTLRVSWLKDGQPLPNANRIQIFQNFGVVSLSLHPTYPEDAGVYTCVLFNSHGQAQSSA 1278          

HSP 18 Score: 85.8853 bits (211), Expect = 1.006e-16
Identity = 72/256 (28.12%), Postives = 113/256 (44.14%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQ---DIHIDAP-----IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDV 1621
            EG  A L  +  P  DPNL + W  +G  + A SR  T  + G A L+I      D GEY+ VA N  G  + S +        +V+ +    Q+          +  +   Q     H+D P     +R  +  +          GQ +HLET++ PI D  L + W  +G  L +  ++      GFA LDI    S D+G Y C A NK G++++    +       +V KS L Q+  Q+ Q LD+++  ++
Sbjct:  950 EGQSARLEIKYTPVEDPNLRIAWLLNGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANI-------AVIGHGSFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNFHSDLRSQEVFE----------GQQIHLETKLTPINDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLGESENQATII-------IVPKSDL-QQFEQHRQ-LDVEDVREI 1179          

HSP 19 Score: 67.3958 bits (163), Expect = 5.101e-11
Identity = 89/369 (24.12%), Postives = 146/369 (39.57%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ--NTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQ--WFL--NECLVIPTS--IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            +GD   L  +    G   ++ +W+KD  P+++G  +    +     L I     ++ G Y C A N  G   T    + VN  +     +H        +  +E S  TP  Q   + A    P+F   +     L  GQS  LE +  P+ D +L I W  NG+ +    R     D G A L+I  V   D G+Y   A N  G+A+ +    ++     +  +    Q      QS   Q      +D  NF            H D++  +  V EG       K++    P ++  W L  NE   +P++   ++  S G  S L+  +            A NKLGE+   AT+ ++P++D +
Sbjct:  819 DGDSVKLYCKAAGEG---VSFKWFKDNEPISSGGSYAVDNKGNETTLHINNATMKEGGWYRCDATNKHGT-TTLKGRVVVNSRQKFNGPAHREMITLRKVDKVERS-RTPVNQLQDVSASKSSPKFEGSLQS-QQLVEGQSARLEIKYTPVEDPNLRIAWLLNGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANIAVIGHGSFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNF------------HSDLR--SQEVFEGQQIHLETKLTPINDPDLRVVWLLDGNE---LPSNDKYRQTLSHGFAS-LDIPQTSSNDSGLYSCRAFNKLGESENQATIIIVPKSDLQ 1163          

HSP 20 Score: 67.3958 bits (163), Expect = 5.276e-11
Identity = 92/375 (24.53%), Postives = 156/375 (41.60%), Query Frame = 2
Query:  920 GDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRP--PQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDII--GVISEDTGDYFCFARNKAGQAQSNVVRL-------LVATEETVVTKSQLPQESVQYLQSLDIQNTE------DVDRS----NFRYXXXXXXXSLPHFD-----IKPI------NLTVEEGNPARFLVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            G P+  ++W KDG  ++    +    +     L I      DSG ++  A N+ G  Q++           +++ +  P  +  + +A+ AS   P+T       P+ P  P F+K +     L+ G  V  E RVI +   +  IEW KNG+PL N  R  I  D+   I+ +I   + ++D G+Y   A N  G+A S    L         + E+T +TK +      Q L+   +   +      D D+     ++   E E    L   D      KPI       L + EG  A     + G P+P+IQW  N   L +     ++   GS++ L+             V+++N+ G+  ++A + V P
Sbjct:   43 GHPDPAIKWLKDGHNVSMCPDYRIEEDGLKHRLVIPQVQAADSGRFTAQASNSAGTKQST----------CILICAPAPTPVPGAKSAV-ASPAPPQT-------PVGPSAPIFLKELRH-QPLKPGAGVTFEGRVIAVPPPN--IEWMKNGKPLQN-YRAKIEHDQKTGIISLIIPQMFNDDAGEYTIKATNVHGEAISGAQLLPREQYDRWFSNEQTRLTKDRKQGLLSQTLRPSSVAQKQMQKQGYDTDQGSVDMHWTISESETEPELSALDARGVGTKPIIRTPLRGLRLTEGTDAILQANIVGNPKPRIQWLFNGRPLQVSGPRMQMTYKGSMAVLKISMVTTEEAGDYTVASENRFGKVESSARIEVYP 395          
BLAST of Titin vs. Ensembl Celegans
Match: ketn-1 (KETtiN (Drosophila actin-binding) homolog; Kettin [Source:UniProtKB/TrEMBL;Acc:Q9NL87])

HSP 1 Score: 202.601 bits (514), Expect = 2.423e-53
Identity = 130/377 (34.48%), Postives = 191/377 (50.66%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS--------PS---TLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXX-----XXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            EGD   L  RV P  DP L V+W ++G PL   SRF  +FE GF  LDILY + ED+G+Y  V +N+ G  ++         PS   T   + ++   L SH  Q    S A ++ + N     DI+ ++  R P+F   +  +  L+ G+    ET+V PI D  L +EWFK+ +P+  G RF    D GFA LD++  + +DTG+Y C A N+ GQ   +  +L       V+T SQ+P       Q L + N +  D  N  + E+      + +  P F I   NL V E  PARF   V+GYPRP++ WF+N    +     K+  DG + YL   + +I     +V  A+N  GE ++ ATL +   +DFR
Sbjct: 2207 EGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSKTKITVLPRPSLDYTSQTHGNQQDSLESHFKQ---HSQAKLQLTAN-----DIYNESDKRAPEFRTQLQNIGVLE-GEFCRFETQVAPINDPYLKVEWFKDKKPVLLGHRFRSTLDFGFACLDLLYALPDDTGEYHCVATNRHGQTMIS-AKLACQGASHVITDSQMP-------QGLRVSNVKK-DNKNIYWSEQGGAVQPKQKQAPQFTIPLRNLQVTENQPARFECAVTGYPRPKVTWFINGNQCLHGHRFKLNFDG-LHYLTVSKSRISDAGEVVAIARNTEGETISTATLDIFQNDDFR 2564          

HSP 2 Score: 165.622 bits (418), Expect = 1.658e-41
Identity = 118/359 (32.87%), Postives = 180/359 (50.14%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEA-SLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGY--PRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRC--KIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG P  L A+V P  D  LTVQW+ +G PLA G RF T  + G+  LDILY F +D+GE++CVA+N+ G  QT  +   V    ++  +S  P E  + I  +EA     P+  D   DA    PQF++P+  +  ++  QS H +T+V P TD +L I+WFK+G+PL N  RF +  D G+  LDI   + ED+G Y   A N  G A+  V   L  T   V+      ++S Q +Q ++       +  + ++   +    L   D       V EG P+ F  +   +  P+  +QW+LN   +  +S + + +D  +  L+ Q    +  GE  +VV  KN  GE   +  LS 
Sbjct:  644 EGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQTI-ANFTVLPRGTIYTDSQHP-ESWQKIQVLEAPRAAAPEKPDAEHDA----PQFIEPLDSIDRME-FQSAHFQTKVTPQTDPNLRIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHTVPEDSGVYSVKASNAKGDAE--VQAQLTVTGNAVILGDTQHEQSWQKIQLIEAPRAPGEEEPDVKHGPPKFVTQLHSLD------GVVEGQPSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVV--KNSEGEDRTSGQLSC 985          

HSP 3 Score: 160.229 bits (404), Expect = 8.025e-40
Identity = 119/374 (31.82%), Postives = 187/374 (50.00%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPM-PGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN-LTVEEGNPARFLVKVSGYPRP--QIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIV-VSAKNKLGEAVANATLSV 1939
            PP+F ++    + A EG    L  R+IP  DP + V W ++G PL   SRF  +    +  LDIL  + EDSG Y+C A + FG   TS  T+     +S++L++ +     + +  IE   N  K + +  +     P+FV  +   L  LQ G  +HLE +V P  D+ L ++WF NG+PL NG RF    D G+  LDI+   ++DTG++ C ARN  G+AQ+ +    V    T+ T SQ P ES Q +Q L+       ++ +  +         P F I+P++ +   E   A F  KV+    P  +IQWF +   ++ ++  K+ +D     L+     +P +S +  V A N  G+A   A L+V
Sbjct:  496 PPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYTCKAVSAFGEAATS-CTVKCAAGKSLLLDT-MHDASWKRVQEIE---NREKLEAVDAEPEKTAPKFVTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQT-IANFTVLPRGTIYTDSQHP-ESWQKIQVLEAPRAAAPEKPDAEH-------DAPQF-IEPLDSIDRMEFQSAHFQTKVTPQTDPNLRIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHT-VPEDSGVYSVKASNAKGDAEVQAQLTV 853          

HSP 4 Score: 148.673 bits (374), Expect = 3.553e-36
Identity = 125/423 (29.55%), Postives = 200/423 (47.28%), Query Frame = 2
Query:  695 FEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTV--EEGNPARFLVKVS--GYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
             EAP +K++        PPRF                   + ++T P S V          E  PA   A V P  DP LT+ W+ +G P++A SR     + G+ I+DI  T   DSGE+ CVAKN  G +  S +T+ V   E ++ +S  PQ + + I  IEA    P+ +    D     P  V  +     L+ G S HL+T+  P+ D S+ +EW K+G+P+ +  R+ +V D GFA+LDI+ ++  D G+Y     N +G+A S      V+    ++ + Q  Q++    ++++I   ED  R      E+E  E+ P F I+P++  V  EEG  A F  +       + Q+QW+ +   L   + I+ + S G +  LE            +  A N++GEAV +  L+  P+
Sbjct: 1535 IEAPKQKLEEADPEPKGPPRF-------------------IQQLTSPGSLV----------ENQPAHFEATVEPVDDPTLTINWFLNGEPMSASSRVKMINDFGWVIMDIAQTEPRDSGEWKCVAKNAAG-EAVSTATIEVQGKEVILQDSLQPQSL-DRIRQIEAGKPAPEERP---DQQFEAPAIVNALQVQGALEEGGSAHLQTQFTPVADPSIKVEWLKDGQPIFHSNRYKMVHDFGFAVLDILHLLKHDAGEYTFRVSNNSGEA-STSTSFEVSESSGLILQPQNEQKA----KAVEI--LEDNLRRRPEEIEQELKEATPVF-IEPLSAPVETEEGGRAHFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYV-VLEISPTYPEDNGEYICRAVNRVGEAVTSTKLTCTPK 1914          

HSP 5 Score: 147.517 bits (371), Expect = 9.570e-36
Identity = 85/209 (40.67%), Postives = 111/209 (53.11%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTES---IAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            EG  A  TAR  P  D  L VQWY DG PL  GSR  T    G+ +L+I  T+ ED+GEY C A N  G   TS + L     E ++  + LP+ M  +   IA IEA    P  +D   DA   PP+F   + G   LQ GQ  HLE +V P+ D  LVIEWF NG+P+N+  R   + D GF +L +     +D+G + C A N+ G
Sbjct: 1833 EGGRAHFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYVVLEISPTYPEDNGEYICRAVNRVGEAVTS-TKLTCTPKEGIISATQLPERMANAGRRIAEIEAP--RPAREDAP-DADHGPPKFTSALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHG 2037          

HSP 6 Score: 130.954 bits (328), Expect = 1.277e-30
Identity = 121/427 (28.34%), Postives = 197/427 (46.14%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF--LVKVSGYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFI-VVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPS 2089
            PP FV          EG P+   A+ IP  DP  +VQWY +G PL+A SR     + G   LD+ YT  ED+GEYS V KN+ G D+TS   L+     +++ ++   Q   + I  IEA    P+      + P+   P FV+P+  + +L  G    LE R++P+ D +L ++WF N +PL      +   D G   L I  V +  TG Y C A N +G A ++   + V   E ++  +  P  S+Q +Q L+ I     +D     YE+ +  +   +++       V EG       LV+ SG P  +++W LN   L      ++ Y  G+ + L      +P +S +    A N  GEA  +AT++                 IL  +++P  + ++  L+   +  E++   +K KP+
Sbjct:  892 PPKFVTQLHSLDGVVEGQPSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVVKNSEGEDRTS-GQLSCTTRAAILGDTQHEQSW-QRIQEIEA----PRAPGAEPEGPVYEKPSFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYARHTGVYSCKAWNDSGNAVTS-ANVGVQGSEGLLLDTSHPA-SLQKIQELEAIDKYARLDAPEREYEKPQWVQGFENYE------NVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGN-AILTIVHV-LPHDSGVYTCRAWNTQGEASTSATVTTAGYE-----------KILYDSQHPVSWERIQELEAPKIVEEIEEIVQKEKPN 1291          

HSP 7 Score: 127.487 bits (319), Expect = 1.686e-29
Identity = 107/385 (27.79%), Postives = 176/385 (45.71%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESV--VLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPG-LYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT--VEEGNPARF--LVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            PP+FVK         EGD   L A+V P  D +LT +W  +G PL    RF  S + G+  L+ILY + ED+G Y+ V +N  G  Q   ST+++N   +     +S  P  +   IA +E  +   +      D     P   KP+P  + ++   Q++HLE +V PI D++L  EW  NG PL    R+ ++ D GF  LDI  +I+ED+G Y     N AG+A+++     V   +++++ +  P+    ++ ++ L      D D +             P F  +    T  ++EG       +V+    P  +I+WF +   L+  + I+ ++  G +  LEF              A N +GEA  +  L   P  + 
Sbjct:   98 PPAFVKQLGPAIQCMEGDNVYLEAQVTPTDDNSLTYEWLVNGQPLMKAHRFVLSQDFGYIALNILYCYPEDNGTYTLVVRNRAGEAQ---STVDINCGHTGGNFTDSFHPNSL-HRIAELETPIQRAEPLP---DKEKEVPTIAKPLPATIDSVHESQTLHLEAQVTPIDDNTLRYEWLFNGNPLKASSRYRVLNDFGFVSLDIDYIIAEDSGKYTLVVYNSAGRAETS-CEFQVDRLKSILSDTAHPESLRRIREMEQLQPAKPSDDDAA----------AQPPVFTQQLTGPTEPLKEGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVG-LEFLHIHPEDTGTYTCKATNLIGEATTDIFLECKPRRNI 463          

HSP 8 Score: 122.865 bits (307), Expect = 3.971e-28
Identity = 89/265 (33.58%), Postives = 133/265 (50.19%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIR---PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDI 1603
            + + PSFV+  +      EG  A L AR++P  DPNL VQW+ +  PL   +  +TS + G   L I   +   +G YSC A N+ G   TS + + V   E ++L++  P  + + I  +EA     +     +DAP R    PQ+V+      N+  GQ+V L   V P  D  L +EW  NG PL N  RF   ++ G AIL I+ V+  D+G Y C A N  G+A ++   +  A  E ++  SQ P   E +Q L++  I
Sbjct: 1021 VYEKPSFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYARHTGVYSCKAWNDSGNAVTS-ANVGVQGSEGLLLDTSHPASL-QKIQELEAIDKYAR-----LDAPEREYEKPQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTSAT-VTTAGYEKILYDSQHPVSWERIQELEAPKI 1277          

HSP 9 Score: 122.479 bits (306), Expect = 6.203e-28
Identity = 103/334 (30.84%), Postives = 144/334 (43.11%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXX------------XXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRP--QIQWFLNECLVI 1795
            PSF +        NE D  +    + P GDP L VQW  +G P+   +R + + E G A L I +    D+GEY CVA N  G   TS   +                       A+E+S          IDAP    Q V     + N+  G S+HLE RV PI D  L +EW +NG PL    RF   F+ GF  LDI+    ED GDY    RN  G+A+S        T+ TV     LP+ S+ Y  S    N +D   S+F+   +              ++  P F  +  N+ V EG   RF  +V+    P  +++WF ++  V+
Sbjct: 2091 PSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKG-SATSVGKI-----------------------AVESS--------TQIDAPQVVQQLVD---SVENILEGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSK-------TKITV-----LPRPSLDYT-SQTHGNQQDSLESHFKQHSQAKLQLTANDIYNESDKRAPEFRTQLQNIGVLEGEFCRFETQVAPINDPYLKVEWFKDKKPVL 2376          

HSP 10 Score: 120.168 bits (300), Expect = 2.977e-27
Identity = 96/363 (26.45%), Postives = 167/363 (46.01%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT---VEEGNPARFLVKVSGYPRPQ--IQWFLN-ECLVIPTSIQKVYSDGSISY-LEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            EG    +   V P  DP+L ++W+ DG PL  GSR  T  + G+  L+ L+   ED+G Y+C A N  G      +T ++ L+     N +L      S   I+   N    ++   +   +PP F + +    + Q GQS+ LE R+IP+ D ++ + W +NG+PL    RF    +  +  LDI+ +  ED+G Y C A +  G+A ++      A +  ++    +   S + +Q ++       +R      + E  ++ P F +  +N +   ++EG P     +V      Q  +QWF N + L      +  +  G ++  + +   +  GE   V  A+N LGEA   A  +V+P
Sbjct:  379 EGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIGE-----ATTDIFLECKPRRNIYLDTHHESSWQKIQEIENRVDEREPTPELTFQPPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYTCKAVSAFGEAATSCTVKCAAGKSLLL--DTMHDASWKRVQEIE-------NREKLEAVDAEPEKTAPKF-VTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACV--ARNSLGEAQTIANFTVLP 724          

HSP 11 Score: 117.472 bits (293), Expect = 1.925e-26
Identity = 106/371 (28.57%), Postives = 161/371 (43.40%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF--LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +V+  E Y+   EG   +L   V P+GDP+L ++W  +G PL   +RF   +E G AIL I++    DSG Y+C A N  G   TS +T+     E ++ +S  P    E I  +EA    PK  ++I        P F+  +    N+  G  +HLE+   P  D  L + W KNG+PL          + G+A LDI     +  G Y     N  G+A S    + VA    ++  ++  +ES + +Q L+     + +     Y+       +   D K  N    EG+   F  L+     PR Q+QW  N   +   S   +  D  I  L+        E    +   N  GEAV++ATL  
Sbjct: 1158 PQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTS-ATVTTAGYEKILYDSQHPVSW-ERIQELEA----PKIVEEIEEIVQKEKPNFLTQLESAENVPEGVPLHLESTFQPARDPELKVVWQKNGQPLGASQLVQTKHELGWATLDISSANEDHNGVYTLTITNSEGEAVS-TASIRVAGTGPILGNTRH-EESWKRIQILEAPKEAEPEAPAPVYDHPAITTQI---DDKECN----EGDHVHFEALITPVNDPRLQVQWIRNGVPLAHGSKYAIQQDFGICTLDVAYTYPEDEGVYQLRIWNPEGEAVSSATLKC 1513          

HSP 12 Score: 101.293 bits (251), Expect = 1.822e-21
Identity = 72/256 (28.12%), Postives = 115/256 (44.92%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRP-PQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL 1597
            PP F           EG  A L  +V P  DP L ++W+ +G P+   +R     + GF +L +     +DSG ++C A N  G D+ S + L V     V        E  E I  +E  ++ PK +D+++ A   P P F + +  L  L    +      + PI D +L ++W  NG P+    R +   + G A L I  +I+ D G+Y C A N  G A S  V  +     T +   Q+ Q+ V  ++++
Sbjct: 1954 PPKFTSALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHGSDEVS-TELKVVGGGGVSYEWQSTAERKERITELEDWIHRPK-EDLNLPAVDYPAPSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKGSATS--VGKIAVESSTQIDAPQVVQQLVDSVENI 2205          

HSP 13 Score: 98.2117 bits (243), Expect = 1.572e-20
Identity = 92/353 (26.06%), Postives = 143/353 (40.51%), Query Frame = 2
Query:  887 PASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRC--KIPGESFIVVSAKNKLGEAVANATLSV 1939
            PA  + ++   G+P  T+QW+KDG PL    RF    E G   L        D+G Y  VAKN  G +    + LNVNL ++         +  E     EA   T + Q I +D                    G+      +     D +  I W++N  P+ +   + I   +G AIL I    +ED  +Y   A N AG+A S+V  L++      + KS + +      QS D                 +     PHF  K  +++  +G+  +F  +V G P P +QW      +  ++  K+  DG  + LE  R      GE  IV+  +N  G A + A L++
Sbjct: 2958 PAEFSCQI--GGEPKPTIQWFKDGQPLPNDDRFQVVEEGGAYKLKFSNIISTDAGIYEIVAKNGVG-EARCKARLNVNLQKT--------GKGAEEGPRYEAPRFTSQIQPIVVDE-------------------GKGAQFSAQFSGFPDPT--IRWYRNNEPVKHADGYEISQSKGEAILRISAARNEDVAEYKVEASNPAGKA-SSVANLVLTPRSGRIAKSTISRGGSASYQSSD-----------------KAAADSPHFIAKLSDISARQGHTVKFSAEVDGNPEPTVQWQFKGKPISASNNVKISRDGKRAILELARVTPDSAGEYQIVI--RNDKGAATSQAKLTL 3258          

HSP 14 Score: 79.7221 bits (195), Expect = 8.329e-15
Identity = 40/95 (42.11%), Postives = 53/95 (55.79%), Query Frame = 2
Query: 1229 DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            D P +PP FVK +        G +V+LE +V P  D+SL  EW  NG+PL    RF +  D G+  L+I+    ED G Y    RN+AG+AQS V
Sbjct:   93 DLPHQPPAFVKQLGPAIQCMEGDNVYLEAQVTPTDDNSLTYEWLVNGQPLMKAHRFVLSQDFGYIALNILYCYPEDNGTYTLVVRNRAGEAQSTV 187          
BLAST of Titin vs. Ensembl Celegans
Match: ketn-1 (KETtiN (Drosophila actin-binding) homolog; Kettin [Source:UniProtKB/TrEMBL;Acc:Q9NL87])

HSP 1 Score: 202.601 bits (514), Expect = 2.441e-53
Identity = 130/377 (34.48%), Postives = 191/377 (50.66%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS--------PS---TLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXX-----XXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            EGD   L  RV P  DP L V+W ++G PL   SRF  +FE GF  LDILY + ED+G+Y  V +N+ G  ++         PS   T   + ++   L SH  Q    S A ++ + N     DI+ ++  R P+F   +  +  L+ G+    ET+V PI D  L +EWFK+ +P+  G RF    D GFA LD++  + +DTG+Y C A N+ GQ   +  +L       V+T SQ+P       Q L + N +  D  N  + E+      + +  P F I   NL V E  PARF   V+GYPRP++ WF+N    +     K+  DG + YL   + +I     +V  A+N  GE ++ ATL +   +DFR
Sbjct: 3197 EGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSKTKITVLPRPSLDYTSQTHGNQQDSLESHFKQ---HSQAKLQLTAN-----DIYNESDKRAPEFRTQLQNIGVLE-GEFCRFETQVAPINDPYLKVEWFKDKKPVLLGHRFRSTLDFGFACLDLLYALPDDTGEYHCVATNRHGQTMIS-AKLACQGASHVITDSQMP-------QGLRVSNVKK-DNKNIYWSEQGGAVQPKQKQAPQFTIPLRNLQVTENQPARFECAVTGYPRPKVTWFINGNQCLHGHRFKLNFDG-LHYLTVSKSRISDAGEVVAIARNTEGETISTATLDIFQNDDFR 3554          

HSP 2 Score: 165.236 bits (417), Expect = 2.263e-41
Identity = 118/359 (32.87%), Postives = 180/359 (50.14%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEA-SLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGY--PRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRC--KIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG P  L A+V P  D  LTVQW+ +G PLA G RF T  + G+  LDILY F +D+GE++CVA+N+ G  QT  +   V    ++  +S  P E  + I  +EA     P+  D   DA    PQF++P+  +  ++  QS H +T+V P TD +L I+WFK+G+PL N  RF +  D G+  LDI   + ED+G Y   A N  G A+  V   L  T   V+      ++S Q +Q ++       +  + ++   +    L   D       V EG P+ F  +   +  P+  +QW+LN   +  +S + + +D  +  L+ Q    +  GE  +VV  KN  GE   +  LS 
Sbjct: 1634 EGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQTI-ANFTVLPRGTIYTDSQHP-ESWQKIQVLEAPRAAAPEKPDAEHDA----PQFIEPLDSIDRME-FQSAHFQTKVTPQTDPNLRIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHTVPEDSGVYSVKASNAKGDAE--VQAQLTVTGNAVILGDTQHEQSWQKIQLIEAPRAPGEEEPDVKHGPPKFVTQLHSLD------GVVEGQPSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVV--KNSEGEDRTSGQLSC 1975          

HSP 3 Score: 160.229 bits (404), Expect = 9.500e-40
Identity = 119/374 (31.82%), Postives = 187/374 (50.00%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPM-PGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN-LTVEEGNPARFLVKVSGYPRP--QIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIV-VSAKNKLGEAVANATLSV 1939
            PP+F ++    + A EG    L  R+IP  DP + V W ++G PL   SRF  +    +  LDIL  + EDSG Y+C A + FG   TS  T+     +S++L++ +     + +  IE   N  K + +  +     P+FV  +   L  LQ G  +HLE +V P  D+ L ++WF NG+PL NG RF    D G+  LDI+   ++DTG++ C ARN  G+AQ+ +    V    T+ T SQ P ES Q +Q L+       ++ +  +         P F I+P++ +   E   A F  KV+    P  +IQWF +   ++ ++  K+ +D     L+     +P +S +  V A N  G+A   A L+V
Sbjct: 1486 PPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYTCKAVSAFGEAATS-CTVKCAAGKSLLLDT-MHDASWKRVQEIE---NREKLEAVDAEPEKTAPKFVTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQT-IANFTVLPRGTIYTDSQHP-ESWQKIQVLEAPRAAAPEKPDAEH-------DAPQF-IEPLDSIDRMEFQSAHFQTKVTPQTDPNLRIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHT-VPEDSGVYSVKASNAKGDAEVQAQLTV 1843          

HSP 4 Score: 148.673 bits (374), Expect = 3.775e-36
Identity = 125/423 (29.55%), Postives = 200/423 (47.28%), Query Frame = 2
Query:  695 FEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTV--EEGNPARFLVKVS--GYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
             EAP +K++        PPRF                   + ++T P S V          E  PA   A V P  DP LT+ W+ +G P++A SR     + G+ I+DI  T   DSGE+ CVAKN  G +  S +T+ V   E ++ +S  PQ + + I  IEA    P+ +    D     P  V  +     L+ G S HL+T+  P+ D S+ +EW K+G+P+ +  R+ +V D GFA+LDI+ ++  D G+Y     N +G+A S      V+    ++ + Q  Q++    ++++I   ED  R      E+E  E+ P F I+P++  V  EEG  A F  +       + Q+QW+ +   L   + I+ + S G +  LE            +  A N++GEAV +  L+  P+
Sbjct: 2525 IEAPKQKLEEADPEPKGPPRF-------------------IQQLTSPGSLV----------ENQPAHFEATVEPVDDPTLTINWFLNGEPMSASSRVKMINDFGWVIMDIAQTEPRDSGEWKCVAKNAAG-EAVSTATIEVQGKEVILQDSLQPQSL-DRIRQIEAGKPAPEERP---DQQFEAPAIVNALQVQGALEEGGSAHLQTQFTPVADPSIKVEWLKDGQPIFHSNRYKMVHDFGFAVLDILHLLKHDAGEYTFRVSNNSGEA-STSTSFEVSESSGLILQPQNEQKA----KAVEI--LEDNLRRRPEEIEQELKEATPVF-IEPLSAPVETEEGGRAHFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYV-VLEISPTYPEDNGEYICRAVNRVGEAVTSTKLTCTPK 2904          

HSP 5 Score: 147.132 bits (370), Expect = 1.377e-35
Identity = 85/209 (40.67%), Postives = 111/209 (53.11%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTES---IAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            EG  A  TAR  P  D  L VQWY DG PL  GSR  T    G+ +L+I  T+ ED+GEY C A N  G   TS + L     E ++  + LP+ M  +   IA IEA    P  +D   DA   PP+F   + G   LQ GQ  HLE +V P+ D  LVIEWF NG+P+N+  R   + D GF +L +     +D+G + C A N+ G
Sbjct: 2823 EGGRAHFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYVVLEISPTYPEDNGEYICRAVNRVGEAVTS-TKLTCTPKEGIISATQLPERMANAGRRIAEIEAP--RPAREDAP-DADHGPPKFTSALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHG 3027          

HSP 6 Score: 142.51 bits (358), Expect = 3.318e-34
Identity = 84/244 (34.43%), Postives = 133/244 (54.51%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASL--NTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA-QSNVVRLLVATEETVVTKSQLPQESVQYLQSLD 1600
            E +     AR++PA D  +TV+WY +G PL A  RF+  F+ G+  LD+LY + +DSG Y+ VA+N  G +  S   L V  ++ + L  H P+ + E I  +E        + +D   DA    P+F+  +P +  L   +++H++ R  P+ D ++VIEWF NGRPL  G R   + + GF  LDI G I+ED+G Y   A N  G+A +  V+ +  A +    T+ Q     + YL++L+
Sbjct:  703 ENERVHFEARILPANDVKMTVEWYHNGNPLPAAHRFHPMFDFGYVALDLLYAYPQDSGTYTLVARNELG-EARSNVELVVGTEKVLYLEPHHPEGL-ERIKELEQDRRQGIAEVEDRTCDA---APKFLNDLPDI-QLNEHENIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQCVITVTPAGQILSDTQHQESLGKINYLENLN 940          

HSP 7 Score: 139.043 bits (349), Expect = 4.183e-33
Identity = 103/382 (26.96%), Postives = 168/382 (43.98%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHI-----DAP-----IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            P F+   + +    E   +   AR+ P  DP L V W KDG PL   +R       G   L +  T+ ED+G Y+CV  N+ G  Q+S     V +D   + + H      +S+  I        +  IHI     + P     +  P+F + + G   +   + VH E R++P  D  + +EW+ NG PL    RF+ +FD G+  LD++    +D+G Y   ARN+ G+A+SN V L+V TE+ +  +   P E ++ ++ L+    + +     R       ++ P F  D+  I L   E             P   I+WF+N   ++  S  K  ++     L+ +           V A N LGEA+    ++V P
Sbjct:  551 PKFLSQIQPFHCEQELGRSFFEARIQPINDPTLRVSWLKDGQPLPNANRIQIFQNFGVVSLSLHPTYPEDAGVYTCVLFNSHGQAQSSAELTTVWIDTLQLDSKH-----ADSLPII----GYLDSHQIHIGPQSVERPEEFNSLEAPKFARELAGKIEVMENERVHFEARILPANDVKMTVEWYHNGNPLPAAHRFHPMFDFGYVALDLLYAYPQDSGTYTLVARNELGEARSN-VELVVGTEKVLYLEPHHP-EGLERIKELEQDRRQGIAEVEDR-----TCDAAPKFLNDLPDIQLNEHENIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQCVITVTP 916          

HSP 8 Score: 134.806 bits (338), Expect = 8.286e-32
Identity = 83/230 (36.09%), Postives = 124/230 (53.91%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVAN--EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            +PP+FV  P +  + +  EG+P  L  +V P  D +L + W +DG  L  G RF T ++ GF  LDIL  + +D+G Y+C A+N+ G  +T  +T+     ++++     P+     I  IEA    P  Q++  D P +PP FVK +        G +V+LE +V P  D+SL  EW  NG+PL    RF +  D G+  L+I+    ED G Y    RN+AG+AQS V
Sbjct:  954 EPPTFVV-PLQADLGDVEEGEPIHLECQVNPINDNSLKIIWLRDGQSLPHGHRFRTFYDFGFVSLDILGFYAQDAGTYTCRAENSLGQAETV-ATIRCAPKDAILGAVQHPRSYAR-IQEIEAP--KPAPQEVP-DLPHQPPAFVKQLGPAIQCMEGDNVYLEAQVTPTDDNSLTYEWLVNGQPLMKAHRFVLSQDFGYIALNILYCYPEDNGTYTLVVRNRAGEAQSTV 1177          

HSP 9 Score: 130.954 bits (328), Expect = 1.373e-30
Identity = 121/427 (28.34%), Postives = 197/427 (46.14%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF--LVKVSGYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFI-VVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPS 2089
            PP FV          EG P+   A+ IP  DP  +VQWY +G PL+A SR     + G   LD+ YT  ED+GEYS V KN+ G D+TS   L+     +++ ++   Q   + I  IEA    P+      + P+   P FV+P+  + +L  G    LE R++P+ D +L ++WF N +PL      +   D G   L I  V +  TG Y C A N +G A ++   + V   E ++  +  P  S+Q +Q L+ I     +D     YE+ +  +   +++       V EG       LV+ SG P  +++W LN   L      ++ Y  G+ + L      +P +S +    A N  GEA  +AT++                 IL  +++P  + ++  L+   +  E++   +K KP+
Sbjct: 1882 PPKFVTQLHSLDGVVEGQPSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVVKNSEGEDRTS-GQLSCTTRAAILGDTQHEQSW-QRIQEIEA----PRAPGAEPEGPVYEKPSFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYARHTGVYSCKAWNDSGNAVTS-ANVGVQGSEGLLLDTSHPA-SLQKIQELEAIDKYARLDAPEREYEKPQWVQGFENYE------NVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGN-AILTIVHV-LPHDSGVYTCRAWNTQGEASTSATVTTAGYE-----------KILYDSQHPVSWERIQELEAPKIVEEIEEIVQKEKPN 2281          

HSP 10 Score: 125.176 bits (313), Expect = 8.707e-29
Identity = 79/214 (36.92%), Postives = 114/214 (53.27%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            +E     L A+V P  D  L  +W  +G PL A SR+    + GF  LDI Y   EDSG+Y+ V  N+ G  +TS     V+  +S++ ++  P+ +   I  +E  L   K  D   DA  +PP F + + G    L+ GQSVH++  V PI D SL IEWF +GRPL  G R   + D G+  L+ + +  EDTG Y C A N  G+A +++
Sbjct: 1235 HESQTLHLEAQVTPIDDNTLRYEWLFNGNPLKASSRYRVLNDFGFVSLDIDYIIAEDSGKYTLVVYNSAGRAETS-CEFQVDRLKSILSDTAHPESL-RRIREME-QLQPAKPSDD--DAAAQPPVFTQQLTGPTEPLKEGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIGEATTDI 1443          

HSP 11 Score: 122.865 bits (307), Expect = 4.442e-28
Identity = 89/265 (33.58%), Postives = 133/265 (50.19%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIR---PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDI 1603
            + + PSFV+  +      EG  A L AR++P  DPNL VQW+ +  PL   +  +TS + G   L I   +   +G YSC A N+ G   TS + + V   E ++L++  P  + + I  +EA     +     +DAP R    PQ+V+      N+  GQ+V L   V P  D  L +EW  NG PL N  RF   ++ G AIL I+ V+  D+G Y C A N  G+A ++   +  A  E ++  SQ P   E +Q L++  I
Sbjct: 2011 VYEKPSFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYARHTGVYSCKAWNDSGNAVTS-ANVGVQGSEGLLLDTSHPASL-QKIQELEAIDKYAR-----LDAPEREYEKPQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTSAT-VTTAGYEKILYDSQHPVSWERIQELEAPKI 2267          

HSP 12 Score: 122.094 bits (305), Expect = 7.493e-28
Identity = 103/334 (30.84%), Postives = 144/334 (43.11%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXX------------XXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVI 1795
            PSF +        NE D  +    + P GDP L VQW  +G P+   +R + + E G A L I +    D+GEY CVA N  G   TS   +                       A+E+S          IDAP    Q V     + N+  G S+HLE RV PI D  L +EW +NG PL    RF   F+ GF  LDI+    ED GDY    RN  G+A+S        T+ TV     LP+ S+ Y  S    N +D   S+F+   +              ++  P F  +  N+ V EG   RF  +V+    P  +++WF ++  V+
Sbjct: 3081 PSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKG-SATSVGKI-----------------------AVESS--------TQIDAPQVVQQLVD---SVENILEGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSK-------TKITV-----LPRPSLDYT-SQTHGNQQDSLESHFKQHSQAKLQLTANDIYNESDKRAPEFRTQLQNIGVLEGEFCRFETQVAPINDPYLKVEWFKDKKPVL 3366          

HSP 13 Score: 120.168 bits (300), Expect = 3.187e-27
Identity = 96/363 (26.45%), Postives = 167/363 (46.01%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT---VEEGNPARFLVKVSGYPRPQ--IQWFLN-ECLVIPTSIQKVYSDGSISY-LEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            EG    +   V P  DP+L ++W+ DG PL  GSR  T  + G+  L+ L+   ED+G Y+C A N  G      +T ++ L+     N +L      S   I+   N    ++   +   +PP F + +    + Q GQS+ LE R+IP+ D ++ + W +NG+PL    RF    +  +  LDI+ +  ED+G Y C A +  G+A ++      A +  ++    +   S + +Q ++       +R      + E  ++ P F +  +N +   ++EG P     +V      Q  +QWF N + L      +  +  G ++  + +   +  GE   V  A+N LGEA   A  +V+P
Sbjct: 1369 EGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIG-----EATTDIFLECKPRRNIYLDTHHESSWQKIQEIENRVDEREPTPELTFQPPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYTCKAVSAFGEAATSCTVKCAAGKSLLL--DTMHDASWKRVQEIE-------NREKLEAVDAEPEKTAPKF-VTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACV--ARNSLGEAQTIANFTVLP 1714          

HSP 14 Score: 117.087 bits (292), Expect = 2.594e-26
Identity = 106/371 (28.57%), Postives = 161/371 (43.40%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF--LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +V+  E Y+   EG   +L   V P+GDP+L ++W  +G PL   +RF   +E G AIL I++    DSG Y+C A N  G   TS +T+     E ++ +S  P    E I  +EA    PK  ++I        P F+  +    N+  G  +HLE+   P  D  L + W KNG+PL          + G+A LDI     +  G Y     N  G+A S    + VA    ++  ++  +ES + +Q L+     + +     Y+       +   D K  N    EG+   F  L+     PR Q+QW  N   +   S   +  D  I  L+        E    +   N  GEAV++ATL  
Sbjct: 2148 PQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTS-ATVTTAGYEKILYDSQHPVSW-ERIQELEA----PKIVEEIEEIVQKEKPNFLTQLESAENVPEGVPLHLESTFQPARDPELKVVWQKNGQPLGASQLVQTKHELGWATLDISSANEDHNGVYTLTITNSEGEAVS-TASIRVAGTGPILGNTRH-EESWKRIQILEAPKEAEPEAPAPVYDHPAITTQI---DDKECN----EGDHVHFEALITPVNDPRLQVQWIRNGVPLAHGSKYAIQQDFGICTLDVAYTYPEDEGVYQLRIWNPEGEAVSSATLKC 2503          

HSP 15 Score: 101.293 bits (251), Expect = 2.126e-21
Identity = 72/256 (28.12%), Postives = 115/256 (44.92%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRP-PQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL 1597
            PP F           EG  A L  +V P  DP L ++W+ +G P+   +R     + GF +L +     +DSG ++C A N  G D+ S + L V     V        E  E I  +E  ++ PK +D+++ A   P P F + +  L  L    +      + PI D +L ++W  NG P+    R +   + G A L I  +I+ D G+Y C A N  G A S  V  +     T +   Q+ Q+ V  ++++
Sbjct: 2944 PPKFTSALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHGSDEVS-TELKVVGGGGVSYEWQSTAERKERITELEDWIHRPK-EDLNLPAVDYPAPSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKGSATS--VGKIAVESSTQIDAPQVVQQLVDSVENI 3195          

HSP 16 Score: 97.8265 bits (242), Expect = 2.028e-20
Identity = 92/353 (26.06%), Postives = 143/353 (40.51%), Query Frame = 2
Query:  887 PASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRC--KIPGESFIVVSAKNKLGEAVANATLSV 1939
            PA  + ++   G+P  T+QW+KDG PL    RF    E G   L        D+G Y  VAKN  G +    + LNVNL ++         +  E     EA   T + Q I +D                    G+      +     D +  I W++N  P+ +   + I   +G AIL I    +ED  +Y   A N AG+A S+V  L++      + KS + +      QS D                 +     PHF  K  +++  +G+  +F  +V G P P +QW      +  ++  K+  DG  + LE  R      GE  IV+  +N  G A + A L++
Sbjct: 3981 PAEFSCQI--GGEPKPTIQWFKDGQPLPNDDRFQVVEEGGAYKLKFSNIISTDAGIYEIVAKNGVG-EARCKARLNVNLQKT--------GKGAEEGPRYEAPRFTSQIQPIVVDE-------------------GKGAQFSAQFSGFPDPT--IRWYRNNEPVKHADGYEISQSKGEAILRISAARNEDVAEYKVEASNPAGKA-SSVANLVLTPRSGRIAKSTISRGGSASYQSSD-----------------KAAADSPHFIAKLSDISARQGHTVKFSAEVDGNPEPTVQWQFKGKPISASNNVKISRDGKRAILELARVTPDSAGEYQIVI--RNDKGAATSQAKLTL 4281          

HSP 17 Score: 95.5153 bits (236), Expect = 1.220e-19
Identity = 67/218 (30.73%), Postives = 96/218 (44.04%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            R Q   EG    L  ++ P  DP+L V W  DG  L +  ++  +   GFA LDI  T   DSG YSC A N  G  +   + + V   +      H  Q   E +  I+ + +   +QD+        P+F+  +   +  Q       E R+ PI D +L + W K+G+PL N  R  I  + G   L +     ED G Y C   N  GQAQS+ 
Sbjct:  433 RSQEVFEGQQIHLETKLTPINDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLGESENQATIIIVPKSDLQQFEQHR-QLDVEDVREIQFAHS---SQDL-------TPKFLSQIQPFHCEQELGRSFFEARIQPINDPTLRVSWLKDGQPLPNANRIQIFQNFGVVSLSLHPTYPEDAGVYTCVLFNSHGQAQSSA 639          

HSP 18 Score: 85.8853 bits (211), Expect = 1.130e-16
Identity = 72/256 (28.12%), Postives = 113/256 (44.14%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQ---DIHIDAP-----IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDV 1621
            EG  A L  +  P  DPNL + W  +G  + A SR  T  + G A L+I      D GEY+ VA N  G  + S +        +V+ +    Q+          +  +   Q     H+D P     +R  +  +          GQ +HLET++ PI D  L + W  +G  L +  ++      GFA LDI    S D+G Y C A NK G++++    +       +V KS L Q+  Q+ Q LD+++  ++
Sbjct:  311 EGQSARLEIKYTPVEDPNLRIAWLLNGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANI-------AVIGHGSFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNFHSDLRSQEVFE----------GQQIHLETKLTPINDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLGESENQATII-------IVPKSDL-QQFEQHRQ-LDVEDVREI 540          

HSP 19 Score: 67.0106 bits (162), Expect = 5.693e-11
Identity = 89/369 (24.12%), Postives = 146/369 (39.57%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ--NTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQ--WFL--NECLVIPTS--IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            +GD   L  +    G   ++ +W+KD  P+++G  +    +     L I     ++ G Y C A N  G   T    + VN  +     +H        +  +E S  TP  Q   + A    P+F   +     L  GQS  LE +  P+ D +L I W  NG+ +    R     D G A L+I  V   D G+Y   A N  G+A+ +    ++     +  +    Q      QS   Q      +D  NF            H D++  +  V EG       K++    P ++  W L  NE   +P++   ++  S G  S L+  +            A NKLGE+   AT+ ++P++D +
Sbjct:  180 DGDSVKLYCKAAGEG---VSFKWFKDNEPISSGGSYAVDNKGNETTLHINNATMKEGGWYRCDATNKHGT-TTLKGRVVVNSRQKFNGPAHREMITLRKVDKVERS-RTPVNQLQDVSASKSSPKFEGSLQS-QQLVEGQSARLEIKYTPVEDPNLRIAWLLNGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANIAVIGHGSFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNF------------HSDLR--SQEVFEGQQIHLETKLTPINDPDLRVVWLLDGNE---LPSNDKYRQTLSHGFAS-LDIPQTSSNDSGLYSCRAFNKLGESENQATIIIVPKSDLQ 524          
BLAST of Titin vs. Ensembl Celegans
Match: ketn-1 (KETtiN (Drosophila actin-binding) homolog; Kettin [Source:UniProtKB/TrEMBL;Acc:Q9NL87])

HSP 1 Score: 202.601 bits (514), Expect = 2.512e-53
Identity = 130/377 (34.48%), Postives = 191/377 (50.66%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS--------PS---TLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXX-----XXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            EGD   L  RV P  DP L V+W ++G PL   SRF  +FE GF  LDILY + ED+G+Y  V +N+ G  ++         PS   T   + ++   L SH  Q    S A ++ + N     DI+ ++  R P+F   +  +  L+ G+    ET+V PI D  L +EWFK+ +P+  G RF    D GFA LD++  + +DTG+Y C A N+ GQ   +  +L       V+T SQ+P       Q L + N +  D  N  + E+      + +  P F I   NL V E  PARF   V+GYPRP++ WF+N    +     K+  DG + YL   + +I     +V  A+N  GE ++ ATL +   +DFR
Sbjct: 3197 EGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSKTKITVLPRPSLDYTSQTHGNQQDSLESHFKQ---HSQAKLQLTAN-----DIYNESDKRAPEFRTQLQNIGVLE-GEFCRFETQVAPINDPYLKVEWFKDKKPVLLGHRFRSTLDFGFACLDLLYALPDDTGEYHCVATNRHGQTMIS-AKLACQGASHVITDSQMP-------QGLRVSNVKK-DNKNIYWSEQGGAVQPKQKQAPQFTIPLRNLQVTENQPARFECAVTGYPRPKVTWFINGNQCLHGHRFKLNFDG-LHYLTVSKSRISDAGEVVAIARNTEGETISTATLDIFQNDDFR 3554          

HSP 2 Score: 165.236 bits (417), Expect = 2.369e-41
Identity = 118/359 (32.87%), Postives = 180/359 (50.14%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEA-SLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGY--PRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRC--KIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG P  L A+V P  D  LTVQW+ +G PLA G RF T  + G+  LDILY F +D+GE++CVA+N+ G  QT  +   V    ++  +S  P E  + I  +EA     P+  D   DA    PQF++P+  +  ++  QS H +T+V P TD +L I+WFK+G+PL N  RF +  D G+  LDI   + ED+G Y   A N  G A+  V   L  T   V+      ++S Q +Q ++       +  + ++   +    L   D       V EG P+ F  +   +  P+  +QW+LN   +  +S + + +D  +  L+ Q    +  GE  +VV  KN  GE   +  LS 
Sbjct: 1634 EGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQTI-ANFTVLPRGTIYTDSQHP-ESWQKIQVLEAPRAAAPEKPDAEHDA----PQFIEPLDSIDRME-FQSAHFQTKVTPQTDPNLRIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHTVPEDSGVYSVKASNAKGDAE--VQAQLTVTGNAVILGDTQHEQSWQKIQLIEAPRAPGEEEPDVKHGPPKFVTQLHSLD------GVVEGQPSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVV--KNSEGEDRTSGQLSC 1975          

HSP 3 Score: 160.229 bits (404), Expect = 9.941e-40
Identity = 119/374 (31.82%), Postives = 187/374 (50.00%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPM-PGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN-LTVEEGNPARFLVKVSGYPRP--QIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIV-VSAKNKLGEAVANATLSV 1939
            PP+F ++    + A EG    L  R+IP  DP + V W ++G PL   SRF  +    +  LDIL  + EDSG Y+C A + FG   TS  T+     +S++L++ +     + +  IE   N  K + +  +     P+FV  +   L  LQ G  +HLE +V P  D+ L ++WF NG+PL NG RF    D G+  LDI+   ++DTG++ C ARN  G+AQ+ +    V    T+ T SQ P ES Q +Q L+       ++ +  +         P F I+P++ +   E   A F  KV+    P  +IQWF +   ++ ++  K+ +D     L+     +P +S +  V A N  G+A   A L+V
Sbjct: 1486 PPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYTCKAVSAFGEAATS-CTVKCAAGKSLLLDT-MHDASWKRVQEIE---NREKLEAVDAEPEKTAPKFVTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACVARNSLGEAQT-IANFTVLPRGTIYTDSQHP-ESWQKIQVLEAPRAAAPEKPDAEH-------DAPQF-IEPLDSIDRMEFQSAHFQTKVTPQTDPNLRIQWFKDGQPLMNSNRFKLTTDFGYISLDIAHT-VPEDSGVYSVKASNAKGDAEVQAQLTV 1843          

HSP 4 Score: 148.673 bits (374), Expect = 4.089e-36
Identity = 125/423 (29.55%), Postives = 200/423 (47.28%), Query Frame = 2
Query:  695 FEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTV--EEGNPARFLVKVS--GYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
             EAP +K++        PPRF                   + ++T P S V          E  PA   A V P  DP LT+ W+ +G P++A SR     + G+ I+DI  T   DSGE+ CVAKN  G +  S +T+ V   E ++ +S  PQ + + I  IEA    P+ +    D     P  V  +     L+ G S HL+T+  P+ D S+ +EW K+G+P+ +  R+ +V D GFA+LDI+ ++  D G+Y     N +G+A S      V+    ++ + Q  Q++    ++++I   ED  R      E+E  E+ P F I+P++  V  EEG  A F  +       + Q+QW+ +   L   + I+ + S G +  LE            +  A N++GEAV +  L+  P+
Sbjct: 2525 IEAPKQKLEEADPEPKGPPRF-------------------IQQLTSPGSLV----------ENQPAHFEATVEPVDDPTLTINWFLNGEPMSASSRVKMINDFGWVIMDIAQTEPRDSGEWKCVAKNAAG-EAVSTATIEVQGKEVILQDSLQPQSL-DRIRQIEAGKPAPEERP---DQQFEAPAIVNALQVQGALEEGGSAHLQTQFTPVADPSIKVEWLKDGQPIFHSNRYKMVHDFGFAVLDILHLLKHDAGEYTFRVSNNSGEA-STSTSFEVSESSGLILQPQNEQKA----KAVEI--LEDNLRRRPEEIEQELKEATPVF-IEPLSAPVETEEGGRAHFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYV-VLEISPTYPEDNGEYICRAVNRVGEAVTSTKLTCTPK 2904          

HSP 5 Score: 147.132 bits (370), Expect = 1.404e-35
Identity = 85/209 (40.67%), Postives = 111/209 (53.11%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTES---IAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            EG  A  TAR  P  D  L VQWY DG PL  GSR  T    G+ +L+I  T+ ED+GEY C A N  G   TS + L     E ++  + LP+ M  +   IA IEA    P  +D   DA   PP+F   + G   LQ GQ  HLE +V P+ D  LVIEWF NG+P+N+  R   + D GF +L +     +D+G + C A N+ G
Sbjct: 2823 EGGRAHFTARYEPVNDNQLQVQWYHDGRPLKNGSRIKTINSFGYVVLEISPTYPEDNGEYICRAVNRVGEAVTS-TKLTCTPKEGIISATQLPERMANAGRRIAEIEAP--RPAREDAP-DADHGPPKFTSALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHG 3027          

HSP 6 Score: 142.51 bits (358), Expect = 3.410e-34
Identity = 84/244 (34.43%), Postives = 133/244 (54.51%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASL--NTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA-QSNVVRLLVATEETVVTKSQLPQESVQYLQSLD 1600
            E +     AR++PA D  +TV+WY +G PL A  RF+  F+ G+  LD+LY + +DSG Y+ VA+N  G +  S   L V  ++ + L  H P+ + E I  +E        + +D   DA    P+F+  +P +  L   +++H++ R  P+ D ++VIEWF NGRPL  G R   + + GF  LDI G I+ED+G Y   A N  G+A +  V+ +  A +    T+ Q     + YL++L+
Sbjct:  703 ENERVHFEARILPANDVKMTVEWYHNGNPLPAAHRFHPMFDFGYVALDLLYAYPQDSGTYTLVARNELG-EARSNVELVVGTEKVLYLEPHHPEGL-ERIKELEQDRRQGIAEVEDRTCDA---APKFLNDLPDI-QLNEHENIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQCVITVTPAGQILSDTQHQESLGKINYLENLN 940          

HSP 7 Score: 139.043 bits (349), Expect = 4.299e-33
Identity = 103/382 (26.96%), Postives = 168/382 (43.98%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHI-----DAP-----IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            P F+   + +    E   +   AR+ P  DP L V W KDG PL   +R       G   L +  T+ ED+G Y+CV  N+ G  Q+S     V +D   + + H      +S+  I        +  IHI     + P     +  P+F + + G   +   + VH E R++P  D  + +EW+ NG PL    RF+ +FD G+  LD++    +D+G Y   ARN+ G+A+SN V L+V TE+ +  +   P E ++ ++ L+    + +     R       ++ P F  D+  I L   E             P   I+WF+N   ++  S  K  ++     L+ +           V A N LGEA+    ++V P
Sbjct:  551 PKFLSQIQPFHCEQELGRSFFEARIQPINDPTLRVSWLKDGQPLPNANRIQIFQNFGVVSLSLHPTYPEDAGVYTCVLFNSHGQAQSSAELTTVWIDTLQLDSKH-----ADSLPII----GYLDSHQIHIGPQSVERPEEFNSLEAPKFARELAGKIEVMENERVHFEARILPANDVKMTVEWYHNGNPLPAAHRFHPMFDFGYVALDLLYAYPQDSGTYTLVARNELGEARSN-VELVVGTEKVLYLEPHHP-EGLERIKELEQDRRQGIAEVEDR-----TCDAAPKFLNDLPDIQLNEHENIHVDLRATPVNDPTMVIEWFVNGRPLLTGSRVKTLNEFGFIALDIKGAIAEDSGTYSVRASNLLGEAIRQCVITVTP 916          

HSP 8 Score: 134.806 bits (338), Expect = 8.369e-32
Identity = 83/230 (36.09%), Postives = 124/230 (53.91%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVAN--EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            +PP+FV  P +  + +  EG+P  L  +V P  D +L + W +DG  L  G RF T ++ GF  LDIL  + +D+G Y+C A+N+ G  +T  +T+     ++++     P+     I  IEA    P  Q++  D P +PP FVK +        G +V+LE +V P  D+SL  EW  NG+PL    RF +  D G+  L+I+    ED G Y    RN+AG+AQS V
Sbjct:  954 EPPTFVV-PLQADLGDVEEGEPIHLECQVNPINDNSLKIIWLRDGQSLPHGHRFRTFYDFGFVSLDILGFYAQDAGTYTCRAENSLGQAETV-ATIRCAPKDAILGAVQHPRSYAR-IQEIEAP--KPAPQEVP-DLPHQPPAFVKQLGPAIQCMEGDNVYLEAQVTPTDDNSLTYEWLVNGQPLMKAHRFVLSQDFGYIALNILYCYPEDNGTYTLVVRNRAGEAQSTV 1177          

HSP 9 Score: 130.954 bits (328), Expect = 1.435e-30
Identity = 121/427 (28.34%), Postives = 197/427 (46.14%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF--LVKVSGYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFI-VVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPS 2089
            PP FV          EG P+   A+ IP  DP  +VQWY +G PL+A SR     + G   LD+ YT  ED+GEYS V KN+ G D+TS   L+     +++ ++   Q   + I  IEA    P+      + P+   P FV+P+  + +L  G    LE R++P+ D +L ++WF N +PL      +   D G   L I  V +  TG Y C A N +G A ++   + V   E ++  +  P  S+Q +Q L+ I     +D     YE+ +  +   +++       V EG       LV+ SG P  +++W LN   L      ++ Y  G+ + L      +P +S +    A N  GEA  +AT++                 IL  +++P  + ++  L+   +  E++   +K KP+
Sbjct: 1882 PPKFVTQLHSLDGVVEGQPSHFEAQFIPFSDPKTSVQWYLNGNPLSASSRRILRNDFGLVSLDLQYTLGEDAGEYSVVVKNSEGEDRTS-GQLSCTTRAAILGDTQHEQSW-QRIQEIEA----PRAPGAEPEGPVYEKPSFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYARHTGVYSCKAWNDSGNAVTS-ANVGVQGSEGLLLDTSHPA-SLQKIQELEAIDKYARLDAPEREYEKPQWVQGFENYE------NVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGN-AILTIVHV-LPHDSGVYTCRAWNTQGEASTSATVTTAGYE-----------KILYDSQHPVSWERIQELEAPKIVEEIEEIVQKEKPN 2281          

HSP 10 Score: 125.176 bits (313), Expect = 8.794e-29
Identity = 79/214 (36.92%), Postives = 114/214 (53.27%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            +E     L A+V P  D  L  +W  +G PL A SR+    + GF  LDI Y   EDSG+Y+ V  N+ G  +TS     V+  +S++ ++  P+ +   I  +E  L   K  D   DA  +PP F + + G    L+ GQSVH++  V PI D SL IEWF +GRPL  G R   + D G+  L+ + +  EDTG Y C A N  G+A +++
Sbjct: 1235 HESQTLHLEAQVTPIDDNTLRYEWLFNGNPLKASSRYRVLNDFGFVSLDIDYIIAEDSGKYTLVVYNSAGRAETS-CEFQVDRLKSILSDTAHPESL-RRIREME-QLQPAKPSDD--DAAAQPPVFTQQLTGPTEPLKEGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIGEATTDI 1443          

HSP 11 Score: 122.865 bits (307), Expect = 4.642e-28
Identity = 89/265 (33.58%), Postives = 133/265 (50.19%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIR---PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDI 1603
            + + PSFV+  +      EG  A L AR++P  DPNL VQW+ +  PL   +  +TS + G   L I   +   +G YSC A N+ G   TS + + V   E ++L++  P  + + I  +EA     +     +DAP R    PQ+V+      N+  GQ+V L   V P  D  L +EW  NG PL N  RF   ++ G AIL I+ V+  D+G Y C A N  G+A ++   +  A  E ++  SQ P   E +Q L++  I
Sbjct: 2011 VYEKPSFVQPLQSVGDLPEGSVALLEARLVPVNDPNLRVQWFYNDQPLMESNWISTSNDFGCVSLRIAPVYARHTGVYSCKAWNDSGNAVTS-ANVGVQGSEGLLLDTSHPASL-QKIQELEAIDKYAR-----LDAPEREYEKPQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTSAT-VTTAGYEKILYDSQHPVSWERIQELEAPKI 2267          

HSP 12 Score: 122.094 bits (305), Expect = 7.567e-28
Identity = 103/334 (30.84%), Postives = 144/334 (43.11%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXX------------XXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVI 1795
            PSF +        NE D  +    + P GDP L VQW  +G P+   +R + + E G A L I +    D+GEY CVA N  G   TS   +                       A+E+S          IDAP    Q V     + N+  G S+HLE RV PI D  L +EW +NG PL    RF   F+ GF  LDI+    ED GDY    RN  G+A+S        T+ TV     LP+ S+ Y  S    N +D   S+F+   +              ++  P F  +  N+ V EG   RF  +V+    P  +++WF ++  V+
Sbjct: 3081 PSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKG-SATSVGKI-----------------------AVESS--------TQIDAPQVVQQLVD---SVENILEGDSIHLECRVTPINDPRLHVEWLRNGAPLPEASRFKPTFEFGFVSLDILYAYPEDNGDYELVVRNDKGEARSK-------TKITV-----LPRPSLDYT-SQTHGNQQDSLESHFKQHSQAKLQLTANDIYNESDKRAPEFRTQLQNIGVLEGEFCRFETQVAPINDPYLKVEWFKDKKPVL 3366          

HSP 13 Score: 120.168 bits (300), Expect = 3.302e-27
Identity = 96/363 (26.45%), Postives = 167/363 (46.01%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT---VEEGNPARFLVKVSGYPRPQ--IQWFLN-ECLVIPTSIQKVYSDGSISY-LEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            EG    +   V P  DP+L ++W+ DG PL  GSR  T  + G+  L+ L+   ED+G Y+C A N  G      +T ++ L+     N +L      S   I+   N    ++   +   +PP F + +    + Q GQS+ LE R+IP+ D ++ + W +NG+PL    RF    +  +  LDI+ +  ED+G Y C A +  G+A ++      A +  ++    +   S + +Q ++       +R      + E  ++ P F +  +N +   ++EG P     +V      Q  +QWF N + L      +  +  G ++  + +   +  GE   V  A+N LGEA   A  +V+P
Sbjct: 1369 EGQSVHMDCVVQPINDPSLRIEWFHDGRPLMFGSRIRTIHDFGYVGLEFLHIHPEDTGTYTCKATNLIG-----EATTDIFLECKPRRNIYLDTHHESSWQKIQEIENRVDEREPTPELTFQPPTFTENLADKEDAQEGQSIRLECRLIPVNDPTMRVTWTRNGQPLPEASRFMPARNFDYVNLDILALYGEDSGVYTCKAVSAFGEAATSCTVKCAAGKSLLL--DTMHDASWKRVQEIE-------NREKLEAVDAEPEKTAPKF-VTQLNSSLGELQEGVPIHLEAQVEPTNDNQLTVQWFHNGQPLANGHRFRTRHDFGYVALDILYAFAQDTGEWACV--ARNSLGEAQTIANFTVLP 1714          

HSP 14 Score: 117.087 bits (292), Expect = 2.642e-26
Identity = 106/371 (28.57%), Postives = 161/371 (43.40%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF--LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +V+  E Y+   EG   +L   V P+GDP+L ++W  +G PL   +RF   +E G AIL I++    DSG Y+C A N  G   TS +T+     E ++ +S  P    E I  +EA    PK  ++I        P F+  +    N+  G  +HLE+   P  D  L + W KNG+PL          + G+A LDI     +  G Y     N  G+A S    + VA    ++  ++  +ES + +Q L+     + +     Y+       +   D K  N    EG+   F  L+     PR Q+QW  N   +   S   +  D  I  L+        E    +   N  GEAV++ATL  
Sbjct: 2148 PQWVQGFENYENVGEGQTVTLHGLVEPSGDPHLRLEWLLNGTPLRNANRFRQEYEFGNAILTIVHVLPHDSGVYTCRAWNTQGEASTS-ATVTTAGYEKILYDSQHPVSW-ERIQELEA----PKIVEEIEEIVQKEKPNFLTQLESAENVPEGVPLHLESTFQPARDPELKVVWQKNGQPLGASQLVQTKHELGWATLDISSANEDHNGVYTLTITNSEGEAVS-TASIRVAGTGPILGNTRH-EESWKRIQILEAPKEAEPEAPAPVYDHPAITTQI---DDKECN----EGDHVHFEALITPVNDPRLQVQWIRNGVPLAHGSKYAIQQDFGICTLDVAYTYPEDEGVYQLRIWNPEGEAVSSATLKC 2503          

HSP 15 Score: 100.908 bits (250), Expect = 2.337e-21
Identity = 72/256 (28.12%), Postives = 115/256 (44.92%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRP-PQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL 1597
            PP F           EG  A L  +V P  DP L ++W+ +G P+   +R     + GF +L +     +DSG ++C A N  G D+ S + L V     V        E  E I  +E  ++ PK +D+++ A   P P F + +  L  L    +      + PI D +L ++W  NG P+    R +   + G A L I  +I+ D G+Y C A N  G A S  V  +     T +   Q+ Q+ V  ++++
Sbjct: 2944 PPKFTSALAGPPELQEGQQAHLECQVTPVADPRLVIEWFHNGQPVNHTNRMKAIHDFGFVVLQLTPAEPQDSGTWTCRATNQHGSDEVS-TELKVVGGGGVSYEWQSTAERKERITELEDWIHRPK-EDLNLPAVDYPAPSFSQGLTDLGQLNEADATAFVCVLEPIGDPTLRVQWEHNGHPIPYSNRISCTNEFGVATLLIKHLIAADAGEYKCVATNVKGSATS--VGKIAVESSTQIDAPQVVQQLVDSVENI 3195          

HSP 16 Score: 97.8265 bits (242), Expect = 2.048e-20
Identity = 92/353 (26.06%), Postives = 143/353 (40.51%), Query Frame = 2
Query:  887 PASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRC--KIPGESFIVVSAKNKLGEAVANATLSV 1939
            PA  + ++   G+P  T+QW+KDG PL    RF    E G   L        D+G Y  VAKN  G +    + LNVNL ++         +  E     EA   T + Q I +D                    G+      +     D +  I W++N  P+ +   + I   +G AIL I    +ED  +Y   A N AG+A S+V  L++      + KS + +      QS D                 +     PHF  K  +++  +G+  +F  +V G P P +QW      +  ++  K+  DG  + LE  R      GE  IV+  +N  G A + A L++
Sbjct: 4022 PAEFSCQI--GGEPKPTIQWFKDGQPLPNDDRFQVVEEGGAYKLKFSNIISTDAGIYEIVAKNGVG-EARCKARLNVNLQKT--------GKGAEEGPRYEAPRFTSQIQPIVVDE-------------------GKGAQFSAQFSGFPDPT--IRWYRNNEPVKHADGYEISQSKGEAILRISAARNEDVAEYKVEASNPAGKA-SSVANLVLTPRSGRIAKSTISRGGSASYQSSD-----------------KAAADSPHFIAKLSDISARQGHTVKFSAEVDGNPEPTVQWQFKGKPISASNNVKISRDGKRAILELARVTPDSAGEYQIVI--RNDKGAATSQAKLTL 4322          

HSP 17 Score: 95.5153 bits (236), Expect = 1.232e-19
Identity = 67/218 (30.73%), Postives = 96/218 (44.04%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            R Q   EG    L  ++ P  DP+L V W  DG  L +  ++  +   GFA LDI  T   DSG YSC A N  G  +   + + V   +      H  Q   E +  I+ + +   +QD+        P+F+  +   +  Q       E R+ PI D +L + W K+G+PL N  R  I  + G   L +     ED G Y C   N  GQAQS+ 
Sbjct:  433 RSQEVFEGQQIHLETKLTPINDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLGESENQATIIIVPKSDLQQFEQHR-QLDVEDVREIQFAHS---SQDL-------TPKFLSQIQPFHCEQELGRSFFEARIQPINDPTLRVSWLKDGQPLPNANRIQIFQNFGVVSLSLHPTYPEDAGVYTCVLFNSHGQAQSSA 639          

HSP 18 Score: 85.8853 bits (211), Expect = 1.131e-16
Identity = 72/256 (28.12%), Postives = 113/256 (44.14%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQ---DIHIDAP-----IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDV 1621
            EG  A L  +  P  DPNL + W  +G  + A SR  T  + G A L+I      D GEY+ VA N  G  + S +        +V+ +    Q+          +  +   Q     H+D P     +R  +  +          GQ +HLET++ PI D  L + W  +G  L +  ++      GFA LDI    S D+G Y C A NK G++++    +       +V KS L Q+  Q+ Q LD+++  ++
Sbjct:  311 EGQSARLEIKYTPVEDPNLRIAWLLNGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANI-------AVIGHGSFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNFHSDLRSQEVFE----------GQQIHLETKLTPINDPDLRVVWLLDGNELPSNDKYRQTLSHGFASLDIPQTSSNDSGLYSCRAFNKLGESENQATII-------IVPKSDL-QQFEQHRQ-LDVEDVREI 540          

HSP 19 Score: 67.0106 bits (162), Expect = 5.993e-11
Identity = 89/369 (24.12%), Postives = 146/369 (39.57%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ--NTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQ--WFL--NECLVIPTS--IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            +GD   L  +    G   ++ +W+KD  P+++G  +    +     L I     ++ G Y C A N  G   T    + VN  +     +H        +  +E S  TP  Q   + A    P+F   +     L  GQS  LE +  P+ D +L I W  NG+ +    R     D G A L+I  V   D G+Y   A N  G+A+ +    ++     +  +    Q      QS   Q      +D  NF            H D++  +  V EG       K++    P ++  W L  NE   +P++   ++  S G  S L+  +            A NKLGE+   AT+ ++P++D +
Sbjct:  180 DGDSVKLYCKAAGEG---VSFKWFKDNEPISSGGSYAVDNKGNETTLHINNATMKEGGWYRCDATNKHGT-TTLKGRVVVNSRQKFNGPAHREMITLRKVDKVERS-RTPVNQLQDVSASKSSPKFEGSLQS-QQLVEGQSARLEIKYTPVEDPNLRIAWLLNGKGILASSRIVTFTDFGIAALEINPVNVFDQGEYTVVAVNPLGEARVSANIAVIGHGSFIQQQQSGSQFGGTAYQSKGAQAPAGTHLDLPNF------------HSDLR--SQEVFEGQQIHLETKLTPINDPDLRVVWLLDGNE---LPSNDKYRQTLSHGFAS-LDIPQTSSNDSGLYSCRAFNKLGESENQATIIIVPKSDLQ 524          
BLAST of Titin vs. Ensembl Fly
Match: sls (gene:FBgn0086906 transcript:FBtr0072848)

HSP 1 Score: 201.06 bits (510), Expect = 1.027e-52
Identity = 130/404 (32.18%), Postives = 215/404 (53.22%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDA-----PIR--PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTE--------DVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE-NDFRPELK 1972
            ++E+  PP F        V +E +      +V P  DP+L V+WY++G PL +G R+   F+ GF  LDILY + EDSGEY C A NN+G D+T  +T++     +++L + +P+ M  S A  +      K T ++H+       P R  PP+FV  +     L        E ++ P+ D ++ +EWF NG+PL +  RF  ++D G+  ++   V  ED+G+Y C A N  G+ ++  + + V+ +  +V  SQLP     ++QS+D I+  E        +VD        + +  + P F  K    TVEEG+PARF V+V+G+PRP++ W +N   V+  S  K+ +DG + +L+  + +      + V A+N +GE++A   L V+   +D+R  LK
Sbjct: 3804 VEEVFGPPKFTTQITSVTV-DEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRTR-ATVSCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQIKEQLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVAMNFGWVYPEDSGEYVCRATNLYGKDETRAI-IKVSGKPGIVYDSQLP----AHMQSIDRIREMEASWQVVPDEVD-------PDAKPRTKPVFVSKLEPQTVEEGDPARFCVRVTGHPRPRVMWLINGHTVVHGSRYKLTNDG-MFHLDVPKTRQYDTGKVEVIARNSVGESIATTELKVVARSDDYRNVLK 4192          

HSP 2 Score: 186.422 bits (472), Expect = 5.070e-48
Identity = 121/383 (31.59%), Postives = 182/383 (47.52%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT---ESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ------ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PP F+          EG  A   AR+ P  DP+L V+WY +G  L  G RF T  + G  ILDILY ++E+SG Y   A+N +G D T  S L      S++L+S LP+ M    E IA +E S+     ++   +   + P F  P+  + NL+ G++ H E R+ P  D  L +EW+ NGRPL  G RF    D GF IL+I  V  ED+G+Y C A N+ G+A +    + +  + +++ +SQLP+      + +  L+ L  ++TE V   +            P F   P ++ + E   A F  ++     P  ++ WF N   +   S  K  +D     LE   C           A NK GEA  +  L V
Sbjct: 3259 VAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRAS-LKCASKSSLILDSQLPRGMEGGLEKIANLEYSM-VRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTAT-MKIQGKRSIIMESQLPKGMEGTIDRIAELEGLGSRSTEFVPDDD--------TGKPPEFITSPFDMVIGENALAHFECRLQPINDPSMRVDWFHNGKALWAGSRIKTINDFGFVILEIAGCYQRDSGLYTCKATNKHGEATVSCKLQV 3630          

HSP 3 Score: 180.259 bits (456), Expect = 5.654e-46
Identity = 124/396 (31.31%), Postives = 202/396 (51.01%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNL--DESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTD 1981
            ++E    P F+      +   EG+ A L  RV P  DPNL ++W+ +G  L  G R+ T+ + G+  LDILY + ED+G Y C A N  G    + +T NV +    S++L++  P  + E I  +E+ +   +T+    DAPI PP F   + G   +  GQ+ H E +V P+ D +L IE++ NG+PL +  RF+I FD G+  LDI   ++ED G+Y   A N  GQA S+   L V    T+++ +Q P+  E ++ L+S      ++ +    R   +    + P  +I  IN    E   A F  ++   G P  +++W+ NE ++  +S I K +  G +S L+    +   E   +  A N LGEAV  A++ V+ E   + + +  D
Sbjct: 2082 VEEKGQKPIFLTPLSNLEHLKEGEHAHLECRVEPINDPNLKIEWFCNGKQLPTGHRYRTTHDFGYVALDILYVYGEDTGTYICKATNQLG---EAVNTCNVRVLNRRSMILDTQHPDAL-EKIQKLESKVPNARTEVG--DAPISPPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYHNGKPLPSASRFHITFDFGYVSLDITHAVAEDAGEYSVRAVNALGQAVSS-TNLRVIPRGTIISDTQHPEGLEKIRKLESTAPHQRQEPETPGTR---QRPVFTQPLQNIDRIN----EHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVS-LDISHIRKEDEGVYMCRAVNPLGEAVTTASMRVVSEASIQMDTQHPD 2462          

HSP 4 Score: 167.162 bits (422), Expect = 7.892e-42
Identity = 121/395 (30.63%), Postives = 182/395 (46.08%), Query Frame = 2
Query:  764 PNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +Q     S+   ++  DE          P R     E       AR+IP GDP LTV+W ++G P+ A +R  T  + G+  L++ Y   EDSG Y+C A N  G   TS S L V    S+ L +     M   I  +E      + ++         P FV  + G  NL  GQS H E R+ P  D +L +EWF NG+PL+ G RF   +D GFA LDI+ V +ED+G+Y C   N  G+A +++V L V +  +++ ++Q  +   +      IQ+ ED  R   + +EE+ +   P F     N  V EG P      L+ V+  P  +++W+ N   +      K   D     L+            +  AKN +GEAV    ++V
Sbjct: 1666 PRLQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSAS-LIVQSKTSIQLETQHEAAM-HKIHQLEDHSRYQRREEEEYTVTT-APVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNGKPLSTGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIV-LNVTSRSSIIHETQHEEALTK------IQHLEDTSRFQRKTDEEQFHAERPQFGRPLRNAKVNEGAPVHLEATLIPVND-PTMKVEWYCNGRPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAIGEAVTTCAVNV 2049          

HSP 5 Score: 162.54 bits (410), Expect = 2.146e-40
Identity = 119/375 (31.73%), Postives = 176/375 (46.93%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVR--LLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINL-TVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P F  H +  +   +G  A     +IP  DP+L V+WY +G  +   +R  T  + G+ +LDI Y    DSGEY C A N +G D T  +TLN      V  +S  P    +S+  I   L  P+ Q     AP+   PP+F+  +  +  L  GQS H E R+ PITD  LV+EW+ NG+ L +G RF    D G  ILDI+    E++G Y   ARNK G+   +V R  L  A++ +++  SQLP+     L+   I N E           EE     P F +   N+  + EG  A F  +++    P+ +++W+ N   +   S  + + D     LE               A N+ GEAV  AT+ +
Sbjct: 3130 PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTR-TTLNCGGRGGVFYDSLQP----DSLQRIR-ELECPQGQQADTSAPLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGE---DVTRASLKCASKSSLILDSQLPRGMEGGLEK--IANLEYSMVRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTATMKI 3493          

HSP 6 Score: 162.155 bits (409), Expect = 2.626e-40
Identity = 116/381 (30.45%), Postives = 190/381 (49.87%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT--ESIAAIEASLN---TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARF---LVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            + P F+ H    +   E D       V PA DP ++++W+ +G PL A ++F + ++ G+  LD+  ++ E+SG Y+C A N+ G   TS  TL     +++ L++  PQ     E++   E  L    T KT       P  PP + KP+   ++L   Q +HLE  V P  D +L IEW+ NG+ LN+G RF +  + GF  +D+I V + D G Y C A NKAG+A ++   +  +++E ++  +Q P+ +    Q   IQ+ ED  R +    E+ +    P F  + +N+  + EG  A F   L+ V G     I+WF N + L     ++ +Y+ G+++ LE    KI         A NK G A  +  L  +
Sbjct: 2752 ETPVFITHLNNIE-CKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCALDLTNSYAENSGVYTCKATNSKGSATTS-GTLKCTGGKTMFLDTQHPQGEAGLEAVQETEEELANRYTSKTTKPETQYP--PPVWTKPLQAEFHLSEAQPIHLEANVEPKEDPNLFIEWYFNGKMLNHGSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAYNKAGEAFTSTT-IFCSSKENIIESTQHPKGAEGLEQ---IQDLEDSLRKDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPV-GDQSMVIEWFYNGKVLEASHRVRTIYAFGTVA-LEVLGTKIEDTGTYTCRATNKHGTAEISCNLECV 3122          

HSP 7 Score: 151.754 bits (382), Expect = 5.636e-37
Identity = 96/305 (31.48%), Postives = 157/305 (51.48%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETV-VTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLN 1780
            EG    L  R+ P GDP++ ++W+ +G P+  G RF  ++E  +  LD+L  +  DSG Y+C A+N  G   TS S   +  ++ ++   +  +   + I  +E S    +++ +     IRP +F+     L N + G   H E ++ P+TD +L +EWFKNGRP+  G RF  + D G+  LDI+ +I+ED+G Y C A N  G  ++ V     + E+ V VT+++   E + YL        ED  R   R E +E  +  P F     N+ ++E   A F   L+ VS  P  +++W+ N
Sbjct: 1304 EGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDLILETQN--ESGLQKIQYLEDSTRHRRSEFVDEVVNIRP-RFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVELQCRSGEQIVTVTQNEAGLEQIHYL--------EDRSRYTRREEIDESTKQAPVFTTSLKNVEIKENQRAHFECRLIPVSD-PSMRVEWYHN 1596          

HSP 8 Score: 151.369 bits (381), Expect = 8.195e-37
Identity = 112/397 (28.21%), Postives = 185/397 (46.60%), Query Frame = 2
Query:  770 MQQSFRSSRSGSVAHLDEITD-PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ----LPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            ++ S R  RS  V   DE+ +  P F+ HP+      EG  A    ++ P  DPNL V+W+K+G P+  G RF    + G+  LDI++   EDSG Y+C A N  G D+T    L     E +V  +     + E I  +E      + ++I  ++  + P F   +  +  ++  Q  H E R+IP++D S+ +EW+ N  PL +G RF    + GF  LDI+  + ED G Y C A N  G+A ++ V  +V T++++  +SQ    LP+          +Q+ ED  +      ++E     P F +   ++ V E     F  ++   G P+  ++W  N   +  ++      D     L  +             A N+LG+AV +A+L V
Sbjct: 1404 LEDSTRHRRSEFV---DEVVNIRPRFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVE-LQCRSGEQIVTVTQNEAGL-EQIHYLEDRSRYTRREEID-ESTKQAPVFTTSLKNV-EIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGSRFTETNNFGFVALDIMSTLPEDAGTYTCRAYNAVGEAITSAV-AVVHTKKSIYLESQHETALPR----------LQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIV 1782          

HSP 9 Score: 150.214 bits (378), Expect = 1.507e-36
Identity = 115/381 (30.18%), Postives = 177/381 (46.46%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQ-SNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            IT  P F+   +      EG  A   ARV P  D  L ++WY +G  + A +R  T ++ G+  LDI     ED+G Y  VA+N  G  Q   +T+ V    S+  +S + + + E    +E         DI  +     P FV P+     +  G+++HLE R+ P+ D ++ +EWF NGRP+  G RF   +D GF  LDII   + D+G+Y   A N  G A  S  VR++  T+  VVT++Q  Q   Q      IQ  ED  R + + E+    ++ P F     N+   EG       ++   G P  +I+WF+N   V      +   +     L+   C           A+N+LGEAV + ++ +I +ND 
Sbjct: 1020 ITQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQ-ATMIVETRSSIDTSS-MHRGLYEKTQNLENKPFVEPQYDIE-EISKSKPVFVTPLSDPKPIHDGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTD--VVTETQNEQSLEQ------IQLLEDSRRRHHQEEDITIMQA-PQFTRGLHNIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDL 1388          

HSP 10 Score: 150.214 bits (378), Expect = 1.574e-36
Identity = 111/387 (28.68%), Postives = 194/387 (50.13%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT-ESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE--TVVTKSQLPQ-----ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            DE  +PP F +  +      EG P     RV P GDP + ++W+ +G  +A GSR +   + GF  LD+ Y +  DSGEY+C A N +G   TS + +      ++V  S LP+ MT E +  +E     P+   + ++    PP+F   +  +  +   ++V  E +V P TD SL +EW++NG+PL +G R+  +FD GF  LDI+ V  ED+G+Y C A N  G+ ++   R  V+ ++  T++ ++Q+P+     +++  +++   + T +V  +     + +  +  P F   IK   LT+ E    +F  +++  G P  +++WF N + L+     Q +Y  G ++ + F           V  A N  G+    A + V
Sbjct: 3670 DEQPNPPKFTEEIKDNLDVPEGGPIHFDCRVEPVGDPTMRIEWFYNGHVMATGSRVHQLNDFGFIALDVDYIYARDSGEYTCRATNKWGTATTS-AKVTCKGKHNIVYESQLPEGMTSEKLKELERG-RIPEAPKV-VEEVFGPPKFTTQITSV-TVDEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRT---RATVSCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQP-PRFVTQIKE-QLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVA-MNFGWVYPEDSGEYVCRATNLYGKDETRAIIKV 4046          

HSP 11 Score: 147.132 bits (370), Expect = 1.688e-35
Identity = 124/400 (31.00%), Postives = 177/400 (44.25%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQV-ANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEAS--LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF-----DIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPEND 1954
            +S +   V    E   PP F K P + Q+   E   A   AR+ P GD  + V+W KDG PL A SR  T    G+  L I      D+G Y+C A N  G D T+ + L V     +V  S  P  + + I  +E S      + ++ +I    + P+F+ P+ G   +  GQ  H E RV P +D  LVIEW+ NGR +    R    +D G+  LDI  V +ED G Y   ARNK G+AQ     +       V T+S +   S+        QN E+      +Y+ EE ++S P F     D KPI+    +G       ++   G P  +++WF N   V   S  + Y D     L+  +          V A N LG A  +A + VI   D
Sbjct:  873 KSQQRRHVQEAAEAIAPPQF-KTPIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQD-TTVAQLTVISKNEIVSESQHPGGL-QKIQHLEDSSRYGRREEEETYI---TQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQATMI-------VETRSSIDTSSMHRGLYEKTQNLENKPFVEPQYDIEEISKSKPVFVTPLSDPKPIH----DGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTD 1255          

HSP 12 Score: 146.362 bits (368), Expect = 2.560e-35
Identity = 112/390 (28.72%), Postives = 190/390 (48.72%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL--PHFDIKPI--NLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPE 1966
            D +  PP F+   +  Q   EG    + AR+ P GDP + V+WY +G PLAA +R  + F+ GF  LD+L     DSGEY C   N  G+ + S + L+V    S+  +S  P  + + I  +E      +T+ I  D  + + PQF++P+  L   + G++VH E +V P+ D S+ +EW+K+G P+    R   +F+ G+  L+I+ + +ED G Y   A N+ G+A S    + V +   V     +P++  +Y++   ++  ED  +S  R   +E  E++  P F   PI   L + E   A F  ++   G    +++W  +   +  +S    Y +     L  ++  I         A N +G+    A L+VI +N+   E
Sbjct:  612 DRVYPPPQFIIPLQNVQ-QTEGGRVHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAE-SRAILSVVQRPSIEQSSQNPNSL-QYINQLEDYSRYQRTESI--DEQLNQAPQFIRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTVRAVNRIGEAISQ-SSIRVHSRSQVTADLGIPEQQ-RYIEK--VEELEDYRKSQQRRHVQEAAEAIAPPQFKT-PIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQDTTVAQLTVISKNEIVSE 991          

HSP 13 Score: 138.272 bits (347), Expect = 9.136e-33
Identity = 107/373 (28.69%), Postives = 168/373 (45.04%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P F +  +     NE   A   AR+IP GDPNL V+WY++   +   SR     + GF  LDI +  KED G Y C A N  G   T+ S + V  + S+ +++  P  ++  I  +E  L    T+   +      P F + + G   L  G   H E RV+P+ D SL  EWF NG  L  G R     D GF  LDI  V+ ED G Y C A N AG+A S+   + V T+  +  +  +P+  E+++ L+   +    ++   +   +       L  +D       + EG       +V     P  +I+WF N   L   + I+  +  G ++ L     +    +     A N++GEAV+ ++L +
Sbjct: 2356 PVFTQPLQNIDRINEHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEAVTTAS-MRVVSEASIQMDTQHPDSISR-IHQLEKPLAPRPTEPERL---FEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAGEAVSSTA-MKVKTKSNIDGQPLIPESWEAIR-LKEAAMNRVPEMFVDSTPQQAPVFTTHLQSYD------KLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVT-LSINGLRADDSAIYTCKATNQVGEAVSTSSLKI 2714          

HSP 14 Score: 132.109 bits (331), Expect = 8.155e-31
Identity = 125/449 (27.84%), Postives = 181/449 (40.31%), Query Frame = 2
Query:  626 SIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDA-PIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDR-------SNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            SIQ DT HP    +     KP                    PR +EP                 + + + P F +         EG  A   ARV+P GDP+L  +W+ +GV L  GSR  T+ + GF  LDI     ED+G Y C A N  G +  S + + V    ++     +P E  E+I   EA++N  +  ++ +D+ P + P F   +     L  GQ V LE +V P  D +L IEWFKNG  L  G R    FD G   L I G+ ++D+  Y C A N+ G+A               V+ S L  E   +LQ+  + + + + R          R E  E     P F     N+  +E +  RF   V  +  P   I+WF N + L      + +Y  G  + L+               A N  G A  + TL  
Sbjct: 2453 SIQMDTQHPDSISRIHQLEKP------------------LAPRPTEP-----------------ERLFEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAG-EAVSSTAMKVKTKSNIDGQPLIP-ESWEAIRLKEAAMN--RVPEMFVDSTPQQAPVFTTHLQSYDKLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVTLSINGLRADDSAIYTCKATNQVGEA---------------VSTSSLKIEDRHWLQAESL-HPDSLPRIGELEAPKEGRPEAPEPTYETPVFITHLNNIECKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCA-LDLTNSYAENSGVYTCKATNSKGSATTSGTLKC 2845          

HSP 15 Score: 129.798 bits (325), Expect = 3.869e-30
Identity = 106/390 (27.18%), Postives = 175/390 (44.87%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFG-------------MDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD----IQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN--LTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P FV+      V  EG+P +++A  I  G P   + W KDGV +++ +      + G   L+I      D+G Y C A+N  G              +Q +     +NL     +    P    E I         P  +    D    PPQF+ P+  +   +GG+ VH+E R+ P+ D ++V+EW+ NGRPL    R   VF  GF  LD++ ++  D+G+Y C   N +G A+S  + L V    ++   SQ P  S+QY+  L+     Q TE +D               P F I+P+      EEG    F  +V+    P  +++W+ +   +  +S I  +++ G +S L     +        V A N++GEA++ +++ V
Sbjct:  471 PQFVQRFSTMTV-REGEPITMSANAI--GTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYVEVPREQPNYEQRRLNLPRPTKVIEPEPIPGPEIIYLRHVERAKPHLRPGEEDRVYPPPQFIIPLQNVQQTEGGR-VHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAESRAI-LSVVQRPSIEQSSQNPN-SLQYINQLEDYSRYQRTESIDEQ---------LNQAPQF-IRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVS-LNILHLRAEDAGTYTVRAVNRIGEAISQSSIRV 843          

HSP 16 Score: 128.642 bits (322), Expect = 9.789e-30
Identity = 100/394 (25.38%), Postives = 164/394 (41.62%), Query Frame = 2
Query:  767 NMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARFLVKVSGYPRPQ--IQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +++ S R  + GS     ++  PP F           EG+ A   A +IP GD ++ ++W+ +G  L A  R  T +  G   L++L T  ED+G Y+C A N  G  + S      NL+                       ++ P+ Q          P+F   +  L  L+ GQS H E  +IP+ D  L +EW+ NG+ + +  R   V D G+ +LDI  +   D+G+Y C A NK G+  +     L       V    L  +S+Q ++ L+    +  D S             P F  + +++T + EG  A F  +++    P   ++W+ N   +      + + D  I  L+   C           A+NK GE V  A+L  
Sbjct: 3008 DLEDSLR--KDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPVGDQSMVIEWFYNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHGTAEIS-----CNLE----------------------CVDKPRGQK---------PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTRTT--LNCGGRGGVFYDSLQPDSLQRIRELECPQGQQADTS------APLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRASLKC 3355          

HSP 17 Score: 82.8037 bits (203), Expect = 1.045e-15
Identity = 83/342 (24.27%), Postives = 127/342 (37.13%), Query Frame = 2
Query:  920 GDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            G+PN TV+WY++  P+            G +IL I   F EDS  +SCVA+N  G   T+  + N+ ++E                                    I+PP FV  +     +  GQ    + +V       L + W KNG  +    +F ++ +     L II   +ED+G Y C A N AG+A+ +         + +V     P++                            +E  PH   +  + TVEEG+   F  +V G P P  +W   E  V P+   ++   G    L         E      A+NKLG    +A L V P
Sbjct: 4419 GEPNPTVKWYRESFPIQNSPDLQIHTFSGKSILIIRQVFVEDSAVFSCVAENRGG---TAKCSANLVVEERRRAGK----------------------------GGIQPPSFVTTIQST-TVATGQLARFDAKVTGT--RPLDVYWLKNGMKIQPSIKFKMLEEDSVHTLLIIEPFAEDSGRYECVAVNAAGEARCD--------GDCIVQSPSKPEKPT-----------------------TPGSEKAPHIVEQLKSQTVEEGSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQMSRQGEYYQLVISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRP 4695          

HSP 18 Score: 72.7886 bits (177), Expect = 1.249e-12
Identity = 90/364 (24.73%), Postives = 130/364 (35.71%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNT---PKTQDIHID----APIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG  A  TARV     P LT  W+ +G  L A  ++  S+  G A L +      D G Y+ +A+               NL   VV         + ++ A+E +  T   PK  D+  +        PP FVK   G   +  G+    + RV   P  +    + W  NGR + +     I+ +  G   L I  V   D G   C ARNKAG+      +L V  +E VV                                        P F  +   +TV EG P        G P+P+I W  +   +  T+ + V  DG  + LE  R       +   +A+N  G     A L V
Sbjct:  268 EGSDAVFTARVGSNPKPRLT--WFHNGQRLVASQKYEISYSSGVATLRVKNATARDGGHYTLLAE---------------NLQGCVV---------SSAVLAVEPAAETAYEPKPVDVMAEQLEAGKALPPAFVKAF-GDREITEGRMTRFDCRVTGNPYPE----VFWLINGRQVRDDASHKILVNESGSHSLMITNVTRLDAGAVQCLARNKAGEVAIE-AQLNVLEKEQVVA---------------------------------------PQFVQRFSTMTVREGEPITMSANAIGTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYV 560          
BLAST of Titin vs. Ensembl Fly
Match: sls (gene:FBgn0086906 transcript:FBtr0309042)

HSP 1 Score: 201.06 bits (510), Expect = 1.075e-52
Identity = 130/404 (32.18%), Postives = 215/404 (53.22%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDA-----PIR--PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTE--------DVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE-NDFRPELK 1972
            ++E+  PP F        V +E +      +V P  DP+L V+WY++G PL +G R+   F+ GF  LDILY + EDSGEY C A NN+G D+T  +T++     +++L + +P+ M  S A  +      K T ++H+       P R  PP+FV  +     L        E ++ P+ D ++ +EWF NG+PL +  RF  ++D G+  ++   V  ED+G+Y C A N  G+ ++  + + V+ +  +V  SQLP     ++QS+D I+  E        +VD        + +  + P F  K    TVEEG+PARF V+V+G+PRP++ W +N   V+  S  K+ +DG + +L+  + +      + V A+N +GE++A   L V+   +D+R  LK
Sbjct: 3819 VEEVFGPPKFTTQITSVTV-DEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRTR-ATVSCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQIKEQLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVAMNFGWVYPEDSGEYVCRATNLYGKDETRAI-IKVSGKPGIVYDSQLP----AHMQSIDRIREMEASWQVVPDEVD-------PDAKPRTKPVFVSKLEPQTVEEGDPARFCVRVTGHPRPRVMWLINGHTVVHGSRYKLTNDG-MFHLDVPKTRQYDTGKVEVIARNSVGESIATTELKVVARSDDYRNVLK 4207          

HSP 2 Score: 186.422 bits (472), Expect = 5.955e-48
Identity = 121/383 (31.59%), Postives = 182/383 (47.52%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT---ESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ------ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PP F+          EG  A   AR+ P  DP+L V+WY +G  L  G RF T  + G  ILDILY ++E+SG Y   A+N +G D T  S L      S++L+S LP+ M    E IA +E S+     ++   +   + P F  P+  + NL+ G++ H E R+ P  D  L +EW+ NGRPL  G RF    D GF IL+I  V  ED+G+Y C A N+ G+A +    + +  + +++ +SQLP+      + +  L+ L  ++TE V   +            P F   P ++ + E   A F  ++     P  ++ WF N   +   S  K  +D     LE   C           A NK GEA  +  L V
Sbjct: 3274 VAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRAS-LKCASKSSLILDSQLPRGMEGGLEKIANLEYSM-VRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTAT-MKIQGKRSIIMESQLPKGMEGTIDRIAELEGLGSRSTEFVPDDD--------TGKPPEFITSPFDMVIGENALAHFECRLQPINDPSMRVDWFHNGKALWAGSRIKTINDFGFVILEIAGCYQRDSGLYTCKATNKHGEATVSCKLQV 3645          

HSP 3 Score: 180.259 bits (456), Expect = 5.861e-46
Identity = 124/396 (31.31%), Postives = 202/396 (51.01%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNL--DESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTD 1981
            ++E    P F+      +   EG+ A L  RV P  DPNL ++W+ +G  L  G R+ T+ + G+  LDILY + ED+G Y C A N  G    + +T NV +    S++L++  P  + E I  +E+ +   +T+    DAPI PP F   + G   +  GQ+ H E +V P+ D +L IE++ NG+PL +  RF+I FD G+  LDI   ++ED G+Y   A N  GQA S+   L V    T+++ +Q P+  E ++ L+S      ++ +    R   +    + P  +I  IN    E   A F  ++   G P  +++W+ NE ++  +S I K +  G +S L+    +   E   +  A N LGEAV  A++ V+ E   + + +  D
Sbjct: 2097 VEEKGQKPIFLTPLSNLEHLKEGEHAHLECRVEPINDPNLKIEWFCNGKQLPTGHRYRTTHDFGYVALDILYVYGEDTGTYICKATNQLG---EAVNTCNVRVLNRRSMILDTQHPDAL-EKIQKLESKVPNARTEVG--DAPISPPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYHNGKPLPSASRFHITFDFGYVSLDITHAVAEDAGEYSVRAVNALGQAVSS-TNLRVIPRGTIISDTQHPEGLEKIRKLESTAPHQRQEPETPGTR---QRPVFTQPLQNIDRIN----EHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVS-LDISHIRKEDEGVYMCRAVNPLGEAVTTASMRVVSEASIQMDTQHPD 2477          

HSP 4 Score: 167.162 bits (422), Expect = 8.622e-42
Identity = 121/395 (30.63%), Postives = 182/395 (46.08%), Query Frame = 2
Query:  764 PNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +Q     S+   ++  DE          P R     E       AR+IP GDP LTV+W ++G P+ A +R  T  + G+  L++ Y   EDSG Y+C A N  G   TS S L V    S+ L +     M   I  +E      + ++         P FV  + G  NL  GQS H E R+ P  D +L +EWF NG+PL+ G RF   +D GFA LDI+ V +ED+G+Y C   N  G+A +++V L V +  +++ ++Q  +   +      IQ+ ED  R   + +EE+ +   P F     N  V EG P      L+ V+  P  +++W+ N   +      K   D     L+            +  AKN +GEAV    ++V
Sbjct: 1681 PRLQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSAS-LIVQSKTSIQLETQHEAAM-HKIHQLEDHSRYQRREEEEYTVTT-APVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNGKPLSTGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIV-LNVTSRSSIIHETQHEEALTK------IQHLEDTSRFQRKTDEEQFHAERPQFGRPLRNAKVNEGAPVHLEATLIPVND-PTMKVEWYCNGRPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAIGEAVTTCAVNV 2064          

HSP 5 Score: 162.54 bits (410), Expect = 2.344e-40
Identity = 119/375 (31.73%), Postives = 176/375 (46.93%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVR--LLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINL-TVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P F  H +  +   +G  A     +IP  DP+L V+WY +G  +   +R  T  + G+ +LDI Y    DSGEY C A N +G D T  +TLN      V  +S  P    +S+  I   L  P+ Q     AP+   PP+F+  +  +  L  GQS H E R+ PITD  LV+EW+ NG+ L +G RF    D G  ILDI+    E++G Y   ARNK G+   +V R  L  A++ +++  SQLP+     L+   I N E           EE     P F +   N+  + EG  A F  +++    P+ +++W+ N   +   S  + + D     LE               A N+ GEAV  AT+ +
Sbjct: 3145 PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTR-TTLNCGGRGGVFYDSLQP----DSLQRIR-ELECPQGQQADTSAPLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGE---DVTRASLKCASKSSLILDSQLPRGMEGGLEK--IANLEYSMVRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTATMKI 3508          

HSP 6 Score: 162.155 bits (409), Expect = 2.867e-40
Identity = 116/381 (30.45%), Postives = 190/381 (49.87%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT--ESIAAIEASLN---TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARF---LVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            + P F+ H    +   E D       V PA DP ++++W+ +G PL A ++F + ++ G+  LD+  ++ E+SG Y+C A N+ G   TS  TL     +++ L++  PQ     E++   E  L    T KT       P  PP + KP+   ++L   Q +HLE  V P  D +L IEW+ NG+ LN+G RF +  + GF  +D+I V + D G Y C A NKAG+A ++   +  +++E ++  +Q P+ +    Q   IQ+ ED  R +    E+ +    P F  + +N+  + EG  A F   L+ V G     I+WF N + L     ++ +Y+ G+++ LE    KI         A NK G A  +  L  +
Sbjct: 2767 ETPVFITHLNNIE-CKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCALDLTNSYAENSGVYTCKATNSKGSATTS-GTLKCTGGKTMFLDTQHPQGEAGLEAVQETEEELANRYTSKTTKPETQYP--PPVWTKPLQAEFHLSEAQPIHLEANVEPKEDPNLFIEWYFNGKMLNHGSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAYNKAGEAFTSTT-IFCSSKENIIESTQHPKGAEGLEQ---IQDLEDSLRKDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPV-GDQSMVIEWFYNGKVLEASHRVRTIYAFGTVA-LEVLGTKIEDTGTYTCRATNKHGTAEISCNLECV 3137          

HSP 7 Score: 151.754 bits (382), Expect = 5.889e-37
Identity = 96/305 (31.48%), Postives = 157/305 (51.48%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETV-VTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLN 1780
            EG    L  R+ P GDP++ ++W+ +G P+  G RF  ++E  +  LD+L  +  DSG Y+C A+N  G   TS S   +  ++ ++   +  +   + I  +E S    +++ +     IRP +F+     L N + G   H E ++ P+TD +L +EWFKNGRP+  G RF  + D G+  LDI+ +I+ED+G Y C A N  G  ++ V     + E+ V VT+++   E + YL        ED  R   R E +E  +  P F     N+ ++E   A F   L+ VS  P  +++W+ N
Sbjct: 1319 EGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDLILETQN--ESGLQKIQYLEDSTRHRRSEFVDEVVNIRP-RFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVELQCRSGEQIVTVTQNEAGLEQIHYL--------EDRSRYTRREEIDESTKQAPVFTTSLKNVEIKENQRAHFECRLIPVSD-PSMRVEWYHN 1611          

HSP 8 Score: 150.984 bits (380), Expect = 8.790e-37
Identity = 112/397 (28.21%), Postives = 185/397 (46.60%), Query Frame = 2
Query:  770 MQQSFRSSRSGSVAHLDEITD-PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ----LPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            ++ S R  RS  V   DE+ +  P F+ HP+      EG  A    ++ P  DPNL V+W+K+G P+  G RF    + G+  LDI++   EDSG Y+C A N  G D+T    L     E +V  +   +   E I  +E      + ++I  ++  + P F   +  +  ++  Q  H E R+IP++D S+ +EW+ N  PL +G RF    + GF  LDI+  + ED G Y C A N  G+A ++ V  +V T++++  +SQ    LP+          +Q+ ED  +      ++E     P F +   ++ V E     F  ++   G P+  ++W  N   +  ++      D     L  +             A N+LG+AV +A+L V
Sbjct: 1419 LEDSTRHRRSEFV---DEVVNIRPRFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVE-LQCRSGEQIVTVTQ-NEAGLEQIHYLEDRSRYTRREEID-ESTKQAPVFTTSLKNV-EIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGSRFTETNNFGFVALDIMSTLPEDAGTYTCRAYNAVGEAITSAV-AVVHTKKSIYLESQHETALPR----------LQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIV 1797          

HSP 9 Score: 150.214 bits (378), Expect = 1.602e-36
Identity = 115/381 (30.18%), Postives = 177/381 (46.46%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQ-SNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            IT  P F+   +      EG  A   ARV P  D  L ++WY +G  + A +R  T ++ G+  LDI     ED+G Y  VA+N  G  Q   +T+ V    S+  +S + + + E    +E         DI  +     P FV P+     +  G+++HLE R+ P+ D ++ +EWF NGRP+  G RF   +D GF  LDII   + D+G+Y   A N  G A  S  VR++  T+  VVT++Q  Q   Q      IQ  ED  R + + E+    ++ P F     N+   EG       ++   G P  +I+WF+N   V      +   +     L+   C           A+N+LGEAV + ++ +I +ND 
Sbjct: 1035 ITQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQ-ATMIVETRSSIDTSS-MHRGLYEKTQNLENKPFVEPQYDIE-EISKSKPVFVTPLSDPKPIHDGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTD--VVTETQNEQSLEQ------IQLLEDSRRRHHQEEDITIMQA-PQFTRGLHNIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDL 1403          

HSP 10 Score: 150.214 bits (378), Expect = 1.659e-36
Identity = 111/387 (28.68%), Postives = 194/387 (50.13%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT-ESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE--TVVTKSQLPQ-----ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            DE  +PP F +  +      EG P     RV P GDP + ++W+ +G  +A GSR +   + GF  LD+ Y +  DSGEY+C A N +G   TS + +      ++V  S LP+ MT E +  +E     P+   + ++    PP+F   +  +  +   ++V  E +V P TD SL +EW++NG+PL +G R+  +FD GF  LDI+ V  ED+G+Y C A N  G+ ++   R  V+ ++  T++ ++Q+P+     +++  +++   + T +V  +     + +  +  P F   IK   LT+ E    +F  +++  G P  +++WF N + L+     Q +Y  G ++ + F           V  A N  G+    A + V
Sbjct: 3685 DEQPNPPKFTEEIKDNLDVPEGGPIHFDCRVEPVGDPTMRIEWFYNGHVMATGSRVHQLNDFGFIALDVDYIYARDSGEYTCRATNKWGTATTS-AKVTCKGKHNIVYESQLPEGMTSEKLKELERG-RIPEAPKV-VEEVFGPPKFTTQITSV-TVDEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRT---RATVSCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQP-PRFVTQIKE-QLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVA-MNFGWVYPEDSGEYVCRATNLYGKDETRAIIKV 4061          

HSP 11 Score: 146.747 bits (369), Expect = 1.874e-35
Identity = 124/400 (31.00%), Postives = 177/400 (44.25%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQV-ANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEAS--LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF-----DIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPEND 1954
            +S +   V    E   PP F K P + Q+   E   A   AR+ P GD  + V+W KDG PL A SR  T    G+  L I      D+G Y+C A N  G D T+ + L V     +V  S  P  + + I  +E S      + ++ +I    + P+F+ P+ G   +  GQ  H E RV P +D  LVIEW+ NGR +    R    +D G+  LDI  V +ED G Y   ARNK G+AQ     +       V T+S +   S+        QN E+      +Y+ EE ++S P F     D KPI+    +G       ++   G P  +++WF N   V   S  + Y D     L+  +          V A N LG A  +A + VI   D
Sbjct:  888 KSQQRRHVQEAAEAIAPPQF-KTPIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQD-TTVAQLTVISKNEIVSESQHPGGL-QKIQHLEDSSRYGRREEEETYI---TQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQATMI-------VETRSSIDTSSMHRGLYEKTQNLENKPFVEPQYDIEEISKSKPVFVTPLSDPKPIH----DGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTD 1270          

HSP 12 Score: 146.362 bits (368), Expect = 2.583e-35
Identity = 112/390 (28.72%), Postives = 190/390 (48.72%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL--PHFDIKPI--NLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPE 1966
            D +  PP F+   +  Q   EG    + AR+ P GDP + V+WY +G PLAA +R  + F+ GF  LD+L     DSGEY C   N  G+ + S + L+V    S+  +S  P  + + I  +E      +T+ I  D  + + PQF++P+  L   + G++VH E +V P+ D S+ +EW+K+G P+    R   +F+ G+  L+I+ + +ED G Y   A N+ G+A S    + V +   V     +P++  +Y++   ++  ED  +S  R   +E  E++  P F   PI   L + E   A F  ++   G    +++W  +   +  +S    Y +     L  ++  I         A N +G+    A L+VI +N+   E
Sbjct:  627 DRVYPPPQFIIPLQNVQ-QTEGGRVHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAE-SRAILSVVQRPSIEQSSQNPNSL-QYINQLEDYSRYQRTESI--DEQLNQAPQFIRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTVRAVNRIGEAISQ-SSIRVHSRSQVTADLGIPEQQ-RYIEK--VEELEDYRKSQQRRHVQEAAEAIAPPQFKT-PIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQDTTVAQLTVISKNEIVSE 1006          

HSP 13 Score: 138.272 bits (347), Expect = 1.005e-32
Identity = 107/373 (28.69%), Postives = 168/373 (45.04%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P F +  +     NE   A   AR+IP GDPNL V+WY++   +   SR     + GF  LDI +  KED G Y C A N  G   T+ S + V  + S+ +++  P  ++  I  +E  L    T+   +      P F + + G   L  G   H E RV+P+ D SL  EWF NG  L  G R     D GF  LDI  V+ ED G Y C A N AG+A S+   + V T+  +  +  +P+  E+++ L+   +    ++   +   +       L  +D       + EG       +V     P  +I+WF N   L   + I+  +  G ++ L     +    +     A N++GEAV+ ++L +
Sbjct: 2371 PVFTQPLQNIDRINEHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEAVTTAS-MRVVSEASIQMDTQHPDSISR-IHQLEKPLAPRPTEPERL---FEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAGEAVSSTA-MKVKTKSNIDGQPLIPESWEAIR-LKEAAMNRVPEMFVDSTPQQAPVFTTHLQSYD------KLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVT-LSINGLRADDSAIYTCKATNQVGEAVSTSSLKI 2729          

HSP 14 Score: 132.109 bits (331), Expect = 8.815e-31
Identity = 125/449 (27.84%), Postives = 181/449 (40.31%), Query Frame = 2
Query:  626 SIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDA-PIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDR-------SNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            SIQ DT HP    +     KP                    PR +EP                 + + + P F +         EG  A   ARV+P GDP+L  +W+ +GV L  GSR  T+ + GF  LDI     ED+G Y C A N  G +  S + + V    ++     +P E  E+I   EA++N  +  ++ +D+ P + P F   +     L  GQ V LE +V P  D +L IEWFKNG  L  G R    FD G   L I G+ ++D+  Y C A N+ G+A               V+ S L  E   +LQ+  + + + + R          R E  E     P F     N+  +E +  RF   V  +  P   I+WF N + L      + +Y  G  + L+               A N  G A  + TL  
Sbjct: 2468 SIQMDTQHPDSISRIHQLEKP------------------LAPRPTEP-----------------ERLFEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAG-EAVSSTAMKVKTKSNIDGQPLIP-ESWEAIRLKEAAMN--RVPEMFVDSTPQQAPVFTTHLQSYDKLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVTLSINGLRADDSAIYTCKATNQVGEA---------------VSTSSLKIEDRHWLQAESL-HPDSLPRIGELEAPKEGRPEAPEPTYETPVFITHLNNIECKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCA-LDLTNSYAENSGVYTCKATNSKGSATTSGTLKC 2860          

HSP 15 Score: 129.798 bits (325), Expect = 4.182e-30
Identity = 106/390 (27.18%), Postives = 175/390 (44.87%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFG-------------MDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD----IQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN--LTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P FV+      V  EG+P +++A  I  G P   + W KDGV +++ +      + G   L+I      D+G Y C A+N  G              +Q +     +NL     +    P    E I         P  +    D    PPQF+ P+  +   +GG+ VH+E R+ P+ D ++V+EW+ NGRPL    R   VF  GF  LD++ ++  D+G+Y C   N +G A+S  + L V    ++   SQ P  S+QY+  L+     Q TE +D               P F I+P+      EEG    F  +V+    P  +++W+ +   +  +S I  +++ G +S L     +        V A N++GEA++ +++ V
Sbjct:  486 PQFVQRFSTMTV-REGEPITMSANAI--GTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYVEVPREQPNYEQRRLNLPRPTKVIEPEPIPGPEIIYLRHVERAKPHLRPGEEDRVYPPPQFIIPLQNVQQTEGGR-VHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAESRAI-LSVVQRPSIEQSSQNPN-SLQYINQLEDYSRYQRTESIDEQ---------LNQAPQF-IRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVS-LNILHLRAEDAGTYTVRAVNRIGEAISQSSIRV 858          

HSP 16 Score: 128.257 bits (321), Expect = 1.076e-29
Identity = 100/394 (25.38%), Postives = 164/394 (41.62%), Query Frame = 2
Query:  767 NMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARFLVKVSGYPRPQ--IQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +++ S R  + GS     ++  PP F           EG+ A   A +IP GD ++ ++W+ +G  L A  R  T +  G   L++L T  ED+G Y+C A N  G  + S      NL+                       ++ P+ Q          P+F   +  L  L+ GQS H E  +IP+ D  L +EW+ NG+ + +  R   V D G+ +LDI  +   D+G+Y C A NK G+  +     L       V    L  +S+Q ++ L+    +  D S             P F  + +++T + EG  A F  +++    P   ++W+ N   +      + + D  I  L+   C           A+NK GE V  A+L  
Sbjct: 3023 DLEDSLR--KDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPVGDQSMVIEWFYNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHGTAEIS-----CNLE----------------------CVDKPRGQK---------PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTRTT--LNCGGRGGVFYDSLQPDSLQRIRELECPQGQQADTS------APLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRASLKC 3370          

HSP 17 Score: 82.8037 bits (203), Expect = 1.167e-15
Identity = 83/342 (24.27%), Postives = 127/342 (37.13%), Query Frame = 2
Query:  920 GDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            G+PN TV+WY++  P+            G +IL I   F EDS  +SCVA+N  G   T+  + N+ ++E                                    I+PP FV  +     +  GQ    + +V       L + W KNG  +    +F ++ +     L II   +ED+G Y C A N AG+A+ +         + +V     P++                            +E  PH   +  + TVEEG+   F  +V G P P  +W   E  V P+   ++   G    L         E      A+NKLG    +A L V P
Sbjct: 4434 GEPNPTVKWYRESFPIQNSPDLQIHTFSGKSILIIRQVFVEDSAVFSCVAENRGG---TAKCSANLVVEERRRAGK----------------------------GGIQPPSFVTTIQST-TVATGQLARFDAKVTGT--RPLDVYWLKNGMKIQPSIKFKMLEEDSVHTLLIIEPFAEDSGRYECVAVNAAGEARCD--------GDCIVQSPSKPEKPT-----------------------TPGSEKAPHIVEQLKSQTVEEGSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQMSRQGEYYQLVISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRP 4710          

HSP 18 Score: 72.7886 bits (177), Expect = 1.360e-12
Identity = 90/364 (24.73%), Postives = 130/364 (35.71%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNT---PKTQDIHID----APIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG  A  TARV     P LT  W+ +G  L A  ++  S+  G A L +      D G Y+ +A+               NL   VV         + ++ A+E +  T   PK  D+  +        PP FVK   G   +  G+    + RV   P  +    + W  NGR + +     I+ +  G   L I  V   D G   C ARNKAG+      +L V  +E VV                                        P F  +   +TV EG P        G P+P+I W  +   +  T+ + V  DG  + LE  R       +   +A+N  G     A L V
Sbjct:  283 EGSDAVFTARVGSNPKPRLT--WFHNGQRLVASQKYEISYSSGVATLRVKNATARDGGHYTLLAE---------------NLQGCVV---------SSAVLAVEPAAETAYEPKPVDVMAEQLEAGKALPPAFVKAF-GDREITEGRMTRFDCRVTGNPYPE----VFWLINGRQVRDDASHKILVNESGSHSLMITNVTRLDAGAVQCLARNKAGEVAIE-AQLNVLEKEQVVA---------------------------------------PQFVQRFSTMTVREGEPITMSANAIGTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYV 575          
BLAST of Titin vs. Ensembl Fly
Match: sls (gene:FBgn0086906 transcript:FBtr0332683)

HSP 1 Score: 200.29 bits (508), Expect = 2.084e-52
Identity = 130/404 (32.18%), Postives = 215/404 (53.22%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDA-----PIR--PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTE--------DVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE-NDFRPELK 1972
            ++E+  PP F        V +E +      +V P  DP+L V+WY++G PL +G R+   F+ GF  LDILY + EDSGEY C A NN+G D+T  +T++     +++L + +P+ M  S A  +      K T ++H+       P R  PP+FV  +     L        E ++ P+ D ++ +EWF NG+PL +  RF  ++D G+  ++   V  ED+G+Y C A N  G+ ++  + + V+ +  +V  SQLP     ++QS+D I+  E        +VD        + +  + P F  K    TVEEG+PARF V+V+G+PRP++ W +N   V+  S  K+ +DG + +L+  + +      + V A+N +GE++A   L V+   +D+R  LK
Sbjct: 3804 VEEVFGPPKFTTQITSVTV-DEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRTR-ATVSCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQIKEQLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVAMNFGWVYPEDSGEYVCRATNLYGKDETRAI-IKVSGKPGIVYDSQLP----AHMQSIDRIREMEASWQVVPDEVD-------PDAKPRTKPVFVSKLEPQTVEEGDPARFCVRVTGHPRPRVMWLINGHTVVHGSRYKLTNDG-MFHLDVPKTRQYDTGKVEVIARNSVGESIATTELKVVARSDDYRNVLK 4192          

HSP 2 Score: 184.496 bits (467), Expect = 2.254e-47
Identity = 121/383 (31.59%), Postives = 182/383 (47.52%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT---ESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ------ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PP F+          EG  A   AR+ P  DP+L V+WY +G  L  G RF T  + G  ILDILY ++E+SG Y   A+N +G D T  S L      S++L+S LP+ M    E IA +E S+     ++   +   + P F  P+  + NL+ G++ H E R+ P  D  L +EW+ NGRPL  G RF    D GF IL+I  V  ED+G+Y C A N+ G+A +    + +  + +++ +SQLP+      + +  L+ L  ++TE V   +            P F   P ++ + E   A F  ++     P  ++ WF N   +   S  K  +D     LE   C           A NK GEA  +  L V
Sbjct: 3259 VAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRAS-LKCASKSSLILDSQLPRGMEGGLEKIANLEYSM-VRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTAT-MKIQGKRSIIMESQLPKGMEGTIDRIAELEGLGSRSTEFVPDDD--------TGKPPEFITSPFDMVIGENALAHFECRLQPINDPSMRVDWFHNGKALWAGSRIKTINDFGFVILEIAGCYQRDSGLYTCKATNKHGEATVSCKLQV 3630          

HSP 3 Score: 179.489 bits (454), Expect = 9.082e-46
Identity = 120/365 (32.88%), Postives = 191/365 (52.33%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNL--DESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
             EG+ A L  RV P  DPNL ++W+ +G  L  G R+ T+ + G+  LDILY + ED+G Y C A N  G    + +T NV +    S++L++  P  + E I  +E+ +   +T+    DAPI PP F   + G   +  GQ+ H E +V P+ D +L IE++ NG+PL +  RF+I FD G+  LDI   ++ED G+Y   A N  GQA S+   L V    T+++ +Q P+  E ++ L+S      ++ +    R   +    + P  +I  IN    E   A F  ++   G P  +++W+ NE ++  +S I K +  G +S L+    +   E   +  A N LGEAV  A++ V+ E
Sbjct: 2102 KEGEHAHLECRVEPINDPNLKIEWFCNGKQLPTGHRYRTTHDFGYVALDILYVYGEDTGTYICKATNQLG---EAVNTCNVRVLNRRSMILDTQHPDAL-EKIQKLESKVPNARTE--VGDAPISPPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYHNGKPLPSASRFHITFDFGYVSLDITHAVAEDAGEYSVRAVNALGQAVSS-TNLRVIPRGTIISDTQHPEGLEKIRKLESTAPHQRQEPETPGTR---QRPVFTQPLQNIDRIN----EHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVS-LDISHIRKEDEGVYMCRAVNPLGEAVTTASMRVVSE 2451          

HSP 4 Score: 166.007 bits (419), Expect = 2.172e-41
Identity = 123/396 (31.06%), Postives = 183/396 (46.21%), Query Frame = 2
Query:  764 PNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL-DIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +Q     S+   ++  DE          P R     E       AR+IP GDP LTV+W ++G P+ A +R  T  + G+  L++ Y   EDSG Y+C A N  G   TS S L V    S+ L +     M   I  +E      + ++         P FV  + G  NL  GQS H E R+ P  D +L +EWF NG+PL+ G RF   +D GFA LDI+ V +ED+G+Y C   N  G+A +++V         V ++S +  E+ Q+ ++L  IQ+ ED  R   + +EE+ +   P F     N  V EG P      L+ V+  P  +++W+ N   +      K   D     L+            +  AKN +GEAV    ++V
Sbjct: 1666 PRLQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSAS-LIVQSKTSIQLETQHEAAM-HKIHQLEDHSRYQRREEEEYTV-TTAPVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNGKPLSTGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIVL-------NVTSRSSIIHET-QHEEALTKIQHLEDTSRFQRKTDEEQFHAERPQFGRPLRNAKVNEGAPVHLEATLIPVND-PTMKVEWYCNGRPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAIGEAVTTCAVNV 2049          

HSP 5 Score: 160.999 bits (406), Expect = 8.422e-40
Identity = 119/375 (31.73%), Postives = 176/375 (46.93%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVR--LLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINL-TVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P F  H +  +   +G  A     +IP  DP+L V+WY +G  +   +R  T  + G+ +LDI Y    DSGEY C A N +G D T  +TLN      V  +S  P    +S+  I   L  P+ Q     AP+   PP+F+  +  +  L  GQS H E R+ PITD  LV+EW+ NG+ L +G RF    D G  ILDI+    E++G Y   ARNK G+   +V R  L  A++ +++  SQLP+     L+   I N E           EE     P F +   N+  + EG  A F  +++    P+ +++W+ N   +   S  + + D     LE               A N+ GEAV  AT+ +
Sbjct: 3130 PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTR-TTLNCGGRGGVFYDSLQP----DSLQRIR-ELECPQGQQADTSAPLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGE---DVTRASLKCASKSSLILDSQLPRGMEGGLEK--IANLEYSMVRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTATMKI 3493          

HSP 6 Score: 160.614 bits (405), Expect = 8.723e-40
Identity = 116/379 (30.61%), Postives = 189/379 (49.87%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT--ESIAAIEASLN---TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARF---LVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            P F+ H    +   E D       V PA DP ++++W+ +G PL A ++F + ++ G+  LD+  ++ E+SG Y+C A N+ G   TS  TL     +++ L++  PQ     E++   E  L    T KT       P  PP + KP+   ++L   Q +HLE  V P  D +L IEW+ NG+ LN+G RF +  + GF  +D+I V + D G Y C A NKAG+A ++   +  +++E ++  +Q P+ +    Q   IQ+ ED  R +    E+ +    P F  + +N+  + EG  A F   L+ V G     I+WF N + L     ++ +Y+ G+++ LE    KI         A NK G A  +  L  +
Sbjct: 2754 PVFITHLNNIE-CKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCALDLTNSYAENSGVYTCKATNSKGSATTS-GTLKCTGGKTMFLDTQHPQGEAGLEAVQETEEELANRYTSKTTKPETQYP--PPVWTKPLQAEFHLSEAQPIHLEANVEPKEDPNLFIEWYFNGKMLNHGSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAYNKAGEAFTSTT-IFCSSKENIIESTQHPKGAEGLEQ---IQDLEDSLRKDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPV-GDQSMVIEWFYNGKVLEASHRVRTIYAFGTVA-LEVLGTKIEDTGTYTCRATNKHGTAEISCNLECV 3122          

HSP 7 Score: 151.369 bits (381), Expect = 7.825e-37
Identity = 96/305 (31.48%), Postives = 157/305 (51.48%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETV-VTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLN 1780
            EG    L  R+ P GDP++ ++W+ +G P+  G RF  ++E  +  LD+L  +  DSG Y+C A+N  G   TS S   +  ++ ++   +  +   + I  +E S    +++ +     IRP +F+     L N + G   H E ++ P+TD +L +EWFKNGRP+  G RF  + D G+  LDI+ +I+ED+G Y C A N  G  ++ V     + E+ V VT+++   E + YL        ED  R   R E +E  +  P F     N+ ++E   A F   L+ VS  P  +++W+ N
Sbjct: 1304 EGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDLILETQN--ESGLQKIQYLEDSTRHRRSEFVDEVVNIRP-RFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVELQCRSGEQIVTVTQNEAGLEQIHYL--------EDRSRYTRREEIDESTKQAPVFTTSLKNVEIKENQRAHFECRLIPVSD-PSMRVEWYHN 1596          

HSP 8 Score: 150.214 bits (378), Expect = 1.985e-36
Identity = 112/397 (28.21%), Postives = 185/397 (46.60%), Query Frame = 2
Query:  770 MQQSFRSSRSGSVAHLDEITD-PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ----LPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            ++ S R  RS  V   DE+ +  P F+ HP+      EG  A    ++ P  DPNL V+W+K+G P+  G RF    + G+  LDI++   EDSG Y+C A N  G D+T    L     E +V  +     + E I  +E      + ++I  ++  + P F   +  +  ++  Q  H E R+IP++D S+ +EW+ N  PL +G RF    + GF  LDI+  + ED G Y C A N  G+A ++ V  +V T++++  +SQ    LP+          +Q+ ED  +      ++E     P F +   ++ V E     F  ++   G P+  ++W  N   +  ++      D     L  +             A N+LG+AV +A+L V
Sbjct: 1404 LEDSTRHRRSEFV---DEVVNIRPRFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQ-VELQCRSGEQIVTVTQNEAGL-EQIHYLEDRSRYTRREEID-ESTKQAPVFTTSLKNV-EIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGSRFTETNNFGFVALDIMSTLPEDAGTYTCRAYNAVGEAITSAV-AVVHTKKSIYLESQHETALPR----------LQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIV 1782          

HSP 9 Score: 149.443 bits (376), Expect = 2.909e-36
Identity = 85/254 (33.46%), Postives = 140/254 (55.12%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT-ESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE--TVVTKSQLPQ 1570
            DE  +PP F +  +      EG P     RV P GDP + ++W+ +G  +A GSR +   + GF  LD+ Y +  DSGEY+C A N +G   TS + +      ++V  S LP+ MT E +  +E     P+   + ++    PP+F   +  +  +   ++V  E +V P TD SL +EW++NG+PL +G R+  +FD GF  LDI+ V  ED+G+Y C A N  G+ ++   R  V+ ++  T++ ++Q+P+
Sbjct: 3670 DEQPNPPKFTEEIKDNLDVPEGGPIHFDCRVEPVGDPTMRIEWFYNGHVMATGSRVHQLNDFGFIALDVDYIYARDSGEYTCRATNKWGTATTS-AKVTCKGKHNIVYESQLPEGMTSEKLKELERG-RIPEAPKV-VEEVFGPPKFTTQITSV-TVDEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRT---RATVSCKKLPTILLQNQVPR 3916          

HSP 10 Score: 148.288 bits (373), Expect = 7.180e-36
Identity = 115/381 (30.18%), Postives = 180/381 (47.24%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQ-SNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            IT  P F+   +      EG  A   ARV P  D  L ++WY +G  + A +R  T ++ G+  LDI     ED+G Y  VA+N  G  Q   +T+ V    S+  +S + + + E    +E         DI  +     P FV P+     +  G+++HLE R+ P+ D ++ +EWF NGRP+  G RF   +D GF  LDII   + D+G+Y   A N  G A  S  VR++  T+  VVT++Q  Q S++ +Q L     ED  R + + E+    ++ P F     N+   EG       ++   G P  +I+WF+N   V      +   +     L+   C           A+N+LGEAV + ++ +I +ND 
Sbjct: 1020 ITQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQ-ATMIVETRSSIDTSS-MHRGLYEKTQNLENKPFVEPQYDIE-EISKSKPVFVTPLSDPKPIHDGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTD--VVTETQNEQ-SLEQIQLL-----EDSRRRHHQEEDITIMQA-PQFTRGLHNIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDL 1388          

HSP 11 Score: 145.976 bits (367), Expect = 3.606e-35
Identity = 124/400 (31.00%), Postives = 177/400 (44.25%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQV-ANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEAS--LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF-----DIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPEND 1954
            +S +   V    E   PP F K P + Q+   E   A   AR+ P GD  + V+W KDG PL A SR  T    G+  L I      D+G Y+C A N  G D T+ + L V     +V  S  P  + + I  +E S      + ++ +I    + P+F+ P+ G   +  GQ  H E RV P +D  LVIEW+ NGR +    R    +D G+  LDI  V +ED G Y   ARNK G+AQ     +       V T+S +   S+        QN E+      +Y+ EE ++S P F     D KPI+    +G       ++   G P  +++WF N   V   S  + Y D     L+  +          V A N LG A  +A + VI   D
Sbjct:  873 KSQQRRHVQEAAEAIAPPQF-KTPIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQD-TTVAQLTVISKNEIVSESQHPGGL-QKIQHLEDSSRYGRREEEETYI---TQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQATMI-------VETRSSIDTSSMHRGLYEKTQNLENKPFVEPQYDIEEISKSKPVFVTPLSDPKPIH----DGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTD 1255          

HSP 12 Score: 145.206 bits (365), Expect = 7.340e-35
Identity = 111/387 (28.68%), Postives = 189/387 (48.84%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL--PHFDIKPI--NLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            D +  PP F+   +  Q   EG    + AR+ P GDP + V+WY +G PLAA +R  + F+ GF  LD+L     DSGEY C   N  G+ + S + L+V    S+  +S  P  + + I  +E      +T+ I  D  + + PQF++P+  L   + G++VH E +V P+ D S+ +EW+K+G P+    R   +F+ G+  L+I+ + +ED G Y   A N+ G+A S    + V +   V     +P++  +Y++   ++  ED  +S  R   +E  E++  P F   PI   L + E   A F  ++   G    +++W  +   +  +S    Y +     L  ++  I         A N +G+    A L+VI +N+ 
Sbjct:  612 DRVYPPPQFIIPLQNVQ-QTEGGRVHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAE-SRAILSVVQRPSIEQSSQNPNSL-QYINQLEDYSRYQRTESI--DEQLNQAPQFIRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTVRAVNRIGEAISQ-SSIRVHSRSQVTADLGIPEQQ-RYIEK--VEELEDYRKSQQRRHVQEAAEAIAPPQFKT-PIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQDTTVAQLTVISKNEI 988          

HSP 13 Score: 138.272 bits (347), Expect = 9.151e-33
Identity = 105/360 (29.17%), Postives = 164/360 (45.56%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            NE   A   AR+IP GDPNL V+WY++   +   SR     + GF  LDI +  KED G Y C A N  G   T+ S + V  + S+ +++  P  ++  I  +E  L    T+   +      P F + + G   L  G   H E RV+P+ D SL  EWF NG  L  G R     D GF  LDI  V+ ED G Y C A N AG+A S+   + V T+  +  +  +P+  E+++ L+   +    ++   +   +       L  +D       + EG       +V     P  +I+WF N   L   + I+  +  G ++ L     +    +     A N++GEAV+ ++L +
Sbjct: 2369 NEHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEAVTTAS-MRVVSEASIQMDTQHPDSIS-RIHQLEKPLAPRPTEPERL---FEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAGEAVSSTA-MKVKTKSNIDGQPLIPESWEAIR-LKEAAMNRVPEMFVDSTPQQAPVFTTHLQSYD------KLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVT-LSINGLRADDSAIYTCKATNQVGEAVSTSSLKI 2714          

HSP 14 Score: 130.568 bits (327), Expect = 2.623e-30
Identity = 125/449 (27.84%), Postives = 181/449 (40.31%), Query Frame = 2
Query:  626 SIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDA-PIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDR-------SNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            SIQ DT HP    +     KP                    PR +EP                 + + + P F +         EG  A   ARV+P GDP+L  +W+ +GV L  GSR  T+ + GF  LDI     ED+G Y C A N  G +  S + + V    ++     +P E  E+I   EA++N  +  ++ +D+ P + P F   +     L  GQ V LE +V P  D +L IEWFKNG  L  G R    FD G   L I G+ ++D+  Y C A N+ G+A               V+ S L  E   +LQ+  + + + + R          R E  E     P F     N+  +E +  RF   V  +  P   I+WF N + L      + +Y  G  + L+               A N  G A  + TL  
Sbjct: 2453 SIQMDTQHPDSISRIHQLEKP------------------LAPRPTEP-----------------ERLFEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAG-EAVSSTAMKVKTKSNIDGQPLIP-ESWEAIRLKEAAMN--RVPEMFVDSTPQQAPVFTTHLQSYDKLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVTLSINGLRADDSAIYTCKATNQVGEA---------------VSTSSLKIEDRHWLQAESL-HPDSLPRIGELEAPKEGRPEAPEPTYETPVFITHLNNIECKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCA-LDLTNSYAENSGVYTCKATNSKGSATTSGTLKC 2845          

HSP 15 Score: 129.798 bits (325), Expect = 4.546e-30
Identity = 106/390 (27.18%), Postives = 175/390 (44.87%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFG-------------MDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD----IQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN--LTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P FV+      V  EG+P +++A  I  G P   + W KDGV +++ +      + G   L+I      D+G Y C A+N  G              +Q +     +NL     +    P    E I         P  +    D    PPQF+ P+  +   +GG+ VH+E R+ P+ D ++V+EW+ NGRPL    R   VF  GF  LD++ ++  D+G+Y C   N +G A+S  + L V    ++   SQ P  S+QY+  L+     Q TE +D               P F I+P+      EEG    F  +V+    P  +++W+ +   +  +S I  +++ G +S L     +        V A N++GEA++ +++ V
Sbjct:  471 PQFVQRFSTMTV-REGEPITMSANAI--GTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYVEVPREQPNYEQRRLNLPRPTKVIEPEPIPGPEIIYLRHVERAKPHLRPGEEDRVYPPPQFIIPLQNVQQTEGGR-VHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAESRAI-LSVVQRPSIEQSSQNPN-SLQYINQLEDYSRYQRTESIDEQ---------LNQAPQF-IRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVS-LNILHLRAEDAGTYTVRAVNRIGEAISQSSIRV 843          

HSP 16 Score: 127.102 bits (318), Expect = 3.111e-29
Identity = 100/394 (25.38%), Postives = 166/394 (42.13%), Query Frame = 2
Query:  767 NMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARFLVKVSGYPRPQ--IQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +++ S R  + GS     ++  PP F           EG+ A   A +IP GD ++ ++W+ +G  L A  R  T +  G   L++L T  ED+G Y+C A N  G      + ++ NL+                       ++ P+ Q          P+F   +  L  L+ GQS H E  +IP+ D  L +EW+ NG+ + +  R   V D G+ +LDI  +   D+G+Y C A NK G+  +    L       V   S  P +S+Q ++ L+    +  D S             P F  + +++T + EG  A F  +++    P   ++W+ N   +      + + D  I  L+   C           A+NK GE V  A+L  
Sbjct: 3008 DLEDSLR--KDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPVGDQSMVIEWFYNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHGT-----AEISCNLE----------------------CVDKPRGQK---------PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTRTT-LNCGGRGGVFYDSLQP-DSLQRIRELECPQGQQADTS------APLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRASLKC 3355          

HSP 17 Score: 83.9593 bits (206), Expect = 5.967e-16
Identity = 83/342 (24.27%), Postives = 127/342 (37.13%), Query Frame = 2
Query:  920 GDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            G+PN TV+WY++  P+            G +IL I   F EDS  +SCVA+N  G   T+  + N+ ++E                                    I+PP FV  +     +  GQ    + +V       L + W KNG  +    +F ++ +     L II   +ED+G Y C A N AG+A+ +         + +V     P++                            +E  PH   +  + TVEEG+   F  +V G P P  +W   E  V P+   ++   G    L         E      A+NKLG    +A L V P
Sbjct: 4419 GEPNPTVKWYRESFPIQNSPDLQIHTFSGKSILIIRQVFVEDSAVFSCVAENRGG---TAKCSANLVVEERRRAGK----------------------------GGIQPPSFVTTIQST-TVATGQLARFDAKV--TGTRPLDVYWLKNGMKIQPSIKFKMLEEDSVHTLLIIEPFAEDSGRYECVAVNAAGEARCD--------GDCIVQSPSKPEKPT-----------------------TPGSEKAPHIVEQLKSQTVEEGSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQMSRQGEYYQLVISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRP 4695          

HSP 18 Score: 73.1738 bits (178), Expect = 9.959e-13
Identity = 90/364 (24.73%), Postives = 131/364 (35.99%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNT---PKTQDIHID----APIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG  A  TARV     P LT  W+ +G  L A  ++  S+  G A L +      D G Y+ +A+N  G                 V++S        ++ A+E +  T   PK  D+  +        PP FVK   G   +  G+    + RV   P  +    + W  NGR + +     I+ +  G   L I  V   D G   C ARNKAG+      +L V  +E VV                                        P F  +   +TV EG P        G P+P+I W  +   +  T+ + V  DG  + LE  R       +   +A+N  G     A L V
Sbjct:  268 EGSDAVFTARVGSNPKPRLT--WFHNGQRLVASQKYEISYSSGVATLRVKNATARDGGHYTLLAENLQG----------------CVVSS--------AVLAVEPAAETAYEPKPVDVMAEQLEAGKALPPAFVKAF-GDREITEGRMTRFDCRVTGNPYPE----VFWLINGRQVRDDASHKILVNESGSHSLMITNVTRLDAGAVQCLARNKAGEVAIE-AQLNVLEKEQVVA---------------------------------------PQFVQRFSTMTVREGEPITMSANAIGTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYV 560          

HSP 19 Score: 59.3066 bits (142), Expect = 1.585e-8
Identity = 65/257 (25.29%), Postives = 105/257 (40.86%), Query Frame = 2
Query:  845 VKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISE-DTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ 1606
            +  P R  V  EG+   L+ +++  G+P   V WYKDG P+      N   ++    L ++   K + GEY+  A N  G  +T   T N+ ++E    N+                                PP FV+        Q G+ + L  +V   P+ +    ++W  N  PL    R   V+D     L I     E D+GDY C A N  G+  S+  R++V  +E   TK      +++ +QSL ++
Sbjct: 9234 ILEPLRNMVIREGESVVLSTQIV--GNPPPKVTWYKDGKPVK-----NAKSDKDLHTLTLITPQKSEKGEYTVKAVNPLGSVET---TANLTIEEPAGGNAE-------------------------------PPLFVERFEEQNVPQKGE-IRLPAKVSGNPVPE----VQWLFNNTPLFPSERIQQVYDGENIELIIKDANPETDSGDYKCIASNPIGKT-SHGARVIVEVDEVTFTKKLKKTITIEEVQSLTLE 9443          

HSP 20 Score: 58.9214 bits (141), Expect = 2.677e-8
Identity = 86/398 (21.61%), Postives = 155/398 (38.94%), Query Frame = 2
Query:  797 SGSVAHLDEITD----PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKV--YSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV---IPENDFR 1960
            SGSV   D+  D    PP F++ P   +   E + A + A  I   +P  + QW+    P+ + +      +   + L I     +  G ++C A+N  G   TS +T+N+           +PQE  E   +                     P+FV+ +     +  G+++ L  +V      +  +EW+ N   +       I  D +G   L I  V  E+ G Y C A NK G++               V+K+ +  ++ +Y+   +I      +          + ++       P  +  +EG  A+  VKV G P+P+++W  ++  +  +   ++  + DG+ S L            I   A N LG AV  A  +V   +   D+R
Sbjct: 6824 SGSVVVSDQKPDEQIKPPRFIQ-PLEPKYFGEHEVAIIEA--IVESEPLSSFQWFVHNEPIKSSNEVRIVSQANKSTLLIENFQSKFVGPFTCRAEN-VGGSVTSTATVNL-----------IPQEEAEEFES---------------------PRFVEELVQPVEVMDGEALLLTCQVT--GKPTPKVEWYHNAEKITENKETTISQDLQGVCQLQITEVFPENEGQYECVATNKIGKS---------------VSKTNVKIQAFEYIPDSEITGLTGSEEDLLDRTLSIDEQAPKIIKKLPEKIEPKEGEQAKLEVKVVGKPKPKVKWLRDDEQIFASEEYQIENFEDGT-SVLVINHVYPDDLGTISFEAYNPLGVAVTTALFAVEGIVGSKDYR 7167          
BLAST of Titin vs. Ensembl Fly
Match: sls (gene:FBgn0086906 transcript:FBtr0332679)

HSP 1 Score: 199.519 bits (506), Expect = 3.108e-52
Identity = 130/404 (32.18%), Postives = 215/404 (53.22%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDA-----PIR--PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTE--------DVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE-NDFRPELK 1972
            ++E+  PP F        V +E +      +V P  DP+L V+WY++G PL +G R+   F+ GF  LDILY + EDSGEY C A NN+G D+T  +T++     +++L + +P+ M  S A  +      K T ++H+       P R  PP+FV  +     L        E ++ P+ D ++ +EWF NG+PL +  RF  ++D G+  ++   V  ED+G+Y C A N  G+ ++  + + V+ +  +V  SQLP     ++QS+D I+  E        +VD        + +  + P F  K    TVEEG+PARF V+V+G+PRP++ W +N   V+  S  K+ +DG + +L+  + +      + V A+N +GE++A   L V+   +D+R  LK
Sbjct: 3804 VEEVFGPPKFTTQITSVTV-DEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRTR-ATVSCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQIKEQLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVAMNFGWVYPEDSGEYVCRATNLYGKDETRAI-IKVSGKPGIVYDSQLP----AHMQSIDRIREMEASWQVVPDEVD-------PDAKPRTKPVFVSKLEPQTVEEGDPARFCVRVTGHPRPRVMWLINGHTVVHGSRYKLTNDG-MFHLDVPKTRQYDTGKVEVIARNSVGESIATTELKVVARSDDYRNVLK 4192          

HSP 2 Score: 183.341 bits (464), Expect = 5.510e-47
Identity = 120/383 (31.33%), Postives = 184/383 (48.04%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT---ESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ------ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PP F+          EG  A   AR+ P  DP+L V+WY +G  L  G RF T  + G  ILDILY ++E+SG Y   A+N +G D T  S L      S++L+S LP+ M    E IA +E S+     ++   +   + P F  P+  + NL+ G++ H E R+ P  D  L +EW+ NGRPL  G RF    D GF IL+I  V  ED+G+Y C A N+ G+A +    + +  + +++ +SQLP+      + +  L+ L  ++TE        +  +++    P F   P ++ + E   A F  ++     P  ++ WF N   +   S  K  +D     LE   C           A NK GEA  +  L V
Sbjct: 3259 VAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRAS-LKCASKSSLILDSQLPRGMEGGLEKIANLEYSM-VRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTAT-MKIQGKRSIIMESQLPKGMEGTIDRIAELEGLGSRSTE--------FVPDDDTGKPPEFITSPFDMVIGENALAHFECRLQPINDPSMRVDWFHNGKALWAGSRIKTINDFGFVILEIAGCYQRDSGLYTCKATNKHGEATVSCKLQV 3630          

HSP 3 Score: 179.874 bits (455), Expect = 8.646e-46
Identity = 120/365 (32.88%), Postives = 191/365 (52.33%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNL--DESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
             EG+ A L  RV P  DPNL ++W+ +G  L  G R+ T+ + G+  LDILY + ED+G Y C A N  G    + +T NV +    S++L++  P  + E I  +E+ +   +T+    DAPI PP F   + G   +  GQ+ H E +V P+ D +L IE++ NG+PL +  RF+I FD G+  LDI   ++ED G+Y   A N  GQA S+   L V    T+++ +Q P+  E ++ L+S      ++ +    R   +    + P  +I  IN    E   A F  ++   G P  +++W+ NE ++  +S I K +  G +S L+    +   E   +  A N LGEAV  A++ V+ E
Sbjct: 2102 KEGEHAHLECRVEPINDPNLKIEWFCNGKQLPTGHRYRTTHDFGYVALDILYVYGEDTGTYICKATNQLG---EAVNTCNVRVLNRRSMILDTQHPDAL-EKIQKLESKVPNARTE--VGDAPISPPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYHNGKPLPSASRFHITFDFGYVSLDITHAVAEDAGEYSVRAVNALGQAVSS-TNLRVIPRGTIISDTQHPEGLEKIRKLESTAPHQRQEPETPGTR---QRPVFTQPLQNIDRIN----EHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVS-LDISHIRKEDEGVYMCRAVNPLGEAVTTASMRVVSE 2451          

HSP 4 Score: 165.236 bits (417), Expect = 3.294e-41
Identity = 123/396 (31.06%), Postives = 183/396 (46.21%), Query Frame = 2
Query:  764 PNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL-DIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +Q     S+   ++  DE          P R     E       AR+IP GDP LTV+W ++G P+ A +R  T  + G+  L++ Y   EDSG Y+C A N  G   TS S L V    S+ L +     M   I  +E      + ++         P FV  + G  NL  GQS H E R+ P  D +L +EWF NG+PL+ G RF   +D GFA LDI+ V +ED+G+Y C   N  G+A +++V         V ++S +  E+ Q+ ++L  IQ+ ED  R   + +EE+ +   P F     N  V EG P      L+ V+  P  +++W+ N   +      K   D     L+            +  AKN +GEAV    ++V
Sbjct: 1666 PRLQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSAS-LIVQSKTSIQLETQHEAAM-HKIHQLEDHSRYQRREEEEYTV-TTAPVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNGKPLSTGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIVL-------NVTSRSSIIHET-QHEEALTKIQHLEDTSRFQRKTDEEQFHAERPQFGRPLRNAKVNEGAPVHLEATLIPVND-PTMKVEWYCNGRPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAIGEAVTTCAVNV 2049          

HSP 5 Score: 160.229 bits (404), Expect = 1.532e-39
Identity = 116/379 (30.61%), Postives = 189/379 (49.87%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT--ESIAAIEASLN---TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARF---LVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            P F+ H    +   E D       V PA DP ++++W+ +G PL A ++F + ++ G+  LD+  ++ E+SG Y+C A N+ G   TS  TL     +++ L++  PQ     E++   E  L    T KT       P  PP + KP+   ++L   Q +HLE  V P  D +L IEW+ NG+ LN+G RF +  + GF  +D+I V + D G Y C A NKAG+A ++   +  +++E ++  +Q P+ +    Q   IQ+ ED  R +    E+ +    P F  + +N+  + EG  A F   L+ V G     I+WF N + L     ++ +Y+ G+++ LE    KI         A NK G A  +  L  +
Sbjct: 2754 PVFITHLNNIE-CKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCALDLTNSYAENSGVYTCKATNSKGSATTS-GTLKCTGGKTMFLDTQHPQGEAGLEAVQETEEELANRYTSKTTKPETQYP--PPVWTKPLQAEFHLSEAQPIHLEANVEPKEDPNLFIEWYFNGKMLNHGSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAYNKAGEAFTSTT-IFCSSKENIIESTQHPKGAEGLEQ---IQDLEDSLRKDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPV-GDQSMVIEWFYNGKVLEASHRVRTIYAFGTVA-LEVLGTKIEDTGTYTCRATNKHGTAEISCNLECV 3122          

HSP 6 Score: 159.844 bits (403), Expect = 1.923e-39
Identity = 119/375 (31.73%), Postives = 176/375 (46.93%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVR--LLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINL-TVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P F  H +  +   +G  A     +IP  DP+L V+WY +G  +   +R  T  + G+ +LDI Y    DSGEY C A N +G D T  +TLN      V  +S  P    +S+  I   L  P+ Q     AP+   PP+F+  +  +  L  GQS H E R+ PITD  LV+EW+ NG+ L +G RF    D G  ILDI+    E++G Y   ARNK G+   +V R  L  A++ +++  SQLP+     L+   I N E           EE     P F +   N+  + EG  A F  +++    P+ +++W+ N   +   S  + + D     LE               A N+ GEAV  AT+ +
Sbjct: 3130 PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTR-TTLNCGGRGGVFYDSLQP----DSLQRIR-ELECPQGQQADTSAPLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGE---DVTRASLKCASKSSLILDSQLPRGMEGGLEK--IANLEYSMVRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTATMKI 3493          

HSP 7 Score: 151.369 bits (381), Expect = 8.410e-37
Identity = 96/305 (31.48%), Postives = 157/305 (51.48%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETV-VTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLN 1780
            EG    L  R+ P GDP++ ++W+ +G P+  G RF  ++E  +  LD+L  +  DSG Y+C A+N  G   TS S   +  ++ ++   +  +   + I  +E S    +++ +     IRP +F+     L N + G   H E ++ P+TD +L +EWFKNGRP+  G RF  + D G+  LDI+ +I+ED+G Y C A N  G  ++ V     + E+ V VT+++   E + YL        ED  R   R E +E  +  P F     N+ ++E   A F   L+ VS  P  +++W+ N
Sbjct: 1304 EGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDLILETQN--ESGLQKIQYLEDSTRHRRSEFVDEVVNIRP-RFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVELQCRSGEQIVTVTQNEAGLEQIHYL--------EDRSRYTRREEIDESTKQAPVFTTSLKNVEIKENQRAHFECRLIPVSD-PSMRVEWYHN 1596          

HSP 8 Score: 149.828 bits (377), Expect = 2.720e-36
Identity = 112/397 (28.21%), Postives = 185/397 (46.60%), Query Frame = 2
Query:  770 MQQSFRSSRSGSVAHLDEITD-PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ----LPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            ++ S R  RS  V   DE+ +  P F+ HP+      EG  A    ++ P  DPNL V+W+K+G P+  G RF    + G+  LDI++   EDSG Y+C A N  G D+T    L     E +V  +     + E I  +E      + ++I  ++  + P F   +  +  ++  Q  H E R+IP++D S+ +EW+ N  PL +G RF    + GF  LDI+  + ED G Y C A N  G+A ++ V  +V T++++  +SQ    LP+          +Q+ ED  +      ++E     P F +   ++ V E     F  ++   G P+  ++W  N   +  ++      D     L  +             A N+LG+AV +A+L V
Sbjct: 1404 LEDSTRHRRSEFV---DEVVNIRPRFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQ-VELQCRSGEQIVTVTQNEAGL-EQIHYLEDRSRYTRREEID-ESTKQAPVFTTSLKNV-EIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGSRFTETNNFGFVALDIMSTLPEDAGTYTCRAYNAVGEAITSAV-AVVHTKKSIYLESQHETALPR----------LQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIV 1782          

HSP 9 Score: 149.443 bits (376), Expect = 3.561e-36
Identity = 86/256 (33.59%), Postives = 139/256 (54.30%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT-ESIAAIEASL--NTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE--TVVTKSQLPQ 1570
            DE  +PP F +  +      EG P     RV P GDP + ++W+ +G  +A GSR +   + GF  LD+ Y +  DSGEY+C A N +G   TS + +      ++V  S LP+ MT E +  +E       PK     ++    PP+F   +  +  +   ++V  E +V P TD SL +EW++NG+PL +G R+  +FD GF  LDI+ V  ED+G+Y C A N  G+ ++   R  V+ ++  T++ ++Q+P+
Sbjct: 3670 DEQPNPPKFTEEIKDNLDVPEGGPIHFDCRVEPVGDPTMRIEWFYNGHVMATGSRVHQLNDFGFIALDVDYIYARDSGEYTCRATNKWGTATTS-AKVTCKGKHNIVYESQLPEGMTSEKLKELERGRIPEAPKV----VEEVFGPPKFTTQITSV-TVDEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRT---RATVSCKKLPTILLQNQVPR 3916          

HSP 10 Score: 147.902 bits (372), Expect = 1.130e-35
Identity = 111/363 (30.58%), Postives = 174/363 (47.93%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQ-SNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            EG  A   ARV P  D  L ++WY +G  + A +R  T ++ G+  LDI     ED+G Y  VA+N  G  Q   +T+ V    S+  +S + + + E    +E         DI  +     P FV P+     +  G+++HLE R+ P+ D ++ +EWF NGRP+  G RF   +D GF  LDII   + D+G+Y   A N  G A  S  VR++  T+  VVT++Q  Q S++ +Q L     ED  R + + E+    ++ P F     N+   EG       ++   G P  +I+WF+N   V      +   +     L+   C           A+N+LGEAV + ++ +I +ND 
Sbjct: 1038 EGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQ-ATMIVETRSSIDTSS-MHRGLYEKTQNLENKPFVEPQYDIE-EISKSKPVFVTPLSDPKPIHDGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTD--VVTETQNEQ-SLEQIQLL-----EDSRRRHHQEEDITIMQA-PQFTRGLHNIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDL 1388          

HSP 11 Score: 145.591 bits (366), Expect = 5.246e-35
Identity = 124/400 (31.00%), Postives = 177/400 (44.25%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQV-ANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEAS--LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF-----DIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPEND 1954
            +S +   V    E   PP F K P + Q+   E   A   AR+ P GD  + V+W KDG PL A SR  T    G+  L I      D+G Y+C A N  G D T+ + L V     +V  S  P  + + I  +E S      + ++ +I    + P+F+ P+ G   +  GQ  H E RV P +D  LVIEW+ NGR +    R    +D G+  LDI  V +ED G Y   ARNK G+AQ     +       V T+S +   S+        QN E+      +Y+ EE ++S P F     D KPI+    +G       ++   G P  +++WF N   V   S  + Y D     L+  +          V A N LG A  +A + VI   D
Sbjct:  873 KSQQRRHVQEAAEAIAPPQF-KTPIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQD-TTVAQLTVISKNEIVSESQHPGGL-QKIQHLEDSSRYGRREEEETYI---TQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQATMI-------VETRSSIDTSSMHRGLYEKTQNLENKPFVEPQYDIEEISKSKPVFVTPLSDPKPIH----DGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTD 1255          

HSP 12 Score: 144.821 bits (364), Expect = 9.960e-35
Identity = 111/387 (28.68%), Postives = 189/387 (48.84%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL--PHFDIKPI--NLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            D +  PP F+   +  Q   EG    + AR+ P GDP + V+WY +G PLAA +R  + F+ GF  LD+L     DSGEY C   N  G+ + S + L+V    S+  +S  P  + + I  +E      +T+ I  D  + + PQF++P+  L   + G++VH E +V P+ D S+ +EW+K+G P+    R   +F+ G+  L+I+ + +ED G Y   A N+ G+A S    + V +   V     +P++  +Y++   ++  ED  +S  R   +E  E++  P F   PI   L + E   A F  ++   G    +++W  +   +  +S    Y +     L  ++  I         A N +G+    A L+VI +N+ 
Sbjct:  612 DRVYPPPQFIIPLQNVQ-QTEGGRVHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAE-SRAILSVVQRPSIEQSSQNPNSL-QYINQLEDYSRYQRTESI--DEQLNQAPQFIRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTVRAVNRIGEAISQ-SSIRVHSRSQVTADLGIPEQQ-RYIEK--VEELEDYRKSQQRRHVQEAAEAIAPPQFKT-PIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQDTTVAQLTVISKNEI 988          

HSP 13 Score: 137.887 bits (346), Expect = 1.294e-32
Identity = 105/360 (29.17%), Postives = 164/360 (45.56%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            NE   A   AR+IP GDPNL V+WY++   +   SR     + GF  LDI +  KED G Y C A N  G   T+ S + V  + S+ +++  P  ++  I  +E  L    T+   +      P F + + G   L  G   H E RV+P+ D SL  EWF NG  L  G R     D GF  LDI  V+ ED G Y C A N AG+A S+   + V T+  +  +  +P+  E+++ L+   +    ++   +   +       L  +D       + EG       +V     P  +I+WF N   L   + I+  +  G ++ L     +    +     A N++GEAV+ ++L +
Sbjct: 2369 NEHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEAVTTAS-MRVVSEASIQMDTQHPDSIS-RIHQLEKPLAPRPTEPERL---FEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAGEAVSSTA-MKVKTKSNIDGQPLIPESWEAIR-LKEAAMNRVPEMFVDSTPQQAPVFTTHLQSYD------KLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVT-LSINGLRADDSAIYTCKATNQVGEAVSTSSLKI 2714          

HSP 14 Score: 130.568 bits (327), Expect = 2.811e-30
Identity = 94/296 (31.76%), Postives = 132/296 (44.59%), Query Frame = 2
Query:  626 SIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDA-PIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            SIQ DT HP    +     KP                    PR +EP                 + + + P F +         EG  A   ARV+P GDP+L  +W+ +GV L  GSR  T+ + GF  LDI     ED+G Y C A N  G +  S + + V    ++     +P E  E+I   EA++N  +  ++ +D+ P + P F   +     L  GQ V LE +V P  D +L IEWFKNG  L  G R    FD G   L I G+ ++D+  Y C A N+ G+A S 
Sbjct: 2453 SIQMDTQHPDSISRIHQLEKP------------------LAPRPTEP-----------------ERLFEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAG-EAVSSTAMKVKTKSNIDGQPLIP-ESWEAIRLKEAAMN--RVPEMFVDSTPQQAPVFTTHLQSYDKLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVTLSINGLRADDSAIYTCKATNQVGEAVST 2709          

HSP 15 Score: 128.642 bits (322), Expect = 8.736e-30
Identity = 106/386 (27.46%), Postives = 175/386 (45.34%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFG-------------MDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINL--TVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P FV+      V  EG+P +++A  I  G P   + W KDGV +++ +      + G   L+I      D+G Y C A+N  G              +Q +     +NL     +    P    E I         P  +    D    PPQF+ P+  +   +GG+ VH+E R+ P+ D ++V+EW+ NGRPL    R   VF  GF  LD++ ++  D+G+Y C   N +G A+S  + L V    ++   SQ P  S+QY+  L     ED  R       +E+    P F I+P+      EEG    F  +V+    P  +++W+ +   +  +S I  +++ G +S L     +        V A N++GEA++ +++ V
Sbjct:  471 PQFVQRFSTMTV-REGEPITMSANAI--GTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYVEVPREQPNYEQRRLNLPRPTKVIEPEPIPGPEIIYLRHVERAKPHLRPGEEDRVYPPPQFIIPLQNVQQTEGGR-VHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAESRAI-LSVVQRPSIEQSSQNPN-SLQYINQL-----EDYSRYQRTESIDEQLNQAPQF-IRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVS-LNILHLRAEDAGTYTVRAVNRIGEAISQSSIRV 843          

HSP 16 Score: 125.946 bits (315), Expect = 6.023e-29
Identity = 100/392 (25.51%), Postives = 166/392 (42.35%), Query Frame = 2
Query:  767 NMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARFLVKVSGYPRPQ--IQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATL 1933
            +++ S R  + GS     ++  PP F           EG+ A   A +IP GD ++ ++W+ +G  L A  R  T +  G   L++L T  ED+G Y+C A N  G      + ++ NL+                       ++ P+ Q          P+F   +  L  L+ GQS H E  +IP+ D  L +EW+ NG+ + +  R   V D G+ +LDI  +   D+G+Y C A NK G+  +    L       V   S  P +S+Q ++ L+    +  D S             P F  + +++T + EG  A F  +++    P   ++W+ N   +      + + D  I  L+   C           A+NK GE V  A+L
Sbjct: 3008 DLEDSLR--KDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPVGDQSMVIEWFYNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHGT-----AEISCNLE----------------------CVDKPRGQK---------PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTRTT-LNCGGRGGVFYDSLQP-DSLQRIRELECPQGQQADTS------APLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRASL 3353          

HSP 17 Score: 83.5741 bits (205), Expect = 6.403e-16
Identity = 83/342 (24.27%), Postives = 127/342 (37.13%), Query Frame = 2
Query:  920 GDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            G+PN TV+WY++  P+            G +IL I   F EDS  +SCVA+N  G   T+  + N+ ++E                                    I+PP FV  +     +  GQ    + +V       L + W KNG  +    +F ++ +     L II   +ED+G Y C A N AG+A+ +         + +V     P++                            +E  PH   +  + TVEEG+   F  +V G P P  +W   E  V P+   ++   G    L         E      A+NKLG    +A L V P
Sbjct: 4419 GEPNPTVKWYRESFPIQNSPDLQIHTFSGKSILIIRQVFVEDSAVFSCVAENRGG---TAKCSANLVVEERRRAGK----------------------------GGIQPPSFVTTIQST-TVATGQLARFDAKV--TGTRPLDVYWLKNGMKIQPSIKFKMLEEDSVHTLLIIEPFAEDSGRYECVAVNAAGEARCDG--------DCIVQSPSKPEKPT-----------------------TPGSEKAPHIVEQLKSQTVEEGSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQMSRQGEYYQLVISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRP 4695          

HSP 18 Score: 73.559 bits (179), Expect = 9.008e-13
Identity = 90/364 (24.73%), Postives = 131/364 (35.99%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNT---PKTQDIHID----APIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG  A  TARV     P LT  W+ +G  L A  ++  S+  G A L +      D G Y+ +A+N  G                 V++S        ++ A+E +  T   PK  D+  +        PP FVK   G   +  G+    + RV   P  +    + W  NGR + +     I+ +  G   L I  V   D G   C ARNKAG+      +L V  +E VV                                        P F  +   +TV EG P        G P+P+I W  +   +  T+ + V  DG  + LE  R       +   +A+N  G     A L V
Sbjct:  268 EGSDAVFTARVGSNPKPRLT--WFHNGQRLVASQKYEISYSSGVATLRVKNATARDGGHYTLLAENLQG----------------CVVSS--------AVLAVEPAAETAYEPKPVDVMAEQLEAGKALPPAFVKAF-GDREITEGRMTRFDCRVTGNPYPE----VFWLINGRQVRDDASHKILVNESGSHSLMITNVTRLDAGAVQCLARNKAGEVAIE-AQLNVLEKEQVVA---------------------------------------PQFVQRFSTMTVREGEPITMSANAIGTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYV 560          

HSP 19 Score: 60.077 bits (144), Expect = 1.139e-8
Identity = 65/255 (25.49%), Postives = 104/255 (40.78%), Query Frame = 2
Query:  851 HPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISE-DTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ 1606
             P R  V  EG+   L+ +++  G+P   V WYKDG P+      N   ++    L ++   K + GEY+  A N  G  +T   T N+ ++E    N+                                PP FV+        Q G+ + L  +V   P+ +    ++W  N  PL    R   V+D     L I     E D+GDY C A N  G+  S+  R++V  +E   TK      +++ +QSL ++
Sbjct: 14564 EPLRNMVIREGESVVLSTQIV--GNPPPKVTWYKDGKPVK-----NAKSDKDLHTLTLITPQKSEKGEYTVKAVNPLGSVET---TANLTIEEPAGGNAE-------------------------------PPLFVERFEEQNVPQKGE-IRLPAKVSGNPVPE----VQWLFNNTPLFPSERIQQVYDGENIELIIKDANPETDSGDYKCIASNPIGKT-SHGARVIVEVDEVTFTKKLKKTITIEEVQSLTLE 14771          

HSP 20 Score: 58.9214 bits (141), Expect = 2.277e-8
Identity = 94/404 (23.27%), Postives = 164/404 (40.59%), Query Frame = 2
Query:  797 SGSVAHLDEITD----PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ----NTEDV-DRS-NFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKV--YSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV---IPENDFR 1960
            SGSV   D+  D    PP F++ P   +   E + A + A  I   +P  + QW+    P+ + +      +   + L I     +  G ++C A+N  G   +  ST  VNL         +PQE  E   +                     P+FV+ +     +  G+++ L  +V      +  +EW+ N   +       I  D +G   L I  V  E+ G Y C A NK G++               V+K+ +  ++ +Y+   +I     + ED+ DR+ +   +  +  + LP   I+P     +EG  A+  VKV G P+P+++W  ++  +  +   ++  + DG+ S L            I   A N LG AV  A  +V   +   D+R
Sbjct: 6824 SGSVVVSDQKPDEQIKPPRFIQ-PLEPKYFGEHEVAIIEA--IVESEPLSSFQWFVHNEPIKSSNEVRIVSQANKSTLLIENFQSKFVGPFTCRAENVGG---SVTSTATVNL---------IPQEEAEEFES---------------------PRFVEELVQPVEVMDGEALLLTCQVT--GKPTPKVEWYHNAEKITENKETTISQDLQGVCQLQITEVFPENEGQYECVATNKIGKS---------------VSKTNVKIQAFEYIPDSEITGLTGSEEDLLDRTLSIDEQAPKIIKKLPE-KIEP-----KEGEQAKLEVKVVGKPKPKVKWLRDDEQIFASEEYQIENFEDGT-SVLVINHVYPDDLGTISFEAYNPLGVAVTTALFAVEGIVGSKDYR 7167          
BLAST of Titin vs. Ensembl Fly
Match: sls (gene:FBgn0086906 transcript:FBtr0332681)

HSP 1 Score: 199.519 bits (506), Expect = 3.336e-52
Identity = 150/492 (30.49%), Postives = 246/492 (50.00%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDA-----PIR--PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTE--------DVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE-NDFRPELKRTDPAILLRNENPFRKLS----------TLKKVAVSPELQNAFRKTKPSAVQLSNYE---RGAPRSKEASDAENLYANVQSRLRRSDK 2197
            ++E+  PP F        V +E +      +V P  DP+L V+WY++G PL +G R+   F+ GF  LDILY + EDSGEY C A NN+G D+T  +T++     +++L + +P+ M  S A  +      K T ++H+       P R  PP+FV  +     L        E ++ P+ D ++ +EWF NG+PL +  RF  ++D G+  ++   V  ED+G+Y C A N  G+ ++  + + V+ +  +V  SQLP     ++QS+D I+  E        +VD        + +  + P F  K    TVEEG+PARF V+V+G+PRP++ W +N   V+  S  K+ +DG + +L+  + +      + V A+N +GE++A   L V+   +D+R  LK +   I+      +RK             LK    SP L N  R  + +  + + +     G P      D +  + NVQ  LR S+K
Sbjct: 3804 VEEVFGPPKFTTQITSVTV-DEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRTR-ATVSCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQIKEQLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVAMNFGWVYPEDSGEYVCRATNLYGKDETRAI-IKVSGKPGIVYDSQLP----AHMQSIDRIREMEASWQVVPDEVD-------PDAKPRTKPVFVSKLEPQTVEEGDPARFCVRVTGHPRPRVMWLINGHTVVHGSRYKLTNDG-MFHLDVPKTRQYDTGKVEVIARNSVGESIATTELKVVARSDDYRNVLKNSPRRIV--GSKDYRKPEWVSQMEEMQVALKAAKCSPSLLNEMRDCRAALGETAKFSIQFAGNP----IPDIQWYFNNVQ--LRASEK 4272          

HSP 2 Score: 182.57 bits (462), Expect = 1.111e-46
Identity = 120/383 (31.33%), Postives = 184/383 (48.04%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT---ESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ------ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PP F+          EG  A   AR+ P  DP+L V+WY +G  L  G RF T  + G  ILDILY ++E+SG Y   A+N +G D T  S L      S++L+S LP+ M    E IA +E S+     ++   +   + P F  P+  + NL+ G++ H E R+ P  D  L +EW+ NGRPL  G RF    D GF IL+I  V  ED+G+Y C A N+ G+A +    + +  + +++ +SQLP+      + +  L+ L  ++TE        +  +++    P F   P ++ + E   A F  ++     P  ++ WF N   +   S  K  +D     LE   C           A NK GEA  +  L V
Sbjct: 3259 VAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRAS-LKCASKSSLILDSQLPRGMEGGLEKIANLEYSM-VRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTAT-MKIQGKRSIIMESQLPKGMEGTIDRIAELEGLGSRSTE--------FVPDDDTGKPPEFITSPFDMVIGENALAHFECRLQPINDPSMRVDWFHNGKALWAGSRIKTINDFGFVILEIAGCYQRDSGLYTCKATNKHGEATVSCKLQV 3630          

HSP 3 Score: 179.104 bits (453), Expect = 1.287e-45
Identity = 120/365 (32.88%), Postives = 191/365 (52.33%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNL--DESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
             EG+ A L  RV P  DPNL ++W+ +G  L  G R+ T+ + G+  LDILY + ED+G Y C A N  G    + +T NV +    S++L++  P  + E I  +E+ +   +T+    DAPI PP F   + G   +  GQ+ H E +V P+ D +L IE++ NG+PL +  RF+I FD G+  LDI   ++ED G+Y   A N  GQA S+   L V    T+++ +Q P+  E ++ L+S      ++ +    R   +    + P  +I  IN    E   A F  ++   G P  +++W+ NE ++  +S I K +  G +S L+    +   E   +  A N LGEAV  A++ V+ E
Sbjct: 2102 KEGEHAHLECRVEPINDPNLKIEWFCNGKQLPTGHRYRTTHDFGYVALDILYVYGEDTGTYICKATNQLG---EAVNTCNVRVLNRRSMILDTQHPDAL-EKIQKLESKVPNARTE--VGDAPISPPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYHNGKPLPSASRFHITFDFGYVSLDITHAVAEDAGEYSVRAVNALGQAVSS-TNLRVIPRGTIISDTQHPEGLEKIRKLESTAPHQRQEPETPGTR---QRPVFTQPLQNIDRIN----EHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVS-LDISHIRKEDEGVYMCRAVNPLGEAVTTASMRVVSE 2451          

HSP 4 Score: 164.081 bits (414), Expect = 7.186e-41
Identity = 123/396 (31.06%), Postives = 183/396 (46.21%), Query Frame = 2
Query:  764 PNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL-DIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +Q     S+   ++  DE          P R     E       AR+IP GDP LTV+W ++G P+ A +R  T  + G+  L++ Y   EDSG Y+C A N  G   TS S L V    S+ L +     M   I  +E      + ++         P FV  + G  NL  GQS H E R+ P  D +L +EWF NG+PL+ G RF   +D GFA LDI+ V +ED+G+Y C   N  G+A +++V         V ++S +  E+ Q+ ++L  IQ+ ED  R   + +EE+ +   P F     N  V EG P      L+ V+  P  +++W+ N   +      K   D     L+            +  AKN +GEAV    ++V
Sbjct: 1666 PRLQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSAS-LIVQSKTSIQLETQHEAAM-HKIHQLEDHSRYQRREEEEYTV-TTAPVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNGKPLSTGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIVL-------NVTSRSSIIHET-QHEEALTKIQHLEDTSRFQRKTDEEQFHAERPQFGRPLRNAKVNEGAPVHLEATLIPVND-PTMKVEWYCNGRPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAIGEAVTTCAVNV 2049          

HSP 5 Score: 158.688 bits (400), Expect = 3.606e-39
Identity = 116/379 (30.61%), Postives = 189/379 (49.87%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT--ESIAAIEASLN---TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARF---LVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            P F+ H    +   E D       V PA DP ++++W+ +G PL A ++F + ++ G+  LD+  ++ E+SG Y+C A N+ G   TS  TL     +++ L++  PQ     E++   E  L    T KT       P  PP + KP+   ++L   Q +HLE  V P  D +L IEW+ NG+ LN+G RF +  + GF  +D+I V + D G Y C A NKAG+A ++   +  +++E ++  +Q P+ +    Q   IQ+ ED  R +    E+ +    P F  + +N+  + EG  A F   L+ V G     I+WF N + L     ++ +Y+ G+++ LE    KI         A NK G A  +  L  +
Sbjct: 2754 PVFITHLNNIE-CKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCALDLTNSYAENSGVYTCKATNSKGSATTS-GTLKCTGGKTMFLDTQHPQGEAGLEAVQETEEELANRYTSKTTKPETQYP--PPVWTKPLQAEFHLSEAQPIHLEANVEPKEDPNLFIEWYFNGKMLNHGSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAYNKAGEAFTSTT-IFCSSKENIIESTQHPKGAEGLEQ---IQDLEDSLRKDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPV-GDQSMVIEWFYNGKVLEASHRVRTIYAFGTVA-LEVLGTKIEDTGTYTCRATNKHGTAEISCNLECV 3122          

HSP 6 Score: 158.303 bits (399), Expect = 5.534e-39
Identity = 119/375 (31.73%), Postives = 176/375 (46.93%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVR--LLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINL-TVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P F  H +  +   +G  A     +IP  DP+L V+WY +G  +   +R  T  + G+ +LDI Y    DSGEY C A N +G D T  +TLN      V  +S  P    +S+  I   L  P+ Q     AP+   PP+F+  +  +  L  GQS H E R+ PITD  LV+EW+ NG+ L +G RF    D G  ILDI+    E++G Y   ARNK G+   +V R  L  A++ +++  SQLP+     L+   I N E           EE     P F +   N+  + EG  A F  +++    P+ +++W+ N   +   S  + + D     LE               A N+ GEAV  AT+ +
Sbjct: 3130 PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTR-TTLNCGGRGGVFYDSLQP----DSLQRI-RELECPQGQQADTSAPLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGE---DVTRASLKCASKSSLILDSQLPRGMEGGLEK--IANLEYSMVRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTATMKI 3493          

HSP 7 Score: 150.599 bits (379), Expect = 1.403e-36
Identity = 96/305 (31.48%), Postives = 157/305 (51.48%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETV-VTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLN 1780
            EG    L  R+ P GDP++ ++W+ +G P+  G RF  ++E  +  LD+L  +  DSG Y+C A+N  G   TS S   +  ++ ++   +  +   + I  +E S    +++ +     IRP +F+     L N + G   H E ++ P+TD +L +EWFKNGRP+  G RF  + D G+  LDI+ +I+ED+G Y C A N  G  ++ V     + E+ V VT+++   E + YL        ED  R   R E +E  +  P F     N+ ++E   A F   L+ VS  P  +++W+ N
Sbjct: 1304 EGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDLILETQN--ESGLQKIQYLEDSTRHRRSEFVDEVVNIRP-RFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVELQCRSGEQIVTVTQNEAGLEQIHYL--------EDRSRYTRREEIDESTKQAPVFTTSLKNVEIKENQRAHFECRLIPVSD-PSMRVEWYHN 1596          

HSP 8 Score: 148.673 bits (374), Expect = 5.303e-36
Identity = 86/256 (33.59%), Postives = 139/256 (54.30%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT-ESIAAIEASL--NTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE--TVVTKSQLPQ 1570
            DE  +PP F +  +      EG P     RV P GDP + ++W+ +G  +A GSR +   + GF  LD+ Y +  DSGEY+C A N +G   TS + +      ++V  S LP+ MT E +  +E       PK     ++    PP+F   +  +  +   ++V  E +V P TD SL +EW++NG+PL +G R+  +FD GF  LDI+ V  ED+G+Y C A N  G+ ++   R  V+ ++  T++ ++Q+P+
Sbjct: 3670 DEQPNPPKFTEEIKDNLDVPEGGPIHFDCRVEPVGDPTMRIEWFYNGHVMATGSRVHQLNDFGFIALDVDYIYARDSGEYTCRATNKWGTATTS-AKVTCKGKHNIVYESQLPEGMTSEKLKELERGRIPEAPKV----VEEVFGPPKFTTQITSV-TVDEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRT---RATVSCKKLPTILLQNQVPR 3916          

HSP 9 Score: 148.673 bits (374), Expect = 6.201e-36
Identity = 112/397 (28.21%), Postives = 185/397 (46.60%), Query Frame = 2
Query:  770 MQQSFRSSRSGSVAHLDEITD-PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ----LPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            ++ S R  RS  V   DE+ +  P F+ HP+      EG  A    ++ P  DPNL V+W+K+G P+  G RF    + G+  LDI++   EDSG Y+C A N  G D+T    L     E +V  +     + E I  +E      + ++I  ++  + P F   +  +  ++  Q  H E R+IP++D S+ +EW+ N  PL +G RF    + GF  LDI+  + ED G Y C A N  G+A ++ V  +V T++++  +SQ    LP+          +Q+ ED  +      ++E     P F +   ++ V E     F  ++   G P+  ++W  N   +  ++      D     L  +             A N+LG+AV +A+L V
Sbjct: 1404 LEDSTRHRRSEFV---DEVVNIRPRFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQ-VELQCRSGEQIVTVTQNEAGL-EQIHYLEDRSRYTRREEID-ESTKQAPVFTTSLKNV-EIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGSRFTETNNFGFVALDIMSTLPEDAGTYTCRAYNAVGEAITSAV-AVVHTKKSIYLESQHETALPR----------LQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIV 1782          

HSP 10 Score: 146.747 bits (369), Expect = 2.360e-35
Identity = 111/363 (30.58%), Postives = 174/363 (47.93%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQ-SNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            EG  A   ARV P  D  L ++WY +G  + A +R  T ++ G+  LDI     ED+G Y  VA+N  G  Q   +T+ V    S+  +S + + + E    +E         DI  +     P FV P+     +  G+++HLE R+ P+ D ++ +EWF NGRP+  G RF   +D GF  LDII   + D+G+Y   A N  G A  S  VR++  T+  VVT++Q  Q S++ +Q L     ED  R + + E+    ++ P F     N+   EG       ++   G P  +I+WF+N   V      +   +     L+   C           A+N+LGEAV + ++ +I +ND 
Sbjct: 1038 EGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQ-ATMIVETRSSIDTSS-MHRGLYEKTQNLENKPFVEPQYDIE-EISKSKPVFVTPLSDPKPIHDGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTD--VVTETQNEQ-SLEQIQLL-----EDSRRRHHQEEDITIMQA-PQFTRGLHNIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDL 1388          

HSP 11 Score: 144.436 bits (363), Expect = 1.133e-34
Identity = 124/401 (30.92%), Postives = 177/401 (44.14%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQV-ANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEAS--LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF-----DIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            +S +   V    E   PP F K P + Q+   E   A   AR+ P GD  + V+W KDG PL A SR  T    G+  L I      D+G Y+C A N  G D T+ + L V     +V  S  P  + + I  +E S      + ++ +I    + P+F+ P+ G   +  GQ  H E RV P +D  LVIEW+ NGR +    R    +D G+  LDI  V +ED G Y   ARNK G+AQ     +       V T+S +   S+        QN E+      +Y+ EE ++S P F     D KPI+    +G       ++   G P  +++WF N   V   S  + Y D     L+  +          V A N LG A  +A + VI   D 
Sbjct:  873 KSQQRRHVQEAAEAIAPPQF-KTPIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQD-TTVAQLTVISKNEIVSESQHPGGL-QKIQHLEDSSRYGRREEEETYI---TQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQATMI-------VETRSSIDTSSMHRGLYEKTQNLENKPFVEPQYDIEEISKSKPVFVTPLSDPKPIH----DGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTDV 1256          

HSP 12 Score: 143.665 bits (361), Expect = 2.344e-34
Identity = 111/387 (28.68%), Postives = 189/387 (48.84%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL--PHFDIKPI--NLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            D +  PP F+   +  Q   EG    + AR+ P GDP + V+WY +G PLAA +R  + F+ GF  LD+L     DSGEY C   N  G+ + S + L+V    S+  +S  P  + + I  +E      +T+   ID  + + PQF++P+  L   + G++VH E +V P+ D S+ +EW+K+G P+    R   +F+ G+  L+I+ + +ED G Y   A N+ G+A S    + V +   V     +P++  +Y++   ++  ED  +S  R   +E  E++  P F   PI   L + E   A F  ++   G    +++W  +   +  +S    Y +     L  ++  I         A N +G+    A L+VI +N+ 
Sbjct:  612 DRVYPPPQFIIPLQNVQ-QTEGGRVHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAE-SRAILSVVQRPSIEQSSQNPNSL-QYINQLEDYSRYQRTE--SIDEQLNQAPQFIRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTVRAVNRIGEAISQ-SSIRVHSRSQVTADLGIPEQQ-RYIEK--VEELEDYRKSQQRRHVQEAAEAIAPPQFKT-PIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQDTTVAQLTVISKNEI 988          

HSP 13 Score: 136.732 bits (343), Expect = 2.785e-32
Identity = 105/360 (29.17%), Postives = 164/360 (45.56%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            NE   A   AR+IP GDPNL V+WY++   +   SR     + GF  LDI +  KED G Y C A N  G   T+ S + V  + S+ +++  P  ++  I  +E  L    T+   +      P F + + G   L  G   H E RV+P+ D SL  EWF NG  L  G R     D GF  LDI  V+ ED G Y C A N AG+A S+   + V T+  +  +  +P+  E+++ L+   +    ++   +   +       L  +D       + EG       +V     P  +I+WF N   L   + I+  +  G ++ L     +    +     A N++GEAV+ ++L +
Sbjct: 2369 NEHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEAVTTAS-MRVVSEASIQMDTQHPDSIS-RIHQLEKPLAPRPTEPERL---FEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAGEAVSSTA-MKVKTKSNIDGQPLIPESWEAIR-LKEAAMNRVPEMFVDSTPQQAPVFTTHLQSYD------KLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVT-LSINGLRADDSAIYTCKATNQVGEAVSTSSLKI 2714          

HSP 14 Score: 129.798 bits (325), Expect = 3.859e-30
Identity = 94/296 (31.76%), Postives = 132/296 (44.59%), Query Frame = 2
Query:  626 SIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDA-PIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            SIQ DT HP    +     KP                    PR +EP                 + + + P F +         EG  A   ARV+P GDP+L  +W+ +GV L  GSR  T+ + GF  LDI     ED+G Y C A N  G +  S + + V    ++     +P E  E+I   EA++N  +  ++ +D+ P + P F   +     L  GQ V LE +V P  D +L IEWFKNG  L  G R    FD G   L I G+ ++D+  Y C A N+ G+A S 
Sbjct: 2453 SIQMDTQHPDSISRIHQLEKP------------------LAPRPTEP-----------------ERLFEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAG-EAVSSTAMKVKTKSNIDGQPLIP-ESWEAIRLKEAAMN--RVPEMFVDSTPQQAPVFTTHLQSYDKLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVTLSINGLRADDSAIYTCKATNQVGEAVST 2709          

HSP 15 Score: 127.102 bits (318), Expect = 2.663e-29
Identity = 106/386 (27.46%), Postives = 175/386 (45.34%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFG-------------MDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINL--TVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P FV+      V  EG+P +++A  I  G P   + W KDGV +++ +      + G   L+I      D+G Y C A+N  G              +Q +     +NL     +    P    E I         P  +    D    PPQF+ P+  +   +GG+ VH+E R+ P+ D ++V+EW+ NGRPL    R   VF  GF  LD++ ++  D+G+Y C   N +G A+S  + L V    ++   SQ P  S+QY+  L     ED  R       +E+    P F I+P+      EEG    F  +V+    P  +++W+ +   +  +S I  +++ G +S L     +        V A N++GEA++ +++ V
Sbjct:  471 PQFVQRFSTMTV-REGEPITMSANAI--GTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYVEVPREQPNYEQRRLNLPRPTKVIEPEPIPGPEIIYLRHVERAKPHLRPGEEDRVYPPPQFIIPLQNVQQTEGGR-VHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAESRAI-LSVVQRPSIEQSSQNPN-SLQYINQL-----EDYSRYQRTESIDEQLNQAPQF-IRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVS-LNILHLRAEDAGTYTVRAVNRIGEAISQSSIRV 843          

HSP 16 Score: 124.79 bits (312), Expect = 1.519e-28
Identity = 100/392 (25.51%), Postives = 166/392 (42.35%), Query Frame = 2
Query:  767 NMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARFLVKVSGYPRPQ--IQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATL 1933
            +++ S R  + GS     ++  PP F           EG+ A   A +IP GD ++ ++W+ +G  L A  R  T +  G   L++L T  ED+G Y+C A N  G      + ++ NL+                       ++ P+ Q          P+F   +  L  L+ GQS H E  +IP+ D  L +EW+ NG+ + +  R   V D G+ +LDI  +   D+G+Y C A NK G+  +    L       V   S  P +S+Q ++ L+    +  D S             P F  + +++T + EG  A F  +++    P   ++W+ N   +      + + D  I  L+   C           A+NK GE V  A+L
Sbjct: 3008 DLEDSLR--KDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPVGDQSMVIEWFYNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHGT-----AEISCNLE----------------------CVDKPRGQK---------PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTRTT-LNCGGRGGVFYDSLQP-DSLQRIRELECPQGQQADTS------APLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRASL 3353          

HSP 17 Score: 72.4034 bits (176), Expect = 1.772e-12
Identity = 90/364 (24.73%), Postives = 131/364 (35.99%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNT---PKTQDIHID----APIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG  A  TARV     P LT  W+ +G  L A  ++  S+  G A L +      D G Y+ +A+N  G                 V++S        ++ A+E +  T   PK  D+  +        PP FVK   G   +  G+    + RV   P  +    + W  NGR + +     I+ +  G   L I  V   D G   C ARNKAG+      +L V  +E VV                                        P F  +   +TV EG P        G P+P+I W  +   +  T+ + V  DG  + LE  R       +   +A+N  G     A L V
Sbjct:  268 EGSDAVFTARVGSNPKPRLT--WFHNGQRLVASQKYEISYSSGVATLRVKNATARDGGHYTLLAENLQG----------------CVVSS--------AVLAVEPAAETAYEPKPVDVMAEQLEAGKALPPAFVKAF-GDREITEGRMTRFDCRVTGNPYPE----VFWLINGRQVRDDASHKILVNESGSHSLMITNVTRLDAGAVQCLARNKAGEVAIE-AQLNVLEKEQVVA---------------------------------------PQFVQRFSTMTVREGEPITMSANAIGTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYV 560          

HSP 18 Score: 59.3066 bits (142), Expect = 1.651e-8
Identity = 65/255 (25.49%), Postives = 104/255 (40.78%), Query Frame = 2
Query:  851 HPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISE-DTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ 1606
             P R  V  EG+   L+ +++  G+P   V WYKDG P+      N   ++    L ++   K + GEY+  A N  G  +T   T N+ ++E    N+                                PP FV+        Q G+ + L  +V   P+ +    ++W  N  PL    R   V+D     L I     E D+GDY C A N  G+  S+  R++V  +E   TK      +++ +QSL ++
Sbjct: 14089 EPLRNMVIREGESVVLSTQIV--GNPPPKVTWYKDGKPVK-----NAKSDKDLHTLTLITPQKSEKGEYTVKAVNPLGSVET---TANLTIEEPAGGNAE-------------------------------PPLFVERFEEQNVPQKGE-IRLPAKVSGNPVPE----VQWLFNNTPLFPSERIQQVYDGENIELIIKDANPETDSGDYKCIASNPIGKT-SHGARVIVEVDEVTFTKKLKKTITIEEVQSLTLE 14296          
BLAST of Titin vs. Ensembl Zebrafish
Match: ttn.2 (titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030113-2])

HSP 1 Score: 115.546 bits (288), Expect = 1.489e-25
Identity = 106/400 (26.50%), Postives = 180/400 (45.00%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDES-------VVLNSHLPQEMTESIAAIE-ASLNTPKTQ----DIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFR------YXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P F++  +   V  EG    L  + I  G+P   + W K+   ++     +   E  +G A   I  T   DS  Y+  A N  G D T+   +NV ++ +       +++     +    +   IE   L   + Q    D++     + P F K +  +   + G  VH E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G  Q++   L+V  E+++V  SQLP       +   +Q  ++++R            ++   +S P   + P  + V EG  A++  +V+GYP P++ W+LN  L+  +   +++ DG I YLE   CK      + V A+N  G A     L +  + DFR  L+R
Sbjct:  935 PQFIEKLKNISV-KEGSLVELAVKAI--GNPLPDIVWLKNSDIISPHKYPHIKIEGAKGQAHFQIPQTSGSDSAWYTATAINKAGRD-TTRCRVNVEVEYTEPVPERRLIIPKGTYKAKDVAPPEIEPLHLRYGQEQWEEGDLYDKEKQQKPHFKKKLTSVRMKRFG-PVHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYEVAYSRDSGVITCRATNKFGADQTSAT-LIVKDEKSLVEDSQLP-------EGRKVQRMDEMERIAHEGGPSGVTGDDMSEKSKPEIVLLPEPIRVFEGETAKYRCRVTGYPTPKVNWYLNGLLIRKSKRFRLHYDG-IHYLEITDCKSYDSGDVRVLAENPEGTAEHTVKLEIQQKEDFRTILRR 1320          

HSP 2 Score: 102.064 bits (253), Expect = 1.901e-21
Identity = 105/402 (26.12%), Postives = 161/402 (40.05%), Query Frame = 2
Query:  794 RSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIV-FDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ------------------NTEDVDRSNFRYXXX-XXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            RS    H++ I +PP  ++H +   V   G PA  +  V   G P   V WYK+   L++G +     E     L ++  F ED+ +Y+C AKN++G+  TS ++LNV + E V                      +P T      AP+ PP  + P+    +   GQS   + RV   +   L I W+   + +     F +  FD     L+I  V  ED G+Y C ARN AG    + + L V             +E V+   SL ++                   T ++     R+    E     P F+ K     V  G   RF V VSG+P+P++QWF N   +  +SI     +     L   + K   E     +A N+ G+      L V
Sbjct: 2607 RSIVTLHVN-IPEPPQIIRHMQPLSV-EAGKPARFSVEV--TGIPQPQVSWYKNSQALSSGFKCKFLREGNEHTLLLIEVFPEDAAQYNCEAKNDYGV-ATSSASLNVEVPEVV----------------------SPDT-----GAPLSPPVVLTPIQNT-SANEGQSARFQCRV---SGEDLTITWYCKDKEIKQSDIFRVSQFDENCQ-LEITRVYPEDEGEYTCVARNSAGMVSCSAL-LKVDVTRVREEIEAKIEEEVKEFSSLTVKTEEEEETYSTSLHLPEKSKTLELKPEQKRFSSSLERKREKPVFESKLTPAEVTIGESVRFTVTVSGFPKPKVQWFHNGKAITSSSIYTFVEERDEYSLIITKVKKDYEGEYSCTASNRFGQTTCKTILKV 2970          

HSP 3 Score: 93.5893 bits (231), Expect = 8.295e-19
Identity = 123/471 (26.11%), Postives = 183/471 (38.85%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER--GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVH--------------------LETRVIPITDSSLVIE-------------------------------------------------WFKNGRPLNNGCRFNI-VFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ-ESVQYLQSLDIQN------------TEDVDRSNFRYXXXXXXXSL-----PHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQK--VYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV-IPENDFRPEL 1969
            P FVK P   Q   EG       ++   G P   + W K GVPL  G R+  S  +  G   L+I  TF +D+GEY+  AKN  G  +TS ST   +L E     +++ ++    +  + A +  PK  D+    P+   ++ K +      Q  Q +                     +E R++ IT   LVIE                                                 W+K+G+ + +G R+ + V   G A L +  V+ ED G Y  FA N  G A S+  +L V  E T   +   PQ E+V+ +QS    +               V RS  R  ++ +   L     P F  KP +    EG  ARF +KV G P P   WF +   V+     K  V  DG+ S +           + VV A+N+ G+   + TL+V   EN  RP+ 
Sbjct:  482 PFFVKKP-VVQKLVEGGSVVFVCQI--GGSPKPHIYWKKSGVPLTTGYRYRVSHNKDTGECKLEISMTFADDAGEYTIFAKNQHG--ETSAST---SLLEEEEFEAYMKKQDVTYVTEVTAMVQEPKVADV---PPVVVSEYEKELIQRRMAQQTQMMQTFISETEFQISAIERKIIQEIEIRILKITYQELVIEDGEEMVINVAEHEAVASSFSTPVKSYRILEGMGVTFHCKMGGKPLPKIAWYKDGKRIKHGGRYQMEVLQDGRASLRLPVVLPEDEGIYTAFASNMKGNAVSS-GKLYV--ESTAAAQPYYPQAEAVRRVQSTSPMSARSASYSPGRSPARSVSRSPARRLDDTDESQLERLYKPVFVQKPSSFRCSEGQTARFDLKVVGRPMPDTFWFHSGQQVVNDYTHKIVVKEDGTQSMIVVPAMPQDSGEWTVV-AQNRAGKTTVSMTLTVEAKENLVRPQF 937          

HSP 4 Score: 93.5893 bits (231), Expect = 8.654e-19
Identity = 66/232 (28.45%), Postives = 103/232 (44.40%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P  FV+ P    V   GD A+L  +V  +G P+L V+W+KDG  +A G ++  +F+   A+L IL   + DS EY     N  G +Q S S +NV LD+                                    I PP F K +  + +   G S+ +E +V    PIT     I WFK G+ +  G ++        A+L I  + + D G + C A N AG ++++
Sbjct: 4650 VQEPARFVEKPPCISV-TAGDSATLECKV--SGSPDLKVKWFKDGKEMAGGRKYKITFKENVAVLKILSAERGDSSEYKVEVSNRVGKEQCSCS-INV-LDK------------------------------------IIPPTFTKMLKKV-DGNVGASIQMECKVSGSQPIT-----ISWFKEGKDITTGTKYQTEMQESTALLKITNLETSDAGVFTCHATNAAGHSETS 4834          

HSP 5 Score: 91.2781 bits (225), Expect = 3.574e-18
Identity = 77/267 (28.84%), Postives = 111/267 (41.57%), Query Frame = 2
Query:  728 KKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLP-----QEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            K    APP     +++        G + +  E    P F K     ++   G P     R+ P GDP + V+W  DG PL A +R     E G+  LD    +  DSG  +C A N FG DQTS +TL V  ++S+V +S LP     Q M E          +  T D  +    +P   + P P    +  G++     RV         + W+ NG  +    RF + +D G   L+I    S D+GD    A N  G A+  V
Sbjct: 1047 KAKDVAPPEIEPLHLRYGQEQWEEGDL-YDKEKQQKPHFKKKLTSVRMKRFG-PVHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYEVAYSRDSGVITCRATNKFGADQTS-ATLIVKDEKSLVEDSQLPEGRKVQRMDEMERIAHEGGPSGVTGD-DMSEKSKPEIVLLPEP--IRVFEGETAKYRCRVTGYPTPK--VNWYLNGLLIRKSKRFRLHYD-GIHYLEITDCKSYDSGDVRVLAENPEGTAEHTV 1304          

HSP 6 Score: 85.8853 bits (211), Expect = 1.614e-16
Identity = 74/260 (28.46%), Postives = 106/260 (40.77%), Query Frame = 2
Query:  716 MQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + I+K ++    R+S        + S S  V+ + E   PPSF K P       EG    +  RV  AG   LTV WYKDG  +     ++ +F+   A+L I  +   DSG Y C A N  G                               A+ E S        +HI A   PP F  P+  +  +  G+++ L   V       L I+W K+ R L++     I F  G A L++  V   D+GDY C A N+AG
Sbjct: 6884 LTILKADKADSGRYSCHASNDVGKDSCSTEVS-VKERKIPPSFTKKPSTTIEDIEGKVVKIEGRV--AGSQPLTVNWYKDGREIFTSDFYDVTFKSSLAVLCIKKSQLSDSGTYVCKATNEAGT------------------------------ASFEVS--------VHITAQKVPPSFDLPLKPV-TVNEGETLTLSCHV--RGSPPLKIQWMKDRRELSSSANTKITFVDGTATLEMTRVSKTDSGDYLCKATNEAG 7099          

HSP 7 Score: 80.1073 bits (196), Expect = 1.091e-14
Identity = 101/452 (22.35%), Postives = 166/452 (36.73%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPST-----------------LNVNLDESVVLNSH----LPQEMTES-------------IAAIEASLNTPK---------------------------TQDIHIDAPIRPPQFV-KPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKV-YSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + S  S+ S     + ++  PPSF K      +  EG P     RV  AG   + V W KDG  L + S +  SF+   A+L+I       SGEY+CVA N+ G                         ++V++ ++V L  H    +P ++T S             I+ +E   NTP                            + ++ +     PP F  KP   + +++ G+ V +E RV       L + W+K+GR +     +++ F    A+L I      D+G Y C A N+AG A   V           +T  ++P                                  P FD+    +TV EG        V G P  +IQW  +   +  ++  K+ + DG+ + LE  R         +  A N+ G     + +++
Sbjct: 6710 ENSIGSATSSCHLTVQDVKTPPSFPKKITSI-MQIEGQPVQFECRV--AGSSPMEVSWLKDGEALRSDSEYTMSFDDNSAVLNIAKGEMRHSGEYTCVATNSVGSASCRAKLTLQEPRYPPVFDKKLVPVDVSVGDTVELECHMTGSMPIKVTWSKDHKDIRTGGNYKISCVE---NTPHLTILKADKADSGRYSCHASNDVGKDSCSTEVSVKERKIPPSFTKKPSTTIEDIE-GKVVKIEGRV--AGSQPLTVNWYKDGREIFTSDFYDVTFKSSLAVLCIKKSQLSDSGTYVCKATNEAGTASFEV--------SVHITAQKVP----------------------------------PSFDLPLKPVTVNEGETLTLSCHVRGSPPLKIQWMKDRRELSSSANTKITFVDGTAT-LEMTRVSKTDSGDYLCKATNEAGSEFCKSKVTI 7109          

HSP 8 Score: 78.1814 bits (191), Expect = 3.923e-14
Identity = 58/226 (25.66%), Postives = 90/226 (39.82%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            I +PP F++  E  +V   GD   L  ++   G P + + W+K    + +       F +G A L +    K D GEY+C A+N+ G               S   + HL                    QD+       PP F K +  +  ++ GQ V  E RV     S + + W K+G  L +   + + FD   A+L+I       +G+Y C A N  G A
Sbjct: 6631 ILEPPFFIESLEPMEV-TAGDAVCLKCQI--GGTPEIKISWFKADGKVRSSPTCKMEFFKGIACLKLAKVAKSDIGEYTCKAENSIG---------------SATSSCHLT------------------VQDVKT-----PPSFPKKITSIMQIE-GQPVQFECRV--AGSSPMEVSWLKDGEALRSDSEYTMSFDDNSAVLNIAKGEMRHSGEYTCVATNSVGSA 6812          

HSP 9 Score: 75.0998 bits (183), Expect = 3.430e-13
Identity = 60/234 (25.64%), Postives = 92/234 (39.32%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            + +PP FVK  E   +  +G  + L+  V   G P L V W+ +  PL +  +   +F+   A L+I+   + DSG Y+C   N  G +  S     V + E                                      PP F K +  L  +  G + HLE  +     +   I WFK+  P+++  ++NIV     A L+I    S D GDY C   N  G+  +  V  L
Sbjct: 4369 VQEPPVFVKRLEPKILWKQGMSSRLSCTV--KGSPELHVTWFLNDKPLNSSEKHKITFKTNQATLEIIDLSESDSGNYTCEVMNEAGCESCSS---QVTVKE--------------------------------------PPAFKKELR-LVEVVKGCTAHLECEMTGT--APFEITWFKDKNPVSSDTKYNIVSKETAAYLEIKTFESADVGDYQCCISNDVGKITTKAVAKL 4556          

HSP 10 Score: 74.3294 bits (181), Expect = 6.419e-13
Identity = 63/224 (28.12%), Postives = 90/224 (40.18%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + D PSFVK  E   VA  G+P  L  +V    D  +++ W +DG  L        +FE   A LDI  +  +D+G Y+C A N  G   +S  + +V + E                                      PP FVK +      + G S  L   V       L + WF N +PLN+  +  I F    A L+II +   D+G+Y C   N+AG
Sbjct: 4276 VVDKPSFVKSFESTTVAV-GNPLRLECQV--DEDTGVSIIWMRDGKKLHTTMDCKLAFEEKIACLDIQKSKLKDTGTYTCTAANEAG---SSSCSSSVTVQE--------------------------------------PPVFVKRLEPKILWKQGMSSRLSCTV--KGSPELHVTWFLNDKPLNSSEKHKITFKTNQATLEIIDLSESDSGNYTCEVMNEAG 4453          

HSP 11 Score: 73.9442 bits (180), Expect = 9.238e-13
Identity = 57/237 (24.05%), Postives = 102/237 (43.04%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDES---VVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVV 1516
            + +PP FV   +  ++   G  A+L  +V  AG P ++++WYK+   + +  ++  +F    A L I     EDSG+Y C A ++ G D+ S   + V  D       + + + Q   + +  ++                  PP FV+ M    N+   + V L+  +   +P+T     I W K+   +       I F+   A++ I  V  +  G Y C A+N+AG  +   V
Sbjct: 4932 VKEPPKFVMKLDLTKLVLNGSLATLECKV--AGSPEISIRWYKNETEIGSDDKYQMAFTDSVATLRISSCCIEDSGDYICQASSDAGSDRCS-CLVTVKGDAGKYQCTVGNEVGQTSCDFLVTMK-----------------EPPSFVQKMDNT-NVLLAKDVSLQCVLKGSMPMT-----ISWMKDDHEIKESEHVQISFENQTAVIYISSVQLKHGGKYTCHAQNEAGSQKCTAV 5142          

HSP 12 Score: 72.7886 bits (177), Expect = 1.963e-12
Identity = 54/229 (23.58%), Postives = 98/229 (42.79%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P + V   +   V   G+ A+L   V  +G P L  +W+KDGV L++G ++  +F +  + L +L T + D+GEY+   KN  G D  +   + + + + +V                                   PP F + +    ++  G+S+ L+ +      + L I WF N   + +G  + I F      L +  +   D+G Y C A N AG A+++
Sbjct: 6256 VLEPAAIVDKTDSISV-TAGEAAALECTV--SGTPELKPKWFKDGVELSSGKKYKITFSKMISSLKLLSTERSDTGEYTFSIKNEVGSDSCA---MQLTVLDKIV-----------------------------------PPLFSRKLKDTQSIV-GKSMELDCKA--SGSAPLTISWFHNEVEIMSGPNYEITFTENTCTLKVPTLKLSDSGTYKCKAVNSAGAAETS 6440          

HSP 13 Score: 71.2478 bits (173), Expect = 5.702e-12
Identity = 93/409 (22.74%), Postives = 153/409 (37.41%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQ-SNVVRLLVATEETVVTKSQ--LPQESVQYLQSLD----------IQNTEDVDRSNFRYXXXXXXXSLPHFDIK---------------------PINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PP  ++ PE   V   GDP S   +V  +G P L V+W KDG  +    + + S+    + L +     ED G Y     N+    Q    TLNV           L Q                          I PP F+KP+  +  + G ++V +  ++   +PIT     +EW K+G  L+   +  I+ D     LDI  +   DTG Y C   NKAG  + S  +R+       +V +SQ  +P  +V++  S              +TE +   +     E  +  L  F +                      P    V+ G P +   KV+G    +I W+ N+ ++      ++  D S++ LE               A+N  G    +  L++
Sbjct: 5708 VQEPPQIIEKPEVINV-TAGDPVSFECKV--SGTPELKVKWSKDGKEVIPSRQHSLSYINNVSQLKLQSVQLEDKGTYVFEVSNHISACQCK-VTLNV-----------LEQ--------------------------IIPPSFIKPLMEMEEIIG-KNVQIGCKISGSLPIT-----VEWEKDGTKLSGRTKHKILQDENSMSLDIECLEKADTGTYTCKLANKAGSCECSGTLRVKEPPSFVLVPESQAVIPNTTVRFKGSFKGTPPFTVKWFKDDTELICGPSCFTGLEGLSCFLDLFAVGISHSGTYSCQISNDAEFVQKLPAAKVVKMGEPLQLECKVTGTAPLRISWYKNDAILSDGGNLRMTFDNSVAVLEISTSSFDDNGVYTCEAQNDAGTKSCSTALTI 6069          

HSP 14 Score: 69.3218 bits (168), Expect = 2.304e-11
Identity = 85/423 (20.09%), Postives = 152/423 (35.93%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAI--LDIIGVISEDTGDYFCFARNKAGQAQS-----------------NVVRLLVATEETVVTKSQLPQESVQY-------LQSLDIQNT-------------EDVDRSNFRYXXXXXXXSLPHFDI-----------KPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            + +PP F + PE+  V           ++   G P +   W+KDG  ++   ++  +F    A L+I+ +  +DSG Y C A+N  G +  S   +++ + E                                      PP  VKP+  L  +  G + + E  V     +   + W K+ + + +  + +++  +  +I  LD+    + D G+Y C   N+ G   S                 NVV +L    E        P  S+Q+       L+   IQ T             E +    +  +   E      F             KP  + V  G+P  F  KVSG P  +++W  +   VIP+    +    ++S L+ Q  ++  +   V    N +       TL+V+
Sbjct: 5427 VKEPPKFTRKPEKITVVKPSQLVVFECQI--TGTPEIDTYWFKDGNDISPSDKYKMTFVDSLARLEIISSDIKDSGVYYCEARNEAGSESCS---MDLRVKE--------------------------------------PPVLVKPLSPL-EVVNGSNAYFECLVKGT--APFEVTWQKDSKDIKSSLK-HVILQKNDSIITLDVQKCDALDVGEYQCVVANEVGSCSSQSTLSIKEPPSFVERIENVVTVLGKMVEFKCVVRGSPPLSIQWQKDESWILEDPSIQRTFENNVATLTIPVCESIHSGKYTCQAMNEAGQEKCFSTLVVQEPPQIIEKPEVINVTAGDPVSFECKVSGTPELKVKWSKDGKEVIPSRQHSLSYINNVSQLKLQSVQLEDKGTYVFEVSNHISACQCKVTLNVL 5802          

HSP 15 Score: 68.9366 bits (167), Expect = 2.486e-11
Identity = 66/254 (25.98%), Postives = 105/254 (41.34%), Query Frame = 2
Query:  770 MQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDS-SLVIEWFKNGRPLNNGCRFNIVF--DRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRL 1522
            M+Q +  S +G    L  +T                EG+  +L  ++  +G P   + W+++   +     F  ++E+ +A L I   F EDSG ++C A +  G   TS   L    DE+          M+E I+++      P             P FVK  P +  L  G SV     V  I  S    I W K+G PL  G R+ +    D G   L+I    ++D G+Y  FA+N+ G+  ++   L
Sbjct:  361 MEQRWEGSVAGVKEGLKNVT--------------VTEGESVTLECQI--SGHPTPAIMWFREDYRIENSIDFQITYEKSYARLMIREAFAEDSGRFTCTATSEAGTISTSCYLLVKAKDET----------MSE-ISSVSVDTGAPAA-----------PFFVKK-PVVQKLVEGGSVVF---VCQIGGSPKPHIYWKKSGVPLTTGYRYRVSHNKDTGECKLEISMTFADDAGEYTIFAKNQHGETSASTSLL 572          

HSP 16 Score: 67.781 bits (164), Expect = 5.415e-11
Identity = 68/292 (23.29%), Postives = 117/292 (40.07%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS--------------PSTLNVNLDESVVLNSHLP-------------QEM---------------TESIAAIEASLNTPKTQDIHIDAP----------IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVV 1516
            S S+  LD+I  PP+F K  ++    N G    +  +V  +G   +T+ W+K+G  +  G+++ T  +   A+L I      D+G ++C A N  G  +TS              P + +V    +VVL +                +EM               +  + A++ S +   T  +  DA             PP+FV  +     +  G    LE +V    + S  I W+KN   + +  ++ + F    A L I     ED+GDY C A + AG  + + +
Sbjct: 4738 SCSINVLDKII-PPTFTKMLKKVD-GNVGASIQMECKV--SGSQPITISWFKEGKDITTGTKYQTEMQESTALLKITNLETSDAGVFTCHATNAAGHSETSGTISVKEPPVFSLKPQSQDVIPGTTVVLTAAFTGTAPFMIKWFREDKEMLTGGTCFIKKETNSSSLELHALKPSQSAKYTCQVSNDAGKVSCTAALFVKEPPKFVMKLDLTKLVLNGSLATLECKVAGSPEIS--IRWYKNETEIGSDDKYQMAFTDSVATLRISSCCIEDSGDYICQASSDAGSDRCSCL 5023          

HSP 17 Score: 67.0106 bits (162), Expect = 1.179e-10
Identity = 53/228 (23.25%), Postives = 88/228 (38.60%), Query Frame = 2
Query:  821 EITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVK---PMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            +I++   FV+     +V   G+P  L  +V   G   L + WYK+   L+ G     +F+   A+L+I  +  +D+G Y+C A+N+ G    S + L +                                          PP F K   P+ GL       +  L+        +   I WFK+ + L    ++  V +   A L I+G+ + D G+Y C A N  G
Sbjct: 5974 QISNDAEFVQKLPAAKVVKMGEPLQLECKV--TGTAPLRISWYKNDAILSDGGNLRMTFDNSVAVLEISTSSFDDNGVYTCEAQNDAGTKSCS-TALTIK----------------------------------------EPPSFYKLPTPVEGLKGKDASLNCELK------GSAPFEITWFKDKKQLKESRKYKFVSEGCSATLHILGLEASDAGEYECKATNNVG 6152          

HSP 18 Score: 66.6254 bits (161), Expect = 1.385e-10
Identity = 71/259 (27.41%), Postives = 105/259 (40.54%), Query Frame = 2
Query:  827 TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSR--FNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE---------TVVTKSQLPQ 1570
            T  P+F + P +  VA EG  A+  A+V  +G+P   V W++DG  L A +      SF  G A+L I       SG +S  A N  G                                          T ++ + A   PP F++ +  L   QG Q V L+ RV  I   + V+++++ G  + +   F IV D     L I     ED+G Y   A N +G+A S    LLV  EE         T+++ SQ+ Q
Sbjct:    3 TQAPTFTQ-PLQSVVALEGSAATFEAQV--SGNPVPEVSWFRDGQVLTAAALPGAQISFSDGRAVLMIPAVTAAHSGRFSVRATNGAG--------------------------------------QATSTAELLVTAETAPPNFIQRLQSLTVRQGSQ-VRLDVRVTGI--PAPVVKFYREGAEIQSSADFQIVQDGDLYSLLIAEAFPEDSGTYSVSASNSSGRATST-AELLVQGEEEAVPAKKSKTIISASQISQ 216          

HSP 19 Score: 61.6178 bits (148), Expect = 5.348e-9
Identity = 63/240 (26.25%), Postives = 101/240 (42.08%), Query Frame = 2
Query:  908 VIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHL-ETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD---RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTE 1615
            V  +G P   VQW+ +G  + + S +    ER    L I    K+  GEYSC A N FG  QT+  T+             L  E+++  AA        K  +     P +PP F   +  +  ++G +   L +    P  D    ++WFK    + +    ++V +    GF I+    +   D+G Y C A N  G+A  +   ++   + +V  K QL QE   Y  S+  + TE
Sbjct: 2902 VTVSGFPKPKVQWFHNGKAITSSSIYTFVEERDEYSLIITKVKKDYEGEYSCTASNRFG--QTTCKTI-------------LKVELSQLSAA-------EKWVEKMFKIPGQPPCFTTQIQPVQCVEGSEVKFLYKVTGTPFPD----VQWFKGNSQIKSSQTCSVVCNPDGSGFLIMS--NIQQRDSGLYTCKAVNPFGEASCSAELIVFHKQVSVFHKQQLVQEQKSYKVSMKEEATE 3113          

HSP 20 Score: 60.8474 bits (146), Expect = 8.586e-9
Identity = 78/369 (21.14%), Postives = 144/369 (39.02%), Query Frame = 2
Query:  917 AGDPNLTVQWYKDGVPLAAGSRFNTS-FERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQ-------EMTESIAAIEASLNTPKTQDIHID-APIR--------------PPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVF-DRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPG--ESFIVVSAKNKLGEAVANATLSV 1939
             G P   + WYKDG  +  G R+     + G A L +     ED G Y+  A N   M   + S+  + ++ +     + PQ       + T  ++A  AS +  ++    +  +P R               P FV+  P  +    GQ+   + +V+  P+ D+     WF +G+ + N     IV  + G   + ++  + +D+G++   A+N+AG+   ++                          +L ++  E++ R              P F  K  N++V+EG+     VK  G P P I W  N  ++ P     +  +G+     FQ  +  G   ++   +A NK G       ++V
Sbjct:  706 GGKPLPKIAWYKDGKRIKHGGRYQMEVLQDGRASLRLPVVLPEDEGIYTAFASN---MKGNAVSSGKLYVESTAAAQPYYPQAEAVRRVQSTSPMSARSASYSPGRSPARSVSRSPARRLDDTDESQLERLYKPVFVQK-PSSFRCSEGQTARFDLKVVGRPMPDTF----WFHSGQQVVNDYTHKIVVKEDGTQSMIVVPAMPQDSGEWTVVAQNRAGKTTVSM--------------------------TLTVEAKENLVR--------------PQFIEKLKNISVKEGSLVELAVKAIGNPLPDIVWLKNSDIISPHKYPHIKIEGAKGQAHFQIPQTSGSDSAWYTATAINKAGRDTTRCRVNV 1026          

HSP 21 Score: 59.6918 bits (143), Expect = 1.949e-8
Identity = 59/244 (24.18%), Postives = 101/244 (41.39%), Query Frame = 2
Query: 1271 GLYNLQ--GGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVY-----SDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTD 1981
            GL N+    G+SV LE ++      +  I WF+    + N   F I +++ +A L I    +ED+G + C A ++AG   ++   L+ A +ET+   S++   SV                            + P F  KP+   + EG    F+ ++ G P+P I W  +    +P +    Y      D     LE             + AKN+ GE   +A+ S++ E +F   +K+ D
Sbjct:  375 GLKNVTVTEGESVTLECQISG--HPTPAIMWFREDYRIENSIDFQITYEKSYARLMIREAFAEDSGRFTCTATSEAGTISTSCYLLVKAKDETM---SEISSVSVD-----------------------TGAPAAPFFVKKPVVQKLVEGGSVVFVCQIGGSPKPHIYWKKSG---VPLTTGYRYRVSHNKDTGECKLEISMTFADDAGEYTIFAKNQHGE--TSASTSLLEEEEFEAYMKKQD 585          

HSP 22 Score: 51.9878 bits (123), Expect = 3.674e-6
Identity = 52/226 (23.01%), Postives = 87/226 (38.50%), Query Frame = 2
Query:  821 EITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVP-LAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            ++ +PP+FVK       A  G+   L   V   G   +TV W +D    L  G     +FE     L +       +G+Y+C  KN+ G+                        E T ++  +E +    KT  I + A                   G++  LE  V    +  L  +WFK+G  L++G ++ I F +  + L ++     DTG+Y    +N+ G
Sbjct: 6161 KLREPPAFVKKLSN-TTAISGEEVVLLTTV--KGSQPMTVSWVQDKDHILRDGENRKITFENNEVTLKVFKADSTTAGKYTCQLKNDAGV-----------------------AECTANLTVLEPAAIVDKTDSISVTA-------------------GEAAALECTVSGTPE--LKPKWFKDGVELSSGKKYKITFSKMISSLKLLSTERSDTGEYTFSIKNEVG 6339          

HSP 23 Score: 51.9878 bits (123), Expect = 3.706e-6
Identity = 56/238 (23.53%), Postives = 91/238 (38.24%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLT-ARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            RSS    V  LD+I  P SF +  +      E    S T    + +G   + V W+K+   + A  +    F    A L+I      DSG Y+C+AKN  G DQ S  TL V    S++                      P++QD+              +PG           ++  V+      L I WFK+ + +++G   ++  +   + +++      D+G Y C   N  G
Sbjct: 5229 RSSCEAVVTVLDQIIKP-SFTRKLKE----TESIKGSFTQLECLVSGSLPINVTWFKENKEIEADEKHKCIFFENAASLEISRLDSSDSGNYTCIAKNQAGSDQCS-GTLKVKEPPSII--------------------EKPESQDV--------------IPG---------SKVQFNVLLSGTPPLTINWFKDKKEVSSGIDCSVQKNDTSSSIELFFAKPSDSGQYVCEVSNDVG 5417          
BLAST of Titin vs. Ensembl Zebrafish
Match: ttn.2 (titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030113-2])

HSP 1 Score: 115.161 bits (287), Expect = 1.744e-25
Identity = 106/400 (26.50%), Postives = 180/400 (45.00%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDES-------VVLNSHLPQEMTESIAAIE-ASLNTPKTQ----DIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFR------YXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P F++  +   V  EG    L  + I  G+P   + W K+   ++     +   E  +G A   I  T   DS  Y+  A N  G D T+   +NV ++ +       +++     +    +   IE   L   + Q    D++     + P F K +  +   + G  VH E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G  Q++   L+V  E+++V  SQLP       +   +Q  ++++R            ++   +S P   + P  + V EG  A++  +V+GYP P++ W+LN  L+  +   +++ DG I YLE   CK      + V A+N  G A     L +  + DFR  L+R
Sbjct:  979 PQFIEKLKNISV-KEGSLVELAVKAI--GNPLPDIVWLKNSDIISPHKYPHIKIEGAKGQAHFQIPQTSGSDSAWYTATAINKAGRD-TTRCRVNVEVEYTEPVPERRLIIPKGTYKAKDVAPPEIEPLHLRYGQEQWEEGDLYDKEKQQKPHFKKKLTSVRMKRFG-PVHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYEVAYSRDSGVITCRATNKFGADQTSAT-LIVKDEKSLVEDSQLP-------EGRKVQRMDEMERIAHEGGPSGVTGDDMSEKSKPEIVLLPEPIRVFEGETAKYRCRVTGYPTPKVNWYLNGLLIRKSKRFRLHYDG-IHYLEITDCKSYDSGDVRVLAENPEGTAEHTVKLEIQQKEDFRTILRR 1364          

HSP 2 Score: 92.8189 bits (229), Expect = 1.446e-18
Identity = 123/471 (26.11%), Postives = 183/471 (38.85%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER--GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVH--------------------LETRVIPITDSSLVIE-------------------------------------------------WFKNGRPLNNGCRFNI-VFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ-ESVQYLQSLDIQN------------TEDVDRSNFRYXXXXXXXSL-----PHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQK--VYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV-IPENDFRPEL 1969
            P FVK P   Q   EG       ++   G P   + W K GVPL  G R+  S  +  G   L+I  TF +D+GEY+  AKN  G  +TS ST   +L E     +++ ++    +  + A +  PK  D+    P+   ++ K +      Q  Q +                     +E R++ IT   LVIE                                                 W+K+G+ + +G R+ + V   G A L +  V+ ED G Y  FA N  G A S+  +L V  E T   +   PQ E+V+ +QS    +               V RS  R  ++ +   L     P F  KP +    EG  ARF +KV G P P   WF +   V+     K  V  DG+ S +           + VV A+N+ G+   + TL+V   EN  RP+ 
Sbjct:  526 PFFVKKP-VVQKLVEGGSVVFVCQI--GGSPKPHIYWKKSGVPLTTGYRYRVSHNKDTGECKLEISMTFADDAGEYTIFAKNQHG--ETSAST---SLLEEEEFEAYMKKQDVTYVTEVTAMVQEPKVADV---PPVVVSEYEKELIQRRMAQQTQMMQTFISETEFQISAIERKIIQEIEIRILKITYQELVIEDGEEMVINVAEHEAVASSFSTPVKSYRILEGMGVTFHCKMGGKPLPKIAWYKDGKRIKHGGRYQMEVLQDGRASLRLPVVLPEDEGIYTAFASNMKGNAVSS-GKLYV--ESTAAAQPYYPQAEAVRRVQSTSPMSARSASYSPGRSPARSVSRSPARRLDDTDESQLERLYKPVFVQKPSSFRCSEGQTARFDLKVVGRPMPDTFWFHSGQQVVNDYTHKIVVKEDGTQSMIVVPAMPQDSGEWTVV-AQNRAGKTTVSMTLTVEAKENLVRPQF 981          

HSP 3 Score: 91.2781 bits (225), Expect = 3.836e-18
Identity = 77/267 (28.84%), Postives = 111/267 (41.57%), Query Frame = 2
Query:  728 KKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLP-----QEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            K    APP     +++        G + +  E    P F K     ++   G P     R+ P GDP + V+W  DG PL A +R     E G+  LD    +  DSG  +C A N FG DQTS +TL V  ++S+V +S LP     Q M E          +  T D  +    +P   + P P    +  G++     RV         + W+ NG  +    RF + +D G   L+I    S D+GD    A N  G A+  V
Sbjct: 1091 KAKDVAPPEIEPLHLRYGQEQWEEGDL-YDKEKQQKPHFKKKLTSVRMKRFG-PVHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYEVAYSRDSGVITCRATNKFGADQTS-ATLIVKDEKSLVEDSQLPEGRKVQRMDEMERIAHEGGPSGVTGD-DMSEKSKPEIVLLPEP--IRVFEGETAKYRCRVTGYPTPK--VNWYLNGLLIRKSKRFRLHYD-GIHYLEITDCKSYDSGDVRVLAENPEGTAEHTV 1348          

HSP 4 Score: 83.1889 bits (204), Expect = 1.332e-15
Identity = 113/479 (23.59%), Postives = 176/479 (36.74%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQ-KVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPE---LKRT-------------DPAILLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAPRSKEA-SDAENLYANVQSRLRRSDKLSYA 2209
            PPSF K P       EG    +  RV  AG   LTV WYKDG  +     ++ +F+   A+L I  +   DSG Y C A N  G                               A+ E S        +HI A   PP F  P+  +  +  G+++ L   V       L I+W K+ R L++     I F  G A L++  V   D+GDY C A N+AG             +  V  K +    +         Q  +  D   F              ++ P ++ + E   A F+ KV G P P ++W   +   +    +  +   G  + +E +             A NK GE   +  L+V  + +   E   LK+T             D   LLRN +P  + K + +  +     L  A    K      S    G    +E+  D   L A++Q R+ +++ ++ A
Sbjct: 5120 PPSFTKKPSTTIEDIEGKVVKIEGRV--AGSQPLTVNWYKDGREIFTSDFYDVTFKSSLAVLCIKKSQLSDSGTYVCKATNEAGT------------------------------ASFEVS--------VHITAQKVPPSFDLPLKPV-TVNEGETLTLSCHV--RGSPPLKIQWMKDRRELSSSANTKITFVDGTATLEMTRVSKTDSGDYLCKATNEAGSE---------FCKSKVTIKDKPGAPAPAQAAPSPPQEVKKFDNLFF-------------IEV-PKSVHIVEKGTATFIAKVGGDPIPNVKWMKGKWRQMTHGGRISIEQKGQEAKMEIKEVTKSDSGQYRCVASNKHGEIECSTDLNVDEKKETTVEMVKLKKTPSKQKSPKEEKDIDIVELLRNVDPKEYEKYARMYGITDFRGLLQAIEFLKKEKELESGRPEGEIVGRESEEDLAKLVADLQKRMEQTEPVTVA 5532          

HSP 5 Score: 80.8777 bits (198), Expect = 5.818e-15
Identity = 74/261 (28.35%), Postives = 115/261 (44.06%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLD-EITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIV-FDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVV 1549
            + +F + ++ S+  L   I +PP  ++H +   V   G PA  +  V   G P   V WYK+   L++G +     E     L ++  F ED+ +Y+C AKN++G+  TS ++LNV + E V                      +P T      AP+ PP  + P+    +   GQS   + RV   +   L I W+   + +     F +  FD     L+I  V  ED G+Y C ARN AG    +   LL    E+VV
Sbjct: 2642 EYTFIAGKNRSIVTLHVNIPEPPQIIRHMQPLSV-EAGKPARFSVEV--TGIPQPQVSWYKNSQALSSGFKCKFLREGNEHTLLLIEVFPEDAAQYNCEAKNDYGV-ATSSASLNVEVPEVV----------------------SPDT-----GAPLSPPVVLTPIQNT-SANEGQSARFQCRV---SGEDLTITWYCKDKEIKQSDIFRVSQFDENCQ-LEITRVYPEDEGEYTCVARNSAGMVSCSA--LLKVDGESVV 2864          

HSP 6 Score: 72.4034 bits (176), Expect = 2.391e-12
Identity = 67/264 (25.38%), Postives = 114/264 (43.18%), Query Frame = 2
Query:  770 MQQSFRSSRSGSVAHLDEITDPPSFVKHPE---------RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTL-NVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDS-SLVIEWFKNGRPLNNGCRFNIVF--DRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRL 1522
            M+Q +  S +G V  + E    PS VK P          +     EG+  +L  ++  +G P   + W+++   +     F  ++E+ +A L I   F EDSG ++C A +  G   TS   L  V+ +        + ++    + A + +++   +  +   AP  P  F    P +  L  G SV     V  I  S    I W K+G PL  G R+ +    D G   L+I    ++D G+Y  FA+N+ G+  ++   L
Sbjct:  361 MEQRWEGSVAG-VKEVPETAAIPSAVKEPVVPPTLIAGLKNVTVTEGESVTLECQI--SGHPTPAIMWFREDYRIENSIDFQITYEKSYARLMIREAFAEDSGRFTCTATSEAGTISTSCYLLVKVSEEIESREEITVQEKQRTVVEAKDETMSEISSVSVDTGAPAAP--FFVKKPVVQKLVEGGSVVF---VCQIGGSPKPHIYWKKSGVPLTTGYRYRVSHNKDTGECKLEISMTFADDAGEYTIFAKNQHGETSASTSLL 616          

HSP 7 Score: 64.3142 bits (155), Expect = 6.846e-10
Identity = 71/259 (27.41%), Postives = 106/259 (40.93%), Query Frame = 2
Query:  827 TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSR--FNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE---------TVVTKSQLPQ 1570
            T  P+F + P +  VA EG  A+  A+V  +G+P   V W++DG  L A +      SF  G A+L I       SG +S  A N  G   +                                      T ++ + A   PP F++ +  L   QG Q V L+ RV  I   + V+++++ G  + +   F IV D     L I     ED+G Y   A N +G+A S    LLV  EE         T+++ SQ+ Q
Sbjct:    3 TQAPTFTQ-PLQSVVALEGSAATFEAQV--SGNPVPEVSWFRDGQVLTAAALPGAQISFSDGRAVLMIPAVTAAHSGRFSVRATNGAGQATS--------------------------------------TAELLVTAETAPPNFIQRLQSLTVRQGSQ-VRLDVRVTGI--PAPVVKFYREGAEIQSSADFQIVQDGDLYSLLIAEAFPEDSGTYSVSASNSSGRATST-AELLVQGEEEAVPAKKSKTIISASQISQ 216          

HSP 8 Score: 62.7734 bits (151), Expect = 2.161e-9
Identity = 65/287 (22.65%), Postives = 119/287 (41.46%), Query Frame = 2
Query: 1148 HLPQEMTESIAAIEASLNTPKTQDI--HIDAPIRPPQFVKPMPGLYNLQ--GGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVY-----SDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTD 1981
             + Q    S+A ++     P+T  I   +  P+ PP  +    GL N+    G+SV LE ++      +  I WF+    + N   F I +++ +A L I    +ED+G + C A ++AG   ++   L+    +         + +VQ  Q   ++  ++          +    + P F  KP+   + EG    F+ ++ G P+P I W  +    +P +    Y      D     LE             + AKN+ GE   +A+ S++ E +F   +K+ D
Sbjct:  360 QMEQRWEGSVAGVK---EVPETAAIPSAVKEPVVPPTLIA---GLKNVTVTEGESVTLECQIS--GHPTPAIMWFREDYRIENSIDFQITYEKSYARLMIREAFAEDSGRFTCTATSEAGTISTSCYLLV----KVSEEIESREEITVQEKQRTVVEAKDETMSEISSVSVDTGAPAAPFFVKKPVVQKLVEGGSVVFVCQIGGSPKPHIYWKKSG---VPLTTGYRYRVSHNKDTGECKLEISMTFADDAGEYTIFAKNQHGE--TSASTSLLEEEEFEAYMKKQD 629          

HSP 9 Score: 62.003 bits (149), Expect = 4.004e-9
Identity = 78/369 (21.14%), Postives = 144/369 (39.02%), Query Frame = 2
Query:  917 AGDPNLTVQWYKDGVPLAAGSRFNTS-FERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQ-------EMTESIAAIEASLNTPKTQDIHID-APIR--------------PPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVF-DRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPG--ESFIVVSAKNKLGEAVANATLSV 1939
             G P   + WYKDG  +  G R+     + G A L +     ED G Y+  A N   M   + S+  + ++ +     + PQ       + T  ++A  AS +  ++    +  +P R               P FV+  P  +    GQ+   + +V+  P+ D+     WF +G+ + N     IV  + G   + ++  + +D+G++   A+N+AG+   ++                          +L ++  E++ R              P F  K  N++V+EG+     VK  G P P I W  N  ++ P     +  +G+     FQ  +  G   ++   +A NK G       ++V
Sbjct:  750 GGKPLPKIAWYKDGKRIKHGGRYQMEVLQDGRASLRLPVVLPEDEGIYTAFASN---MKGNAVSSGKLYVESTAAAQPYYPQAEAVRRVQSTSPMSARSASYSPGRSPARSVSRSPARRLDDTDESQLERLYKPVFVQ-KPSSFRCSEGQTARFDLKVVGRPMPDTF----WFHSGQQVVNDYTHKIVVKEDGTQSMIVVPAMPQDSGEWTVVAQNRAGKTTVSM--------------------------TLTVEAKENLVR--------------PQFIEKLKNISVKEGSLVELAVKAIGNPLPDIVWLKNSDIISPHKYPHIKIEGAKGQAHFQIPQTSGSDSAWYTATAINKAGRDTTRCRVNV 1070          

HSP 10 Score: 56.9954 bits (136), Expect = 1.278e-7
Identity = 76/301 (25.25%), Postives = 124/301 (41.20%), Query Frame = 2
Query:  812 HLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHL-----ETRVIPITDSSLV-IEWFKN-GRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVV---------TKSQLPQES-----VQYLQSLDIQNTEDVDR----SNFR 1639
            H+     PPSF   P +    NEG+  +L+  V   G P L +QW KD   L++ +    +F  G A L++    K DSG+Y C A N  G                         E  +S   I+   + P        AP  P + VK    L+ ++  +SVH+      T +  +    +  ++W K   R + +G R +I      A ++I  V   D+G Y C A NK G+ + +    +   +ET V         +K + P+E      V+ L+++D +  E   R    ++FR
Sbjct: 5210 HITAQKVPPSF-DLPLKPVTVNEGETLTLSCHV--RGSPPLKIQWMKDRRELSSSANTKITFVDGTATLEMTRVSKTDSGDYLCKATNEAG------------------------SEFCKSKVTIK---DKPGAPAPAQAAPSPPQE-VKKFDNLFFIEVPKSVHIVEKGTATFIAKVGGDPIPNVKWMKGKWRQMTHGGRISIEQKGQEAKMEIKEVTKSDSGQYRCVASNKHGEIECSTDLNVDEKKETTVEMVKLKKTPSKQKSPKEEKDIDIVELLRNVDPKEYEKYARMYGITDFR 5479          
BLAST of Titin vs. Ensembl Zebrafish
Match: ttn.1 (titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030616-413])

HSP 1 Score: 105.916 bits (263), Expect = 1.218e-22
Identity = 107/397 (26.95%), Postives = 178/397 (44.84%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLD-------ESVVLNSHLPQEMTESIAAIEAS---LNTPKTQ----DIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P FV+      V  EG    L  + I  G+P   + W K+   ++     +   E  +G A   I  +   DS  Y+  A N  G D T+   +NV +D       + +V+     +   + IAA E     L   + Q    D++     + P F K +  +  L+     H E R+ PI D ++++EW  +G+PL    R  +V + G+  LD     S D+G   C A NK G  Q++   L+V  E+++V ++QLP+   +  Q +D I+        +    ++   ++ P   + P  + V EG  A+F  +V+GYP P++ W+LN  L+  +   ++  DG I YLE    K      + VSA+N  G         +  + DFR  L+R
Sbjct:  981 PQFVEKLRNISV-KEGTLVELAVKAI--GNPLPDIVWLKNSDIISPHKHPHIRIEGGKGEANFKIPSSAGSDSAWYTATAINKAGRD-TTRCRVNVEVDAVKPQPEKKLVIPKGTYK--AKEIAAPELEPLHLRYGQEQWEDGDLYDKEKQQKPHFKKKLTSV-RLKRFGPAHFECRLTPIGDPTMIVEWLHDGKPLAAANRLRMVNEFGYCSLDYEAAYSRDSGVITCRATNKFGVDQTSAT-LIVKDEKSLVEETQLPEG--RRGQRIDEIERIAHEGGPSGVTGDDNLEKTKPEIVLLPEPVRVMEGETAKFRCRVTGYPTPKVNWYLNGLLIRKSKRFRLQFDG-IHYLEIVDTKSYDSGDVKVSAENPEGVTEHVVKFEIQQKEDFRSILRR 1366          

HSP 2 Score: 86.6557 bits (213), Expect = 1.123e-16
Identity = 93/407 (22.85%), Postives = 168/407 (41.28%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLD-EITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL----------VATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPI------NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +F + ++ S   L  +I + P  ++H +   V   G PA  +  V   G P   V WYK+   L++G +     E     L ++  F ED+ +Y+C AKN++G+  TS ++LNV + E V           E++A + A +     QD  ++                    G+S   + RV   +   L I W++  + +     F +        LDI      D G+Y C ARN  G    + V  +          V+T   +VT   + +     ++S +  +T  +  ++ +  E ++  S   +   P+      ++ V  G+ A+F    SG P  +I W  N   +  T  +Q  +  G IS +      +  +     + KN+ GE+  +A L+V
Sbjct: 2645 EYTFIAGKNRSTVSLHVQIPEAPQIIRHMQPLSV-EAGKPARFSVEV--TGIPQPQVSWYKNSQALSSGFKCKFQREGNEHTLLLIEVFPEDAAQYNCEAKNDYGV-ATSSASLNVEVSEVV---------SPETVAPVSAPVIITSLQDTSVEE-------------------GESARFQCRV---SGDDLKITWYRRDKEIVMSDNFQMTQFGDTCQLDISRAYVADAGEYTCVARNSGGMVSCSAVLTVNDHSVSTVASVSTHSEMVTSQTMTETRSSTMESFESVSTVMMSSTSVKSIEVQQVTSEEEYSTSPVLTLKMSDVIVSLGDVAQFNCSFSGQPFTEIVWDHNGRTITNTERVQYAHEAGLISLI-ILNVHLGDQGSYCCTVKNRNGESRTSAQLTV 3015          

HSP 3 Score: 82.4185 bits (202), Expect = 2.181e-15
Identity = 79/342 (23.10%), Postives = 128/342 (37.43%), Query Frame = 2
Query:  917 AGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            +GD   ++ W KDG  L+ G ++    E G A L+I      DSG Y+C A+N+ G   T+  TL +    +         E+TE I   E   NT +    + +        +K       +  GQ+V L   +   +D    ++W  NG  L+N   +          L I  +   D G   C AR + G                                         V +  F       +   P F ++P +  V EG    F  +++G P P+++W  +  ++  TS  K+    ++  LE     I       V AKNK G+  A A+L+V+
Sbjct: 28675 SGDLKPSISWMKDGKNLSQGGKYEIFEEHGSAHLEIYDADLSDSGVYTCTAQNSVGSVSTN-CTLTIQA-RTTAAALEGKSELTEEIVKKE---NTYEEVQSYTE--------IKASKTQMTISQGQTVTLRASIPEASD----VKWILNGAELSNSESYRYGVSGSDHTLTIKSISHHDQGILTCEARTEQG-----------------------------------------VVKCQFDMTVSATHSGSPSFLVQPHSQNVNEGQNVTFTCEITGEPSPEVEWLKDNAVISITSNMKLSRSKNVYTLEIHNATIEDSGKFTVKAKNKFGQCSATASLNVL 28958          

HSP 4 Score: 77.411 bits (189), Expect = 7.143e-14
Identity = 70/268 (26.12%), Postives = 119/268 (44.40%), Query Frame = 2
Query:  761 EPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVV-------LNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIR-----PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVF--DRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRL 1522
            +PN  + F ++   S+    E   PP+ V   +   V  EG+  +L  ++  +G P   + W+++   +     F  ++E+ +A L I   F EDSG ++C A +  G   TS   L V + E +        +  H+     +   AIEA   T  ++   +  P+       P FVK  P +  L  G  V  + +V         I W K+G PL  G R+ + +  D G   L+I    ++D G+Y  FARN  G++ ++ + L
Sbjct:  370 QPNGVKEFETAAIPSITK--EQVMPPTIVAALKNVTV-TEGETVALECQI--SGYPTPAIMWFREDYRIENSIDFQITYEKSYARLMIREAFAEDSGRFTCTATSEAGTISTS-CYLLVKVSEEIESREDFSNVPEHVEMSAQQRQGAIEAKEET-MSEISAVSEPVEAGAGAAPFFVK-KPTVQKLVEGDRVVFDCQVGGTPKPH--IYWKKSGIPLTTGYRYRVAYNKDTGACKLEISMTFADDAGEYTVFARNPLGESSASAILL 627          

HSP 5 Score: 76.2554 bits (186), Expect = 1.454e-13
Identity = 108/481 (22.45%), Postives = 175/481 (36.38%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQF---VKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQ-KVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPE---LKRT-------------DPAILLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERG--APRSKEASDAENLYANVQSRLRRSDKLS 2203
            PP+F K P  +    EG    L +RV  +G   L+V WYKD   +     ++ SF+   A++ +      DSG Y+C A N  G   T+   + VN+ E                                     RPP F   +KPM     +  G+ ++L   V       + I+W K+ R + +     + F  G A L+I      D GDY C A N AG                    +    ++ + L +L                          F  +P ++ + E   A F+ KV G P P ++W   +   +    +  +   G  S LE +             A NK GE   +  L+V  + +  PE   LK+T             D   LLRN +P  + K + +  +         FR     A++    E+G  + R +E  D   L +++Q R+  S+ ++
Sbjct: 5076 PPTFTKKPSEHIEDAEGKLVKLESRV--SGSQPLSVIWYKDNKEINTSDIYDVSFKSNVAVMCLRKATVTDSGVYTCSASNEAG---TASFQVVVNITEQK-----------------------------------RPPTFDIPLKPM----TVSEGERLNLSCHV--CGSPPVKIQWMKDRREVTSSASTKMTFVDGTATLEINQASKTDAGDYLCKATNNAGNK--------AGVAPAAAPAAPTTPQATKKLDNL-------------------------FFIEEPKSIHIVEKGTATFIAKVGGDPIPNVKWMKGKWRQMTHGGRINIQQKGQESKLEIKEVTKSDSGQYRCVASNKHGEIECSTDLNVDEKKESGPEVVKLKKTPSKQKSPKEDKDIDIVELLRNVDPKEYEKYARMYGI-------TDFRGLL-QAIEFLKKEKGEESGRPEEDEDLAKLVSDLQRRMENSEPVT 5469          

HSP 6 Score: 65.4698 bits (158), Expect = 3.019e-10
Identity = 78/252 (30.95%), Postives = 118/252 (46.83%), Query Frame = 2
Query: 1247 PQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNI-VFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ-ESVQYLQSLDIQNTEDV-DRSNFRYXXXXXXXSL-----PHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQK--VYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV-IPENDFRPEL 1969
            P F  P+ G Y L+ G S     R+       +V  W+K+G+ + +G R+ + V   G A L +  V++ED   Y     N  G A S+  +L V  E   V ++QL Q  +VQ ++S   ++T     RS  R  +E +   L     P F  KP ++   EG  ARF +KV G P P+  WF N   V+     K  V  DG+ S +      +    + VV A+N+ G+   + TL+V   EN  RP+ 
Sbjct:  739 PVFNTPVKG-YRLREGMSATFHCRMSGTPLPKIV--WYKDGKRIIHGGRYQMEVLRDGRASLRLPTVLAEDEAVYTALISNIKGNAVSSG-KLYV--ESAGVAQTQLSQPGAVQRIRSTSPRSTSRSPGRSPSRRLDETDEAQLERLYKPVFVQKPSSVKCSEGQTARFDLKVVGRPMPETYWFHNGQQVVNDYTHKIVVKEDGTQSMIVVPAMPLDSGEWTVV-AQNRAGKTTVSMTLTVEAKENLVRPQF 983          

HSP 7 Score: 62.7734 bits (151), Expect = 2.354e-9
Identity = 68/243 (27.98%), Postives = 100/243 (41.15%), Query Frame = 2
Query:  827 TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSR--FNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVV 1549
            T  P+F + P +  VA EG  A+  A+V  +G+P   V W++DG  L A +      SF  G A+L I       SG +S  A N  G   ++                       E +A  E +                PP F++ +  +   QG Q V L+ RV  I   + V+++++ G  + +   F IV D     L I     ED+G Y   A N +G+  SN   LLV  EE  V
Sbjct:    3 TQAPTFTQ-PLQSVVALEGSAATFEAQV--SGNPVPEVSWFRDGQVLTAAALPGAQISFSDGRAVLMIPAVTAAHSGRFSVRATNGAGQATST----------------------AELLATAETA----------------PPNFIQRLQSVTVTQGSQ-VRLDVRVTGI--PTPVVKFYREGAEIQSSADFQIVQDGDLYSLLIAEAFPEDSGTYSVSASNSSGRTTSN-AELLVQGEEVAV 200          

HSP 8 Score: 62.003 bits (149), Expect = 3.217e-9
Identity = 66/272 (24.26%), Postives = 102/272 (37.50%), Query Frame = 2
Query:  809 AHLDEITDPPSFVKHPERYQVANEGDPASLTARV--IPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTF-KEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVI-SEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNT 1612
            A +  +T+P  FVK     ++ +   P S   R+     G P L V WYKDG  L A  R+NT       IL+ L+    E +G YSC   N +G D+                                         D  + A   P +FVK +  + ++   Q + LE          L + W+K+G+ L    R+N        IL+ +    +E TG Y C   N  G  + +    +VA  E      +L   ++   Q L ++ T
Sbjct: 4590 ATVTAVTEPARFVK-----KLTDLSIPMSQKLRLECTFTGAPKLFVTWYKDGKQLYASYRYNTRVTANSCILECLHECNNETTGRYSCEISNIYGTDKC----------------------------------------DAQVVAVTEPARFVKKLTDM-SIPMSQKLRLECTFTGA--PKLFVTWYKDGKQLYASYRYNTKVTSNSCILECLHECNNETTGRYSCEVSNIYGTDKCHA--QVVAVTEPARFVKKLTDVAIPVTQKLRLECT 4811          

HSP 9 Score: 60.4622 bits (145), Expect = 9.981e-9
Identity = 66/257 (25.68%), Postives = 112/257 (43.58%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVV----LNSH----LPQEMTE----------SIAAIEASLNTPKTQDIHI-----DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESV 1579
            EG+ A    RV  +GD +L + WY+    +     F  +       LDI   +  D+GEY+CVA+N+ GM   S + L VN D SV     +++H      Q MTE          S++ +  S  + K+ ++       +    P   +K    + +L      +      P T+    I W  NGR + N  R     + G   L I+ V   D G Y C  +N+ G+++++  +L V  +E    ++ +P +S+
Sbjct: 2786 EGESARFQCRV--SGD-DLKITWYRRDKEIVMSDNFQMTQFGDTCQLDISRAYVADAGEYTCVARNSGGMVSCS-AVLTVN-DHSVSTVASVSTHSEMVTSQTMTETRSSTMESFESVSTVMMSSTSVKSIEVQQVTSEEEYSTSPVLTLKMSDVIVSLGDVAQFNCSFSGQPFTE----IVWDHNGRTITNTERVQYAHEAGLISLIILNVHLGDQGSYCCTVKNRNGESRTS-AQLTVEAKEANPKETPVPSDSI 3032          

HSP 10 Score: 57.7658 bits (138), Expect = 8.178e-8
Identity = 61/244 (25.00%), Postives = 105/244 (43.03%), Query Frame = 2
Query: 1238 IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK---SQLPQE---SVQYLQ-SLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVY-----SDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATL 1933
            + PP  V  +  +  +  G++V LE ++      +++  WF+    + N   F I +++ +A L I    +ED+G + C A ++AG   ++   LLV   E + ++   S +P+    S Q  Q +++ +     + S      E    + P F  KP    + EG+   F  +V G P+P I W  +    IP +    Y      D     LE             V A+N LGE+ A+A L
Sbjct:  390 VMPPTIVAALKNV-TVTEGETVALECQISGYPTPAIM--WFREDYRIENSIDFQITYEKSYARLMIREAFAEDSGRFTCTATSEAGTISTSCY-LLVKVSEEIESREDFSNVPEHVEMSAQQRQGAIEAKEETMSEISAVSEPVEAGAGAAPFFVKKPTVQKLVEGDRVVFDCQVGGTPKPHIYWKKSG---IPLTTGYRYRVAYNKDTGACKLEISMTFADDAGEYTVFARNPLGESSASAIL 626          

HSP 11 Score: 56.6102 bits (135), Expect = 1.764e-7
Identity = 56/233 (24.03%), Postives = 85/233 (36.48%), Query Frame = 2
Query:  809 AHLDEITDPPSFVKHPERYQVANEGDPASLTARV--IPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTF-KEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDT-GDYFCFARNKAG 1495
            A +  +T+P  FVK     ++ +   P S   R+     G P L V WYKDG  L A  R+NT       IL+ L+    E +G YSC   N +G D+     + V                                          P +FVK +  +  +   Q + LE          + + W+K+G+ L    R+N        IL+ +   ++ T G Y C   N  G
Sbjct: 4685 AQVVAVTEPARFVK-----KLTDMSIPMSQKLRLECTFTGAPKLFVTWYKDGKQLYASYRYNTKVTSNSCILECLHECNNETTGRYSCEVSNIYGTDKCHAQVVAVT----------------------------------------EPARFVKKLTDV-AIPVTQKLRLECTFTGA--PKIFVTWYKDGKQLYASYRYNTKVIGDTCILECLHECNDATPGKYSCEVSNSIG 4869          

HSP 12 Score: 55.0694 bits (131), Expect = 5.376e-7
Identity = 75/319 (23.51%), Postives = 120/319 (37.62%), Query Frame = 2
Query:  809 AHLDEITDPPSFVKHPERYQVANEGDPASLTARV--IPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDS-GEYSCVAKNNFGMDQ--------TSPSTLNVNL-DESVVLNSHLPQEMTESIA------------AIEASL--------NTPKTQDIHIDAPIRPPQFVKPMPGLY---------------------------------NLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDT-GDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP 1567
            A +  +T+P  FVK     ++ +   P +   R+     G P + V WYKDG  L A  R+NT       IL+ L+   + + G+YSC   N+ G D         T P+   + L D+ V ++ +L  E T + A             + AS         NT   + +H        +  K  PG Y                                 +LQ GQ + LE     I    + + W+K+G+      R N        +L+ +    E+T G Y C   N+ G   S++   LV    T+ T+ ++P
Sbjct: 4780 AQVVAVTEPARFVK-----KLTDVAIPVTQKLRLECTFTGAPKIFVTWYKDGKQLYASYRYNTKVIGDTCILECLHECNDATPGKYSCEVSNSIGTDICHANITTFTEPARFELKLKDKQVAMSKNLKLECTFTGAPKIFVTWYKDGKQLYASYRYNTTVVGNTCTLECLH--------ECTKETPGKYSCEVSNSYGKDICHAEVTTFSGPARFVKTLTDQSLQQGQKLRLEASFKGI--GKIFVTWYKDGKQAYASYRCNTKVIGNTCVLEYLHECDENTPGKYSCEVMNEDG---SDICHALV----TLGTERKIP 5076          

HSP 13 Score: 54.299 bits (129), Expect = 7.600e-7
Identity = 101/489 (20.65%), Postives = 178/489 (36.40%), Query Frame = 2
Query:  632 QFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVA------------HLDEITDPPSFVKHPERYQVA--------------------NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER-GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQ------------EMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVF-DRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPG-----ESFIVVSAKNKLGEAVANATLSV 1939
             F T  P ++ + K    P  FE   EK Q++ + + A     +  M QSF S +   ++            HL +IT      +  E+  ++                     EG  A+   R+  +G P   + WYKDG  +  G R+     R G A L +     ED   Y+ +  N  G    + S+  + ++ + V  + L Q              T        S    +T +  ++  +  P FV+  P       GQ+   + +V+  P+ ++     WF NG+ + N     IV  + G   + ++  +  D+G++   A+N+AG+   ++                          +L ++  E++ R              P F  K  N++V+EG      VK  G P P I W  N  ++ P     +  +G      F   KIP       ++   +A NK G       ++V
Sbjct:  642 HFKTEVPTIAEEPKVADVPAAFETVTEKDQLLMQRRMA----QQTQMMQSFISEQELQMSSLEQRFIQEVEFHLLKITYQELVTEDGEQLDMSVPEHDAVSPVFNTPVKGYRLREGMSATFHCRM--SGTPLPKIVWYKDGKRIIHGGRYQMEVLRDGRASLRLPTVLAEDEAVYTALISNIKG---NAVSSGKLYVESAGVAQTQLSQPGAVQRIRSTSPRSTSRSPGRSPSRRLDETDEAQLER-LYKPVFVQ-KPSSVKCSEGQTARFDLKVVGRPMPETY----WFHNGQQVVNDYTHKIVVKEDGTQSMIVVPAMPLDSGEWTVVAQNRAGKTTVSM--------------------------TLTVEAKENLVR--------------PQFVEKLRNISVKEGTLVELAVKAIGNPLPDIVWLKNSDIISPHKHPHIRIEGGKGEANF---KIPSSAGSDSAWYTATAINKAGRDTTRCRVNV 1072          

HSP 14 Score: 54.299 bits (129), Expect = 7.862e-7
Identity = 89/377 (23.61%), Postives = 134/377 (35.54%), Query Frame = 2
Query:  917 AGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLP--------------------QEMTESIAAIEASLNTPKTQDIHIDAP-------------IRPPQFVKPMPGLYNLQGG-QSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDI--QNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +G P   + W  +G  +    R   + E G   L IL     D G Y C  KN  G  +TS + L V   E+    + +P                    QE  ES+  + A   T K Q  H   P             I+P   VK  P     Q    S++   +  P    S  I W  N   +     +++  D     L++  V +E  G   C   N AG    +    +    +T  +   +P E   Y  SL +  Q  E    S    E  ++    P F  K  +     G  A+F V VSG+P+P IQW+ N  L+  +S      +     L   +     E     +A N+ G++   + L V
Sbjct: 2950 SGQPFTEIVWDHNGRTITNTERVQYAHEAGLISLIILNVHLGDQGSYCCTVKNRNGESRTS-AQLTVEAKEANPKETPVPSDSISKSAKTESESSKKATDQEKVESLQNVGAL--TTKWQISHHYNPDVTTLLERDKYDAIQPEFLVKLSPEFLAKQREIDSIYYINKGSP----SPFIVWLYNQLNVEEPRSYSLKHDGPLCCLNVKNVNTEQGGSNSCKVINAAGDKTCSTHLKM----KTAFSTLPIPTEEDSYATSLRLKYQTFELQPESQLFSESIKKKPEKPIFITKLSSECAALGETAKFTVIVSGFPKPIIQWYHNGNLINSSSFYTFVQEKEEHSLVITQITKELEGEYSCTASNRFGKSTCTSYLHV 3315          

HSP 15 Score: 51.9878 bits (123), Expect = 3.780e-6
Identity = 67/276 (24.28%), Postives = 116/276 (42.03%), Query Frame = 2
Query:  827 TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRF---NTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESV-VLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVK--PM---PGLYNLQGGQSVHLETRVIPITDSSLV-------------IEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVA--TEETVVTKSQLPQESVQ 1582
            T P + +  P+   V+ EG+    T  V   G+P  +V W ++   + +  R    +T ++  F I  +  +   D G Y+ V +N+ G  Q +  +L +     V  + +  P+  +     I++       Q I    PI+ P  VK  PM   P   +     S   E + I  +  ++V             I W K+G+ L+ G ++ I  + G A L+I      D+G Y C A+N  G   +N    + A  T   +  KS+L +E V+
Sbjct: 28493 TLPATILTKPQSLTVS-EGESVKFTCDV--DGEPAPSVTWMREAQIIVSSQRHLITSTEYKSTFEINKVEMS---DGGNYTVVVENSEG-KQEAQFSLTIRKPTPVQKVVASPPRVKSPESPRIKSPFGIRSPQRIKSPEPIKSPTRVKSPPMVKSPTPKDKTSKPSFSTELKDISASADTIVKLTVKLSGDLKPSISWMKDGKNLSQGGKYEIFEEHGSAHLEIYDADLSDSGVYTCTAQNSVGSVSTNCTLTIQARTTAAALEGKSELTEEIVK 28761          

HSP 16 Score: 51.9878 bits (123), Expect = 4.475e-6
Identity = 59/239 (24.69%), Postives = 94/239 (39.33%), Query Frame = 2
Query:  806 VAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVK----PMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            V ++ E   PP+F   P +    +EG+  +L+  V   G P + +QW KD   + + +    +F  G A L+I    K D+G+Y C A NN G               +      L     +++  IE     PK+  IHI          K    P+P +  ++G                    +W    R + +G R NI      + L+I  V   D+G Y C A NK G+ + +
Sbjct: 5164 VVNITEQKRPPTF-DIPLKPMTVSEGERLNLSCHV--CGSPPVKIQWMKDRREVTSSASTKMTFVDGTATLEINQASKTDAGDYLCKATNNAGNKAGVAPAAAPAAPTTPQATKKL-----DNLFFIEE----PKS--IHIVEKGTATFIAKVGGDPIPNVKWMKG--------------------KW----RQMTHGGRINIQQKGQESKLEIKEVTKSDSGQYRCVASNKHGEIECS 5364          
BLAST of Titin vs. Ensembl Zebrafish
Match: ttn.1 (titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030616-413])

HSP 1 Score: 86.6557 bits (213), Expect = 1.132e-16
Identity = 93/407 (22.85%), Postives = 168/407 (41.28%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLD-EITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL----------VATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPI------NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +F + ++ S   L  +I + P  ++H +   V   G PA  +  V   G P   V WYK+   L++G +     E     L ++  F ED+ +Y+C AKN++G+  TS ++LNV + E V           E++A + A +     QD  ++                    G+S   + RV   +   L I W++  + +     F +        LDI      D G+Y C ARN  G    + V  +          V+T   +VT   + +     ++S +  +T  +  ++ +  E ++  S   +   P+      ++ V  G+ A+F    SG P  +I W  N   +  T  +Q  +  G IS +      +  +     + KN+ GE+  +A L+V
Sbjct:  952 EYTFIAGKNRSTVSLHVQIPEAPQIIRHMQPLSV-EAGKPARFSVEV--TGIPQPQVSWYKNSQALSSGFKCKFQREGNEHTLLLIEVFPEDAAQYNCEAKNDYGV-ATSSASLNVEVSEVV---------SPETVAPVSAPVIITSLQDTSVEE-------------------GESARFQCRV---SGDDLKITWYRRDKEIVMSDNFQMTQFGDTCQLDISRAYVADAGEYTCVARNSGGMVSCSAVLTVNDHSVSTVASVSTHSEMVTSQTMTETRSSTMESFESVSTVMMSSTSVKSIEVQQVTSEEEYSTSPVLTLKMSDVIVSLGDVAQFNCSFSGQPFTEIVWDHNGRTITNTERVQYAHEAGLISLI-ILNVHLGDQGSYCCTVKNRNGESRTSAQLTV 1322          

HSP 2 Score: 82.4185 bits (202), Expect = 2.235e-15
Identity = 79/342 (23.10%), Postives = 128/342 (37.43%), Query Frame = 2
Query:  917 AGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            +GD   ++ W KDG  L+ G ++    E G A L+I      DSG Y+C A+N+ G   T+  TL +    +         E+TE I   E   NT +    + +        +K       +  GQ+V L   +   +D    ++W  NG  L+N   +          L I  +   D G   C AR + G                                         V +  F       +   P F ++P +  V EG    F  +++G P P+++W  +  ++  TS  K+    ++  LE     I       V AKNK G+  A A+L+V+
Sbjct: 26982 SGDLKPSISWMKDGKNLSQGGKYEIFEEHGSAHLEIYDADLSDSGVYTCTAQNSVGSVSTN-CTLTIQA-RTTAAALEGKSELTEEIVKKE---NTYEEVQSYTE--------IKASKTQMTISQGQTVTLRASIPEASD----VKWILNGAELSNSESYRYGVSGSDHTLTIKSISHHDQGILTCEARTEQG-----------------------------------------VVKCQFDMTVSATHSGSPSFLVQPHSQNVNEGQNVTFTCEITGEPSPEVEWLKDNAVISITSNMKLSRSKNVYTLEIHNATIEDSGKFTVKAKNKFGQCSATASLNVL 27265          

HSP 3 Score: 76.6406 bits (187), Expect = 1.186e-13
Identity = 108/481 (22.45%), Postives = 175/481 (36.38%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQF---VKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQ-KVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPE---LKRT-------------DPAILLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERG--APRSKEASDAENLYANVQSRLRRSDKLS 2203
            PP+F K P  +    EG    L +RV  +G   L+V WYKD   +     ++ SF+   A++ +      DSG Y+C A N  G   T+   + VN+ E                                     RPP F   +KPM     +  G+ ++L   V       + I+W K+ R + +     + F  G A L+I      D GDY C A N AG                    +    ++ + L +L                          F  +P ++ + E   A F+ KV G P P ++W   +   +    +  +   G  S LE +             A NK GE   +  L+V  + +  PE   LK+T             D   LLRN +P  + K + +  +         FR     A++    E+G  + R +E  D   L +++Q R+  S+ ++
Sbjct: 3383 PPTFTKKPSEHIEDAEGKLVKLESRV--SGSQPLSVIWYKDNKEINTSDIYDVSFKSNVAVMCLRKATVTDSGVYTCSASNEAG---TASFQVVVNITEQK-----------------------------------RPPTFDIPLKPM----TVSEGERLNLSCHV--CGSPPVKIQWMKDRREVTSSASTKMTFVDGTATLEINQASKTDAGDYLCKATNNAGNK--------AGVAPAAAPAAPTTPQATKKLDNL-------------------------FFIEEPKSIHIVEKGTATFIAKVGGDPIPNVKWMKGKWRQMTHGGRINIQQKGQESKLEIKEVTKSDSGQYRCVASNKHGEIECSTDLNVDEKKESGPEVVKLKKTPSKQKSPKEDKDIDIVELLRNVDPKEYEKYARMYGI-------TDFRGLL-QAIEFLKKEKGEESGRPEEDEDLAKLVSDLQRRMENSEPVT 3776          

HSP 4 Score: 62.003 bits (149), Expect = 3.298e-9
Identity = 66/272 (24.26%), Postives = 102/272 (37.50%), Query Frame = 2
Query:  809 AHLDEITDPPSFVKHPERYQVANEGDPASLTARV--IPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTF-KEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVI-SEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNT 1612
            A +  +T+P  FVK     ++ +   P S   R+     G P L V WYKDG  L A  R+NT       IL+ L+    E +G YSC   N +G D+                                         D  + A   P +FVK +  + ++   Q + LE          L + W+K+G+ L    R+N        IL+ +    +E TG Y C   N  G  + +    +VA  E      +L   ++   Q L ++ T
Sbjct: 2897 ATVTAVTEPARFVK-----KLTDLSIPMSQKLRLECTFTGAPKLFVTWYKDGKQLYASYRYNTRVTANSCILECLHECNNETTGRYSCEISNIYGTDKC----------------------------------------DAQVVAVTEPARFVKKLTDM-SIPMSQKLRLECTFTGA--PKLFVTWYKDGKQLYASYRYNTKVTSNSCILECLHECNNETTGRYSCEVSNIYGTDKCHA--QVVAVTEPARFVKKLTDVAIPVTQKLRLECT 3118          

HSP 5 Score: 60.4622 bits (145), Expect = 1.006e-8
Identity = 66/257 (25.68%), Postives = 112/257 (43.58%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVV----LNSH----LPQEMTE----------SIAAIEASLNTPKTQDIHI-----DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESV 1579
            EG+ A    RV  +GD +L + WY+    +     F  +       LDI   +  D+GEY+CVA+N+ GM   S + L VN D SV     +++H      Q MTE          S++ +  S  + K+ ++       +    P   +K    + +L      +      P T+    I W  NGR + N  R     + G   L I+ V   D G Y C  +N+ G+++++  +L V  +E    ++ +P +S+
Sbjct: 1093 EGESARFQCRV--SGD-DLKITWYRRDKEIVMSDNFQMTQFGDTCQLDISRAYVADAGEYTCVARNSGGMVSCS-AVLTVN-DHSVSTVASVSTHSEMVTSQTMTETRSSTMESFESVSTVMMSSTSVKSIEVQQVTSEEEYSTSPVLTLKMSDVIVSLGDVAQFNCSFSGQPFTE----IVWDHNGRTITNTERVQYAHEAGLISLIILNVHLGDQGSYCCTVKNRNGESRTS-AQLTVEAKEANPKETPVPSDSI 1339          

HSP 6 Score: 56.6102 bits (135), Expect = 1.778e-7
Identity = 56/233 (24.03%), Postives = 85/233 (36.48%), Query Frame = 2
Query:  809 AHLDEITDPPSFVKHPERYQVANEGDPASLTARV--IPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTF-KEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDT-GDYFCFARNKAG 1495
            A +  +T+P  FVK     ++ +   P S   R+     G P L V WYKDG  L A  R+NT       IL+ L+    E +G YSC   N +G D+     + V                                          P +FVK +  +  +   Q + LE          + + W+K+G+ L    R+N        IL+ +   ++ T G Y C   N  G
Sbjct: 2992 AQVVAVTEPARFVK-----KLTDMSIPMSQKLRLECTFTGAPKLFVTWYKDGKQLYASYRYNTKVTSNSCILECLHECNNETTGRYSCEVSNIYGTDKCHAQVVAVT----------------------------------------EPARFVKKLTDV-AIPVTQKLRLECTFTGA--PKIFVTWYKDGKQLYASYRYNTKVIGDTCILECLHECNDATPGKYSCEVSNSIG 3176          

HSP 7 Score: 55.0694 bits (131), Expect = 5.374e-7
Identity = 75/319 (23.51%), Postives = 120/319 (37.62%), Query Frame = 2
Query:  809 AHLDEITDPPSFVKHPERYQVANEGDPASLTARV--IPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDS-GEYSCVAKNNFGMDQ--------TSPSTLNVNL-DESVVLNSHLPQEMTESIA------------AIEASL--------NTPKTQDIHIDAPIRPPQFVKPMPGLY---------------------------------NLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDT-GDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP 1567
            A +  +T+P  FVK     ++ +   P +   R+     G P + V WYKDG  L A  R+NT       IL+ L+   + + G+YSC   N+ G D         T P+   + L D+ V ++ +L  E T + A             + AS         NT   + +H        +  K  PG Y                                 +LQ GQ + LE     I    + + W+K+G+      R N        +L+ +    E+T G Y C   N+ G   S++   LV    T+ T+ ++P
Sbjct: 3087 AQVVAVTEPARFVK-----KLTDVAIPVTQKLRLECTFTGAPKIFVTWYKDGKQLYASYRYNTKVIGDTCILECLHECNDATPGKYSCEVSNSIGTDICHANITTFTEPARFELKLKDKQVAMSKNLKLECTFTGAPKIFVTWYKDGKQLYASYRYNTTVVGNTCTLECLH--------ECTKETPGKYSCEVSNSYGKDICHAEVTTFSGPARFVKTLTDQSLQQGQKLRLEASFKGI--GKIFVTWYKDGKQAYASYRCNTKVIGNTCVLEYLHECDENTPGKYSCEVMNEDG---SDICHALV----TLGTERKIP 3383          

HSP 8 Score: 54.299 bits (129), Expect = 7.792e-7
Identity = 89/377 (23.61%), Postives = 134/377 (35.54%), Query Frame = 2
Query:  917 AGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLP--------------------QEMTESIAAIEASLNTPKTQDIHIDAP-------------IRPPQFVKPMPGLYNLQGG-QSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDI--QNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +G P   + W  +G  +    R   + E G   L IL     D G Y C  KN  G  +TS + L V   E+    + +P                    QE  ES+  + A   T K Q  H   P             I+P   VK  P     Q    S++   +  P    S  I W  N   +     +++  D     L++  V +E  G   C   N AG    +    +    +T  +   +P E   Y  SL +  Q  E    S    E  ++    P F  K  +     G  A+F V VSG+P+P IQW+ N  L+  +S      +     L   +     E     +A N+ G++   + L V
Sbjct: 1257 SGQPFTEIVWDHNGRTITNTERVQYAHEAGLISLIILNVHLGDQGSYCCTVKNRNGESRTS-AQLTVEAKEANPKETPVPSDSISKSAKTESESSKKATDQEKVESLQNVGAL--TTKWQISHHYNPDVTTLLERDKYDAIQPEFLVKLSPEFLAKQREIDSIYYINKGSP----SPFIVWLYNQLNVEEPRSYSLKHDGPLCCLNVKNVNTEQGGSNSCKVINAAGDKTCSTHLKM----KTAFSTLPIPTEEDSYATSLRLKYQTFELQPESQLFSESIKKKPEKPIFITKLSSECAALGETAKFTVIVSGFPKPIIQWYHNGNLINSSSFYTFVQEKEEHSLVITQITKELEGEYSCTASNRFGKSTCTSYLHV 1622          

HSP 9 Score: 51.9878 bits (123), Expect = 3.746e-6
Identity = 67/276 (24.28%), Postives = 116/276 (42.03%), Query Frame = 2
Query:  827 TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRF---NTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESV-VLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVK--PM---PGLYNLQGGQSVHLETRVIPITDSSLV-------------IEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVA--TEETVVTKSQLPQESVQ 1582
            T P + +  P+   V+ EG+    T  V   G+P  +V W ++   + +  R    +T ++  F I  +  +   D G Y+ V +N+ G  Q +  +L +     V  + +  P+  +     I++       Q I    PI+ P  VK  PM   P   +     S   E + I  +  ++V             I W K+G+ L+ G ++ I  + G A L+I      D+G Y C A+N  G   +N    + A  T   +  KS+L +E V+
Sbjct: 26800 TLPATILTKPQSLTVS-EGESVKFTCDV--DGEPAPSVTWMREAQIIVSSQRHLITSTEYKSTFEINKVEMS---DGGNYTVVVENSEG-KQEAQFSLTIRKPTPVQKVVASPPRVKSPESPRIKSPFGIRSPQRIKSPEPIKSPTRVKSPPMVKSPTPKDKTSKPSFSTELKDISASADTIVKLTVKLSGDLKPSISWMKDGKNLSQGGKYEIFEEHGSAHLEIYDADLSDSGVYTCTAQNSVGSVSTNCTLTIQARTTAAALEGKSELTEEIVK 27068          

HSP 10 Score: 51.9878 bits (123), Expect = 4.398e-6
Identity = 59/239 (24.69%), Postives = 94/239 (39.33%), Query Frame = 2
Query:  806 VAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVK----PMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            V ++ E   PP+F   P +    +EG+  +L+  V   G P + +QW KD   + + +    +F  G A L+I    K D+G+Y C A NN G               +      L     +++  IE     PK+  IHI          K    P+P +  ++G                    +W    R + +G R NI      + L+I  V   D+G Y C A NK G+ + +
Sbjct: 3471 VVNITEQKRPPTF-DIPLKPMTVSEGERLNLSCHV--CGSPPVKIQWMKDRREVTSSASTKMTFVDGTATLEINQASKTDAGDYLCKATNNAGNKAGVAPAAAPAAPTTPQATKKL-----DNLFFIEE----PKS--IHIVEKGTATFIAKVGGDPIPNVKWMKG--------------------KW----RQMTHGGRINIQQKGQESKLEIKEVTKSDSGQYRCVASNKHGEIECS 3671          
BLAST of Titin vs. Ensembl Zebrafish
Match: obscnb (obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF b [Source:ZFIN;Acc:ZDB-GENE-070119-5])

HSP 1 Score: 79.7221 bits (195), Expect = 8.734e-15
Identity = 99/398 (24.87%), Postives = 158/398 (39.70%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQF-VKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQS------LDI----------------QNTEDVDRSNFRYXXXXXXXSLPHFDIKPI---NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
            P F+  P+ + +   G  ASL+  ++  G+P   V W K+ + ++AG RF T  +     L I     EDSG+Y C AKN  G +  +  TL V L E+VV                                  R P F VKP+     L G  + +      P  +     +W K+GR L    R  I  +   + L I  V S D+G Y C  +N  G+AQS    L+V  ++T +  +      + ++Q        DI                + TE+        ++E+   +L     K +     TV EG  A+    V+G+P+PQI W  +   +       +Y D + ++ L+   CK         +A N  G+  + A L ++ E
Sbjct:   10 PRFLTRPKAFSLCV-GRDASLSCTIV--GNPVPVVTWEKEKLRISAGGRFKTVEDGDIYRLTIYDLTLEDSGQYMCRAKNTVG-EAYAAVTLKVGLPETVVE---------------------------------RAPVFIVKPVSTRVGLGGDVTFYCRVSAHPAPN----FDWEKDGRYLGETNRIKITSESDSSSLRIQSVRSLDSGTYNCRVQNSIGRAQSAAT-LVVDLQDTHLLNADKSTSLLSHMQKRKQEMRTDISFYRTTESSSTTSSSTKITEEHGSFGLARDQEQRVSALTSMLPKGVFTRTCTVTEGKHAKLSCFVTGHPKPQIMWRKDGTNISEGRRHVMYEDQAENFILKVLYCKQSDNGLYTCNASNLAGQTYS-AVLVIVKE 364          
BLAST of Titin vs. Ensembl Xenopus
Match: chmp3 (charged multivesicular body protein 3 [Source:Xenbase;Acc:XB-GENE-1005141])

HSP 1 Score: 74.7146 bits (182), Expect = 3.113e-13
Identity = 58/226 (25.66%), Postives = 95/226 (42.04%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFV-KPMPGLYNLQGGQ-SVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP FVK  E  ++  +GD      ++  +G P + V W+K+   +  G ++  SF    A+L+I     E+SG+Y+C A N+ G    S S L V                                          PP F+ KP P L  L+G   ++  E +  P       + WFK+ R + +  +F I+ D   A + I+ + + D G+Y C A N+ G
Sbjct:  269 VQEPPRFVKKLESSKIVKQGDSDRFDCKI--SGSPEIRVLWFKNDAEIQHGGKYAMSFVDSVAVLEITDATIEESGDYTCEAHNDAGSVSCSTS-LKVK----------------------------------------EPPVFIAKPEPVL-TLKGVDVTLQCELKGTP----PFEVSWFKDRREIKSSKKFKIITDNYLASIHILKIDAGDIGEYQCKAVNEVG 446          

HSP 2 Score: 72.0182 bits (175), Expect = 2.249e-12
Identity = 68/263 (25.86%), Postives = 100/263 (38.02%), Query Frame = 2
Query:  707 IEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            +  +QI+  N     ++S         +S SG +  L E   PP F   PE       G+ A+    V   G     V W KD   + +G  +  SF    A L IL   K DSG Y+C A N+ G D  S S L V                                          PP+FVK +     ++ G S   + ++       + + WFKN   + +G ++ + F    A+L+I     E++GDY C A N AG
Sbjct:  138 VATIQILSTNVGHAGQYSCTASNPIGTASSSGKLI-LTEPKSPPLFDIKPENINTPI-GEAANFDCHV--TGTQPFKVTWAKDNREIRSGGNYKISFTENRAHLKILKVSKVDSGVYTCYASNDAGKDSCSAS-LGVQ----------------------------------------EPPRFVKKLESSKIVKQGDSDRFDCKI--SGSPEIRVLWFKNDAEIQHGGKYAMSFVDSVAVLEITDATIEESGDYTCEAHNDAG 353          
BLAST of Titin vs. Ensembl Xenopus
Match: MYPN (myopalladin [Source:NCBI gene;Acc:100495211])

HSP 1 Score: 72.7886 bits (177), Expect = 2.008e-12
Identity = 71/261 (27.20%), Postives = 104/261 (39.85%), Query Frame = 2
Query:  791 SRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNL---------DESVVLNSHLPQEMT-----------ESIAAIEASLNTPKTQDIHIDAP--IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQS 1507
            ++S S    + +  PP+F++  +  +V  EG    L   V+  G P   V+WY +G  L                L I   F+ED+G YSC A N +G D TS       +         D     N+   QEM              I  +  +  +P T    +D    I  P F K +  L   +G Q V  E+RV      S  +EW++ G  + +   F I+  +    L I  V SED+G + C A NK G   S
Sbjct:  238 TQSSSFYFEEPVGRPPNFIQKLKSREVT-EGSKVQLDCIVV--GFPPPEVRWYCEGKELENSPDIQIQKSGDLDSLVITEAFEEDTGRYSCFASNIYGTDSTSAEIYVEGMAFKPEPSAPDTQETSNADTYQEMNIPPSNVQTMQPTMIQQVRKNCQSPTTYLQGLDGRPLIAAPVFTKSLQDLTACEG-QLVVFESRVK--GSPSPKVEWYREGTLIEDSPDFRILQKKEICTLVIAEVFSEDSGMFTCTASNKYGTTSS 492          

HSP 2 Score: 58.9214 bits (141), Expect = 4.152e-8
Identity = 76/325 (23.38%), Postives = 123/325 (37.85%), Query Frame = 2
Query: 1031 TFKEDSGEYSCVAKNNFGMDQTSPST-LNVNL-DESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVA------------TEET----VVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL---PHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            T ++D   Y+C  +N      T   T +N  + +E+  L +  P+   ES+       N  ++   + + P+ RPP F++ +     +  G  V L+  V+        + W+  G+ L N     I        L I     EDTG Y CFA N  G   S    + V             T+ET       +  +P  +VQ +Q   IQ      +S   Y +  +   L   P F     +LT  EG    F  +V G P P+++W+    L+  +   ++     I  L               +A NK G   + A L+V
Sbjct:  182 TLEQDISNYTCQLENRERPHYTPEKTEINTTISEEANSLEAVDPECEKESLQV----ENDTQSSSFYFEEPVGRPPNFIQKLKS-REVTEGSKVQLDCIVVGFPPPE--VRWYCEGKELENSPDIQIQKSGDLDSLVITEAFEEDTGRYSCFASNIYG-TDSTSAEIYVEGMAFKPEPSAPDTQETSNADTYQEMNIPPSNVQTMQPTMIQQVRKNCQSPTTYLQGLDGRPLIAAPVFTKSLQDLTACEGQLVVFESRVKGSPSPKVEWYREGTLIEDSPDFRILQKKEICTLVIAEVFSEDSGMFTCTASNKYGTTSSIAYLTV 498          

HSP 3 Score: 52.373 bits (124), Expect = 4.223e-6
Identity = 62/224 (27.68%), Postives = 93/224 (41.52%), Query Frame = 2
Query: 1292 GQSVHLETRV--IPITDSSLVIEWFKNGRPL---NNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQK--VYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            G SV    +V  IPI      + WFK+G+ +   +  C+     D G   L I    ++D G+Y   A N  G+   +    L+        +S LP +S +    +    +E V+   FR          P+F   P ++   EG   R   KVSG P P I W LN   V P +  K  V  +G  S L     K    ++I + A NK G+   +  LS++
Sbjct:  897 GTSVTFTCKVVGIPIPK----VYWFKDGKQISKKDQHCKMQREAD-GTCALYIEAATNDDDGNYTIMAANPQGRISCS--GHLLVQNAPFRPRSLLPVQSHRARPRVPEVESEVVEERFFR----------PYFLQAPGDMVAHEGRLCRLDCKVSGLPTPDIMWLLNGRQVKPDATHKMLVRENGIHSLLIDPVTKADSGTYICI-ATNKTGQNSFSLELSIM 1102          
BLAST of Titin vs. Ensembl Xenopus
Match: PALLD (palladin, cytoskeletal associated protein [Source:NCBI gene;Acc:100144658])

HSP 1 Score: 72.0182 bits (175), Expect = 3.833e-12
Identity = 103/407 (25.31%), Postives = 155/407 (38.08%), Query Frame = 2
Query:  806 VAHLDEITD---PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER---GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHI-------------DAPIRP----PQFVKPMPGLYNLQGGQSVHLETRV--IPITDSSLVIEWFKNGRPLN-NGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFL-NECLVIPTSIQKVYSD--GSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            V H DE  D    P F    + Y++  EG P++ T +V   G+P   + W+KDG  ++  S  +   +R   G   L    +  +D G Y+ +A N  G                +     L   M +++     +  TP +Q +H+             + PI+     P F++  PG   +Q G+   ++ +V  +P  D    + W  NGRP+  +     +V + G   L I  V + D G Y C A N+AGQ  S  + L+VA ++                                           P F  K  N  V EG P R   +VSG P PQI W   NE L   T    ++ D  G +  L  Q        +  VSAKN+ G     A L V
Sbjct: 1021 VEHGDEPVDNGEAPQFETKLKHYKIF-EGMPSTFTCKV--TGNPKPKIYWFKDGKQISKRSE-HYRIQREPDGTCSLHTSASSLDDDGNYTIMAANPQGR---------------ISCTGRL---MVQAVNQRGRTARTPTSQ-LHVRRPRSRSRDSGDENEPIQERFFRPHFLQ-APGDLIVQEGKLCRMDCKVSGLPTPD----LSWQLNGRPVRPDNSHKMLVRENGVHSLVIEPVTTRDAGIYTCVASNRAGQ-NSFTLELIVAAKDA---------------------------------------HKPPVFIDKLQNTGVAEGYPVRLECRVSGMPPPQIFWKKENESLTYSTERVSMHQDNYGYLCLL-IQGATKEDAGWYTVSAKNEAGIVSCTARLDV 1358          
BLAST of Titin vs. Ensembl Xenopus
Match: PALLD (palladin, cytoskeletal associated protein [Source:NCBI gene;Acc:100144658])

HSP 1 Score: 71.633 bits (174), Expect = 4.318e-12
Identity = 103/407 (25.31%), Postives = 155/407 (38.08%), Query Frame = 2
Query:  806 VAHLDEITD---PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER---GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHI-------------DAPIRP----PQFVKPMPGLYNLQGGQSVHLETRV--IPITDSSLVIEWFKNGRPLN-NGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFL-NECLVIPTSIQKVYSD--GSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            V H DE  D    P F    + Y++  EG P++ T +V   G+P   + W+KDG  ++  S  +   +R   G   L    +  +D G Y+ +A N  G                +     L   M +++     +  TP +Q +H+             + PI+     P F++  PG   +Q G+   ++ +V  +P  D    + W  NGRP+  +     +V + G   L I  V + D G Y C A N+AGQ  S  + L+VA ++                                           P F  K  N  V EG P R   +VSG P PQI W   NE L   T    ++ D  G +  L  Q        +  VSAKN+ G     A L V
Sbjct:  935 VEHGDEPVDNGEAPQFETKLKHYKIF-EGMPSTFTCKV--TGNPKPKIYWFKDGKQISKRSE-HYRIQREPDGTCSLHTSASSLDDDGNYTIMAANPQGR---------------ISCTGRL---MVQAVNQRGRTARTPTSQ-LHVRRPRSRSRDSGDENEPIQERFFRPHFLQ-APGDLIVQEGKLCRMDCKVSGLPTPD----LSWQLNGRPVRPDNSHKMLVRENGVHSLVIEPVTTRDAGIYTCVASNRAGQ-NSFTLELIVAAKDA---------------------------------------HKPPVFIDKLQNTGVAEGYPVRLECRVSGMPPPQIFWKKENESLTYSTERVSMHQDNYGYLCLL-IQGATKEDAGWYTVSAKNEAGIVSCTARLDV 1272          
BLAST of Titin vs. Ensembl Xenopus
Match: PALLD (palladin, cytoskeletal associated protein [Source:NCBI gene;Acc:100144658])

HSP 1 Score: 71.633 bits (174), Expect = 4.859e-12
Identity = 103/407 (25.31%), Postives = 155/407 (38.08%), Query Frame = 2
Query:  806 VAHLDEITD---PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER---GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHI-------------DAPIRP----PQFVKPMPGLYNLQGGQSVHLETRV--IPITDSSLVIEWFKNGRPLN-NGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFL-NECLVIPTSIQKVYSD--GSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            V H DE  D    P F    + Y++  EG P++ T +V   G+P   + W+KDG  ++  S  +   +R   G   L    +  +D G Y+ +A N  G                +     L   M +++     +  TP +Q +H+             + PI+     P F++  PG   +Q G+   ++ +V  +P  D    + W  NGRP+  +     +V + G   L I  V + D G Y C A N+AGQ  S  + L+VA ++                                           P F  K  N  V EG P R   +VSG P PQI W   NE L   T    ++ D  G +  L  Q        +  VSAKN+ G     A L V
Sbjct:  611 VEHGDEPVDNGEAPQFETKLKHYKIF-EGMPSTFTCKV--TGNPKPKIYWFKDGKQISKRSE-HYRIQREPDGTCSLHTSASSLDDDGNYTIMAANPQGR---------------ISCTGRL---MVQAVNQRGRTARTPTSQ-LHVRRPRSRSRDSGDENEPIQERFFRPHFLQ-APGDLIVQEGKLCRMDCKVSGLPTPD----LSWQLNGRPVRPDNSHKMLVRENGVHSLVIEPVTTRDAGIYTCVASNRAGQ-NSFTLELIVAAKDA---------------------------------------HKPPVFIDKLQNTGVAEGYPVRLECRVSGMPPPQIFWKKENESLTYSTERVSMHQDNYGYLCLL-IQGATKEDAGWYTVSAKNEAGIVSCTARLDV 948          
BLAST of Titin vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 120.939 bits (302), Expect = 2.957e-27
Identity = 112/399 (28.07%), Postives = 184/399 (46.12%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGS--RFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLD------ESVVLNSHLPQEM--TESIAAIEAS---LNTPKTQ----DIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P+FV   E+ +  N  + + L  +V   G+PN  + W K+   +      R      RG A L I     +DS  Y+  A N  G D T+   +NV ++      E  ++   +P+     + IAA E     L   + Q    D++     + P F K +  L  L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP  ++ +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1516 PAFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAALKIDSIISQDSAWYTATAINKAGRD-TTRCKVNVEVEFAEPEPERKLI---IPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSL-RLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPDGKKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRR 1901          

HSP 2 Score: 72.0182 bits (175), Expect = 3.185e-12
Identity = 91/355 (25.63%), Postives = 140/355 (39.44%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK--SQLPQESVQYL------QSLDIQ----NTEDVDRSNF---RYX-XXXXXXSLPHFDIKPI---NLTVE---EGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKV 1816
            +V  PE  QV  E        G PA   A  + +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  V P+      + G+    + +V   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L A E  +  +   Q+  E  + L       S D +    ++ED+D  +    RY        S P +  KP     LT +   EG P  F   +  YP P++ WF N    IPT +++V
Sbjct: 3192 YVNAPEPPQVLQELQPVTVQSGKPARFCA--VISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIVTPLQDTVTSE-GRPARFQCQV---SGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEAPESILHERIGQQIEMEMKEELFEGEADGSGDARGAFSDSEDIDHHSLMARRYANRTSSTSSWPEY-FKPTFTQKLTFQYALEGEPIVFTCSLVAYPTPEMTWFHNN-RPIPTGLRRV 3510          

HSP 3 Score: 70.8626 bits (172), Expect = 7.427e-12
Identity = 68/250 (27.20%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM-TESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+  V WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     + L ++  TE    +E+      +T  T++         P F+   P +  L  G SV  E ++    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   L  A  E +V   Q
Sbjct:  899 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFIS-KPVVQKLVEGGSVVFECQI--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYEALVKTQQ 1141          

HSP 4 Score: 65.855 bits (159), Expect = 2.491e-10
Identity = 66/262 (25.19%), Postives = 117/262 (44.66%), Query Frame = 2
Query: 1229 DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE----TVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            + P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +EE    T +T+ +   E  ++++S D+  T   D S    +      + P F  KP+   + EG    F  ++ G P+P + W  +    +P +    Y    +SY  +   C++          GE  IV+  +NK GE  A+A+L  + E D+   +K
Sbjct:  894 EVPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFDKETTLTE-KFATEEKRFVESRDVVMT---DTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECRLVISMTFADDAGEYTIVI--RNKHGETSASASL--LEEADYEALVK 1138          

HSP 5 Score: 58.5362 bits (140), Expect = 4.841e-8
Identity = 40/110 (36.36%), Postives = 53/110 (48.18%), Query Frame = 2
Query:  782 FRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTA--RVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYT--FKEDSGEYSCVAKNNFGMDQTS 1099
             RS  + S      +  PP F+K      +++   P    A  + +  G P  TV WYKDG  L  GSRF+   E G    ++  T   K D GEYSCVA NN GM ++S
Sbjct: 5400 LRSRYADSFFEFQVVDGPPRFIKG-----ISDCHAPLGTAAYFQCLVRGSPRPTVSWYKDG-KLVQGSRFSAE-ESGIGFHNLFITGLVKGDEGEYSCVATNNSGMARSS 5502          
BLAST of Titin vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 118.242 bits (295), Expect = 2.123e-26
Identity = 105/401 (26.18%), Postives = 173/401 (43.14%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGS--RFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-----------------LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P+FV   E+ +  N  + + L  +V   G+PN  + W K+   +      R      RG A L I     +DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+    R  Q       LY+                 L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP  ++ +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1562 PAFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTR---CKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHL----RYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPDGKKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRR 1947          

HSP 2 Score: 92.4337 bits (228), Expect = 2.037e-18
Identity = 102/422 (24.17%), Postives = 173/422 (41.00%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFN-TSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPL--NNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQE---SVQYLQSLDIQNTEDVD--RSNFRYXXXXXXXSL-------------------PHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP 2011
            PP+ V  P +  V +EG PA    +V      +L V WY     +     F  T FE  +  L+I   + ED G Y+ VA N  G   ++ +       +S  + S      + S++  + +L              + P F++P+  L  +  G++V    RV  +   +  I+WF N +P+  +    F+     G A++ I+    E  G Y C A N AG+A       + A     +   ++ Q+    ++ + SL +   ED     S+ R     E   L                   P F  +I  + ++VE  + A+  V V+G P+P+IQWF N  L+ P++  K   DG    L     +   E      A N+ G+AV +A L + P  +   E++  +   L + + P
Sbjct: 3350 PPAIVT-PLQDTVTSEGRPARFQCQV---SGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQ-LEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEGFSKSEEVTSKSQWHTSPSVSLKKEALG-------------QKPIFIQPLSSL-RVHSGETVRFHARVSGVPKPA--IQWFHNHQPILPSKDVVFHFEESTGMALMLIVDAYPEHAGKYSCRAANSAGEATCAATLTVTAKAPESILHERIGQQIEMEMKEIASL-LSAEEDFQTYSSDLRLPNANETLELLSEPPARSTQFDSRQEGAAPVFIREISDVEISVE--DVAKLSVTVTGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEGEYTCLASNEYGKAVCSAHLRISPRGERSTEMESGEKKALEKPKGP 3747          

HSP 3 Score: 86.2705 bits (212), Expect = 1.380e-16
Identity = 79/301 (26.25%), Postives = 120/301 (39.87%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS-----------------PSTLNVNLDESVVLNSHL----PQEMTESI----------AAIEASLNTPK------------------TQDIHID------APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + S  ++ S ++  + E   PPSF +  +  +    G P +LT R+   G   + V WY+DGV L        SF    A L IL T    SG+YSC A N  G   ++                 P +++V   ES     H+    P  +T S             I    NTP                   T D+  D      +   PP+F+K +      + G+S+ LE ++    +  +V  WF+N   L+   ++N+ F    A+L I    +EDTGDY C A N  G A  +
Sbjct: 7167 ENSIGTAASKTIFRIQERQLPPSFARQLKDIE-QTVGLPVTLTCRL--NGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVV--WFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCS 7462          

HSP 4 Score: 83.9593 bits (206), Expect = 6.962e-16
Identity = 83/376 (22.07%), Postives = 144/376 (38.30%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRN 2002
             +GDPA+L  +   +G   ++ +W+KDG  L  G ++  S     +IL I+ T K+DSGEY+   +N+ G                               ++ +AS+N        +D  I PP F K +  + +++G     ++   I      + I+WFK+ + ++   +    F    A L+I  +   D+G Y C A NKAG +Q +                            L ++                     P+F  KP +  V  G   +    V G     I+WF +   + P + + V+ D + + LE    K       +    N +G   + AT+ V     F   +K+  P ++LRN
Sbjct: 5604 TQGDPATLQVKF--SGTKEISAKWFKDGQELTLGPKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGR------------------------------SSCKASINV-------LDL-IIPPSFTKKLRKMDSIKGS---FIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCS--------------------------GHLTVKEP-------------------PYFVEKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIFVKEPPQF---IKKPSPVLVLRN 5888          

HSP 5 Score: 80.4925 bits (197), Expect = 8.991e-15
Identity = 67/244 (27.46%), Postives = 100/244 (40.98%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            + +P   ++  E  QV   GDPA+L   V  +G P L  +WYKDG PL A  ++  SF+   A L        DSG+Y+    N  G   +S  T    LD  +                                     P F KP+  + ++ GG +  L+ ++       + + WFK+G+ L    R+ I F  G A L+I  V   D G++ C A N  G   S+   L+V    + VTK
Sbjct: 5026 VKEPAKIIERAELIQV-TAGDPATLEYTV--SGTPELKPKWYKDGRPLVASKKYRISFKNNIAQLKFYSAELHDSGQYTFEISNEVG--SSSCETTFTVLDRDIA------------------------------------PLFTKPLRNVDSVVGG-ACRLDCKI--AGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGA-LIVQEPPSFVTK 5224          

HSP 6 Score: 78.9518 bits (193), Expect = 2.868e-14
Identity = 101/474 (21.31%), Postives = 174/474 (36.71%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN----------------VVRLLVATEETVVTKSQL----PQESVQYLQ-------------------SLDIQNTEDVDRSNFRYXXXXXXXS-----------LPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQ-KVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPF-----RKLSTLKKVAVSPELQNAFRK 2077
            + +PPSF+  PER Q   +   +++  + +  G P   ++W KD V L +G +     E   + L++       +G+Y+C   N+ G D  +   L                 +TE                        PP+FVK +     ++ G S  LE ++    +  +V  W++N   L    ++ + F    A++ +  + +ED+GD+ C A+N AG    +                +V  L  TE  V  + +L    P E V Y                     S+ I N E  D   +  + + E  S            P F  K  +LTV  G PA     + G     +QW   +  VI  S   ++    +++ L+F + +       +   KN  G     ATL+V+            +PA+++              +   KVA +PEL   + K
Sbjct: 6339 VKEPPSFLVKPERQQAIPD---STVEFKAVLKGTPPFKIKWLKDDVELVSGPKCFIGLEGSTSFLNLYSVDSSKTGQYTCQVTNDVGSDSCTTMLL-----------------VTE------------------------PPKFVKKLEASKIIKAGDSARLECKITGSPEIQVV--WYRNEHELTASDKYQMTFIDSVAVIQMNSLGTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNTE--VSLECELSGTPPFEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVL------------EPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYK 6752          

HSP 7 Score: 78.1814 bits (191), Expect = 4.059e-14
Identity = 86/389 (22.11%), Postives = 147/389 (37.79%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFV+ P+   V   G   + T+  I  G P  TV W+K    L  G+R N S +     L++       SGEY+C+  N  G                                   AS  T     + + AP     FVK +   Y+++ G+ + LE   +   PI+     + W KNG  +    R NI      AIL+I+    ED+G Y C+  N +G+   +   L++                                               P+F   ++P+ +TV  G+ A    +++G P   + W+  +  + PT+  K++   +++ L F +         +  A+N +GE V+++T   + E    P   R
Sbjct: 8784 VREPPSFVQKPDPMDVLT-GSNVTFTS--IVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAG----------------------------------RASCTT----RLFVKAPA---IFVKRL-NDYSIEKGKPLILEGTFSGTPPIS-----VTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEP---------------------------------------------PYFVKQLEPVKVTV--GDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGE-VSSSTFLTVQEQKLPPSFSR 9074          

HSP 8 Score: 78.1814 bits (191), Expect = 4.270e-14
Identity = 118/489 (24.13%), Postives = 176/489 (35.99%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWF------LNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP-------ENDFRPELKRTDPAI--------------LLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPSAVQLSN---YERGAPRSKEASDAENLYANVQSRLRRSDKLS 2203
            PPSF K         EG+   L  RV  AG   +TV WYK+ V +   S     F+    +L +      D+G Y+C A N+ G      S L                                 T  I I  P +PP F + +  +   + G SV L   V       + I+W K GR +    R +  F  G A+L++      D+GDY C A N AG   S+  +  V  +E                          VD   F             F  +P ++ V E   A F+ KV G P P ++W       LN+   I      ++  G  + LE +             A NK GE  +N  L V         E D R  LK+T PA+              LL+N +P  + K + +  +     L  AF   K S  + ++    E      ++  + E L A +Q RL +++ ++
Sbjct: 9261 PPSFTKKLSETVEETEGNSFKLEGRV--AGSQPITVAWYKNNVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAG------SALC--------------------------------TSSIVIKEPKKPPVFDQHLAPVTASE-GDSVQLSCHV--QGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAG---SDTSKCKVTIKEKPAAAPA--------------AKKAAVDGKLF-------------FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRI-----LIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKT-PALKKGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEELEKSERDEKEFEELVAFIQQRLTQTEPVT 9670          

HSP 9 Score: 78.1814 bits (191), Expect = 4.493e-14
Identity = 91/389 (23.39%), Postives = 145/389 (37.28%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFVK PE  +V   G   + T+ +   G P   V W++    L  G+R N  FE   A L++       SGEY+CV  NN G    +  T  + + E                                      P  FVK +   ++++ G+S+ LE   T  +PI+     + W K+G  +    R NIV      IL+I+     D G Y C   N+AG+   +    LV+T E                                           P+F  +++P+  +V  G+      +V+G P   + WF  +  +  T   + Y   +++ L F +  I         A+N +G A A+ T+  I E    P   R
Sbjct: 6902 VQEPPSFVKEPEPLEVL-PGKNITFTSVI--RGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQ---ASCTTRLFVKE--------------------------------------PATFVKKLSD-HSVEPGKSIILEGTYTGTLPIS-----VTWKKDGVSITPSERCNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDA---LVSTLEP------------------------------------------PYFVTELEPLEASV--GDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTA-ASKTIFRIQERQLPPSFAR 7192          

HSP 10 Score: 77.411 bits (189), Expect = 7.922e-14
Identity = 60/210 (28.57%), Postives = 91/210 (43.33%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
             E DP +L   V  AG P L V+W KDG  +     F+ SFE   A   I    K+DSG+Y+   +N+FG   +  + L V LD                             QDI       PP F K +  +  +  G S+H+E +V   +PI+      +WFK+G+ ++   ++ +V       L++  +  EDT +Y C   N AG
Sbjct: 6166 TEKDPVTLECVV--AGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFG-SSSCDAYLRV-LD-----------------------------QDI-------PPSFTKKLTKMDKVL-GSSIHMECKVSGSLPIS-----AQWFKDGKEISTSAKYRLVCHENTVSLEVSNLELEDTANYTCKVSNVAG 6329          

HSP 11 Score: 76.6406 bits (187), Expect = 1.230e-13
Identity = 112/461 (24.30%), Postives = 176/461 (38.18%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL--VATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN-LTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGS--ISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI---PENDFRP------ELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAPRS--KEASDAE 2152
            +V  PE  QV  E        G PA   A +  +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  V P+      +G +    + +V   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L   +  E V +KSQ        L+   +                      P F I+P++ L V  G   RF  +VSG P+P IQWF N   ++P+     + + S  ++ +                A N  GEA   ATL+V    PE+          E++  + A LL  E  F+  S+  ++  + E      +    + Q  + + GA     +E SD E
Sbjct: 3238 YVNAPEPPQVLQELQPVTVQSGKPARFCAVI--SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIVTPLQDTVTSEG-RPARFQCQV---SGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEGFSKSEEVTSKSQWHTSPSVSLKKEALGQK-------------------PIF-IQPLSSLRVHSGETVRFHARVSGVPKPAIQWFHNHQPILPSKDVVFHFEESTGMALMLIVDAYPEHAGKYSCRAANSAGEATCAATLTVTAKAPESILHERIGQQIEMEMKEIASLLSAEEDFQTYSSDLRLPNANETLELLSEPPARSTQFDSRQEGAAPVFIREISDVE 3644          

HSP 12 Score: 74.3294 bits (181), Expect = 6.629e-13
Identity = 64/231 (27.71%), Postives = 98/231 (42.42%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVV 1516
            + +P + V+ PE   V   G+P +L   V  AG P L+ +W+KDG  L++GSR + +F R  A L I      D G Y+   +N  G    S  T++V++ + VV                                   PP FV+ +    +   G SV LE RV     + + + WF +G  + +  +    F      L +  +   DTG Y C A N AGQ +S+ V
Sbjct: 7654 VLEPATIVEKPEPMTVTT-GNPFTLECVV--AGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVG---KSSCTVSVHVSDRVV-----------------------------------PPSFVRRLKDT-SATLGASVVLECRV--SGSAPISVGWFLDGNEIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAV 7840          

HSP 13 Score: 72.7886 bits (177), Expect = 2.025e-12
Identity = 87/372 (23.39%), Postives = 133/372 (35.75%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHID--APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +PP FV   E  + A+ GD  SL  +V  AG P +TV W+K    L +   + T F    A L        DSGEY+C+A+N+ G   T+ S     + E       LP      +  IE ++  P T    ++  API+                                   + W+++G  L +     + F    A L I+      +G Y C A N  G A S     L A E         P++S                               P FDIKP+++ V  G  A F   V+G    ++ W  +   + P     +   G+  +L   +            A N +G+ + +A LSV
Sbjct: 7090 EPPYFVTELEPLE-ASVGDSVSLQCQV--AGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIG---TAASKTIFRIQE-----RQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQ-----------------------------------VCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTA--RLTARE---------PKKS-------------------------------PFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSV 7373          

HSP 14 Score: 72.0182 bits (175), Expect = 3.570e-12
Identity = 93/430 (21.63%), Postives = 159/430 (36.98%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG-QAQSNVVRL-----LVATEETVVTKSQLPQE---SVQYLQSLDIQ---NTEDVDR--SNFRYXXXXXXXSLPHFDIKPIN-----------------------------------LTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            S S   +  +T+PP FVK  E  ++   GD A L  ++   G P + V WY++   L A  ++  +F    A++ +     EDSG++ C A+N  G   TS ST  V + E  V +S  P  + E++   E SL          +    PP                                 + W+K+ R L +  ++ +      A + I+ V S D G+Y C A+N+ G  A    V+L      ++   ++   +  P E   S++  Q + +Q     E+V R   N R        +L    ++P N                                   +TV  G       KV+G P   ++W+ +  L+  +   K      IS L+    +           +N +G++   A + V
Sbjct: 6423 SDSCTTMLLVTEPPKFVKKLEASKIIKAGDSARLECKI--TGSPEIQVVWYRNEHELTASDKYQMTFIDSVAVIQMNSLGTEDSGDFICEAQNPAG--STSCST-KVIVKEPPVFSSFPP--IVETLKNTEVSL--------ECELSGTPP-------------------------------FEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDV 6806          

HSP 15 Score: 72.0182 bits (175), Expect = 3.885e-12
Identity = 59/225 (26.22%), Postives = 95/225 (42.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQF-VKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  ++ ++  + +      ++   G P + V WYKD V +   S+F  SFE   AIL++     EDSG+Y+C A+N  G   +S ++L V                                          PP F  KP P +  L+G   VHLE  +         + W K+ R L +G ++ I+ +     + I+ V + D G+Y C A N  G
Sbjct: 8314 VQEPPRFIKKLDQSRIVKQDEYTRYECKI--GGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSS-TSLKVK----------------------------------------EPPVFRKKPFP-VETLKGAD-VHLECEL--QGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVG 8491          

HSP 16 Score: 71.2478 bits (173), Expect = 6.082e-12
Identity = 57/234 (24.36%), Postives = 92/234 (39.32%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            + +PPSFVK  +   +   G+ A L  ++   G P + V W+K+   L+  +    SF    AILDI     +DSG YSC A N+ G D  S           VV+                                  PP F+K +     ++G  ++ L+  +         + WFK+ + + +  ++ +   + F  L+I    S D GDY C   N+ G+       LL
Sbjct: 4746 VREPPSFVKKVDPSYLMLPGESARLHCKL--KGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCS---------TEVVIK--------------------------------EPPSFIKTLEPADIVRGANAL-LQCEI--AGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLL 4933          

HSP 17 Score: 69.707 bits (169), Expect = 1.650e-11
Identity = 68/250 (27.20%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM-TESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+  V WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     + L ++  TE    +E+      +T  T++         P F+   P +  L  G SV  E ++    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   L  A  E +V   Q
Sbjct:  945 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFIS-KPVVQKLVEGGSVVFECQI--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYEALVKTQQ 1187          

HSP 18 Score: 69.3218 bits (168), Expect = 2.237e-11
Identity = 57/232 (24.57%), Postives = 91/232 (39.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P + V+ PE  +V   GD  +L   V  +G P L+ +W+KDG  L + +++  SF    + L I+     DSG YS   +N  G D    S                                      I +   I PP F + +     L  G SV +E +V    PI+     + WF +G  +++G ++          L +  +   D GDY C A N AG  + +
Sbjct: 8595 VLEPAAIVEKPESIKVTT-GDTCTLECTV--SGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVVPGDSGVYSFEVQNPVGKDSCKVS--------------------------------------IQVSDRIIPPSFTRKLKETNGLS-GSSVVMECKVYGSPPIS-----VLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECS 8779          

HSP 19 Score: 68.9366 bits (167), Expect = 3.357e-11
Identity = 93/413 (22.52%), Postives = 151/413 (36.56%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN-LTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKV---YSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP 2011
            RSS   S+  LD I  PPSF K   + +  +    + +    I AG   +++QW+KD   ++A  +   SF    A L+I      DSG Y+C A N  G  Q S                HL      ++      +  P++QD++    ++          L  L GG +        P+T     I+WFK+ + L+ G   ++  D    IL++    + D+G Y C   N  G   S           T+  K                                      P F  KP   L +  G    F  +V+G P  ++ W+L+   +  T ++K    + DG ++  +    ++      V  A+N  G     A+ S+        ELK  +P I +R   P
Sbjct: 5672 RSSCKASINVLDLII-PPSFTK---KLRKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCS---------------GHL------TVKEPPYFVEKPQSQDVNPGTRVQ----------LKALVGGTA--------PMT-----IKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKA---------TIFVKEP------------------------------------PQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEI--TDLRKYGISFVDG-LATFQISNARVENSGTYVCEARNDAG----TASCSI--------ELKVKEPPIFIRELEP 5976          

HSP 20 Score: 65.855 bits (159), Expect = 2.366e-10
Identity = 65/241 (26.97%), Postives = 89/241 (36.93%), Query Frame = 2
Query:  788 SSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            S+ SG+   L E  +PP F   P     A  G+ A L   V   G   + V W KD   + +G  +  S+    A L I+   K DSG+Y+C A N  G D     T  +N+ E ++                                   PP F K +        G S  LE RV    PIT     + W+KN   ++      I+F     +L +      D G Y C A N AG A
Sbjct: 9150 SASSGAKLILTEGKNPP-FFDIPLAPMDAVVGESADLECHV--TGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDS---CTAQLNIKERLI-----------------------------------PPSFTKKLSETVEETEGNSFKLEGRVAGSQPIT-----VAWYKNNVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAGSA 9344          

HSP 21 Score: 64.6994 bits (156), Expect = 5.372e-10
Identity = 61/234 (26.07%), Postives = 89/234 (38.03%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            I +PP FVK  E  +V   GD ASL  ++  AG P + V WYK    L   +     F+   A L        DSGEY C A+N+ G  + S ST         V    LP   +  +  ++ ++  P   +  +                    G +         PI+     + W+K+G+PL +       F    A L+I       +G Y C A N  G A S    +L
Sbjct: 8970 ILEPPYFVKQLEPVKVTV-GDSASLQCQL--AGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVG--EVSSSTF------LTVQEQKLPPSFSRQLRDVQETVGLPVVFECAV-------------------SGSE---------PIS-----VSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATNPIGSASSGAKLIL 9159          

HSP 22 Score: 64.6994 bits (156), Expect = 6.047e-10
Identity = 66/262 (25.19%), Postives = 117/262 (44.66%), Query Frame = 2
Query: 1229 DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE----TVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            + P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +EE    T +T+ +   E  ++++S D+  T   D S    +      + P F  KP+   + EG    F  ++ G P+P + W  +    +P +    Y    +SY  +   C++          GE  IV+  +NK GE  A+A+L  + E D+   +K
Sbjct:  940 EVPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFDKETTLTE-KFATEEKRFVESRDVVMT---DTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECRLVISMTFADDAGEYTIVI--RNKHGETSASASL--LEEADYEALVK 1184          

HSP 23 Score: 64.3142 bits (155), Expect = 7.859e-10
Identity = 81/376 (21.54%), Postives = 131/376 (34.84%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKN 1900
            + S  +  S +V  + E   PPSF +  +       G P +   R+   G   L V WYKDG  L   +    SF    A L IL T +   G+Y+C A N  G   T+ S+  + L E  V                                    P F    P   +L  G+S   +  V     + + I W K+ R +  G  + +      A L ++ V   D G Y C+A N AG+  S   +L V             QE  ++++ LD                                  V++    R+  K+ G P  ++ W+ +E  +  +S  ++  + S++ LE     +         A+N
Sbjct: 8108 ENSVGAVASSAVLVIKERKLPPSFARKLKDVH-ETLGFPVAFECRI--NGSEPLQVSWYKDGELLKDDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLG---TASSSAKLILSEHEV------------------------------------PPFFDLKPVSVDLALGESGSFKCHV--TGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVAKGDAGQYTCYASNVAGK-DSCSAQLGV-------------QEPPRFIKKLDQSR------------------------------IVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARN 8395          

HSP 24 Score: 64.3142 bits (155), Expect = 8.129e-10
Identity = 64/319 (20.06%), Postives = 109/319 (34.17%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQW 1771
            L  + +PP F++  E  + A  G+P +L  +V   G P + + WYK+   L +   +   F+   A L I      D GEY+C A+N+ G   +S           V+    LP      +  +  +L  P   +  I+                                     L + W+K+G  L +     + F    A L I+       G Y C A N  G A S+         + ++++ ++P                                  P FD+KP+++ +  G    F   V+G    +I W
Sbjct: 8026 LVSVLEPPYFIEPLEHVEAAI-GEPITLQCKV--DGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVL--------VIKERKLPPSFARKLKDVHETLGFPVAFECRING---------------------------------SEPLQVSWYKDGELLKDDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLGTASSSA--------KLILSEHEVP----------------------------------PFFDLKPVSVDLALGESGSFKCHVTGTAPIKITW 8258          

HSP 25 Score: 63.5438 bits (153), Expect = 1.469e-9
Identity = 50/226 (22.12%), Postives = 83/226 (36.73%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +PP F+K P    V   G   +   +V   G P + V WY DG  +    ++  SF  G A   I     E+SG Y C A+N+ G   T+  ++ + + E                                      PP F++ +  +  ++    V LE  V+  T     + W KN + + +G ++ +        L I      D G+Y C   N+ G  
Sbjct: 5870 VKEPPQFIKKPSPVLVLRNGQSTTFECQV--TGTPEIRVSWYLDGNEITDLRKYGISFVDGLATFQISNARVENSGTYVCEARNDAG---TASCSIELKVKE--------------------------------------PPIFIRELEPVEVVKDSD-VELECEVMGTT--PFEVTWLKNNKEIRSGKKYTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSC 6049          

HSP 26 Score: 62.7734 bits (151), Expect = 2.358e-9
Identity = 51/225 (22.67%), Postives = 86/225 (38.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSV-HLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  +  +VA +G+   L  ++  +G P + V W+++   L    ++N SF    A+L I     ED+G+Y C A N  G D +  + L V                                          PP F +  P +  L+G   +   E    P       + W K+ + + +  +F I        L I  + + D G+Y C A N+ G
Sbjct: 7373 VKEPPKFIKKLDASKVAKQGESIQLECKI--SGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVG-DASCSTALKVKA----------------------------------------PPVFTQKPPPVGALKGSDVILQCEISGTP----PFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVG 7550          

HSP 27 Score: 62.3882 bits (150), Expect = 2.699e-9
Identity = 51/228 (22.37%), Postives = 86/228 (37.72%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +P +F++  E  Q+  +GD   L  +V   G P + + W+ +   L   S+   SF    A+L +     EDSGEY C A+N  G D  +           +V+    P   T+   +IE      K  D+ + A +   PP                                 I WFK+   L +G ++          L ++  ++ D G+Y C   N+ G +
Sbjct: 5308 VKEPATFIEKLEPSQLLKKGDGTQLACKV--TGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCT----------GIVIVKESPY-FTKEFKSIEVL----KEYDVMLLAEVAGTPP-------------------------------FEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSS 5487          

HSP 28 Score: 60.077 bits (144), Expect = 1.378e-8
Identity = 66/258 (25.58%), Postives = 106/258 (41.09%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHL-----PQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQG-----GQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQES 1576
            P F++     +++ E D A L+  V   G P   +QW+ +G+ L   + +   F+     L IL+T  +D GEY+C+A N +G                 V ++HL      +  TE  +  + +L  PK        P  PP F K +  ++   G       SVH E         +  + WFK   PL     + I+    G     +      D+G Y C A+N  G++ +    LLV  E+T V  +   +ES
Sbjct: 3634 PVFIREISDVEISVE-DVAKLSVTV--TGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEGEYTCLASNEYG---------------KAVCSAHLRISPRGERSTEMESGEKKALEKPK-------GPC-PPYFFKELKPVHCGPGIPAVFEYSVHGE--------PAPTVLWFKEDMPLYTSVCYTIIHSPDGSGTFIVNDPQRGDSGLYLCKAQNLWGES-TCAAELLVLPEDTDVPDASCKEES 3856          

HSP 29 Score: 59.6918 bits (143), Expect = 1.791e-8
Identity = 66/244 (27.05%), Postives = 95/244 (38.93%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----------IEWFK-NGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            + E   PP F +H      A+EGD   L+  V   G   + +QW K G  +    R + SF  G A+L++  T K DSG+Y C A N  G D TS   + +                       E     P  +   +D              L+ +   QS+    RV+  T ++ +          ++W K   R LN G R  I      A L+I      D+G Y C A NK G+ +SNV
Sbjct: 9352 IKEPKKPPVFDQHLAPV-TASEGDSVQLSCHV--QGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSD-TSKCKVTIK----------------------EKPAAAPAAKKAAVDG------------KLFFVSEPQSI----RVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNV 9553          

HSP 30 Score: 59.3066 bits (142), Expect = 2.367e-8
Identity = 55/222 (24.77%), Postives = 87/222 (39.19%), Query Frame = 2
Query: 1334 DSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVY---SDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI-----PENDFRPELKR 1975
            D S  + W+   R L N  ++ I ++ G A + +  +   D G Y C   N  G+  S+   L V              + V+ +     + T+ V R   R +     E  P F +   N T   G   RF V ++ +P P++ W+ +   + P   +K Y   SD  +  L         ++   V A+NK GE    A L+V       E   RP  KR
Sbjct: 33509 DQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFDDGTYRCKVVNDYGE-DSSYAELFV--------------KGVREVYDYYCRRTKKVKR---RTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMFKR 33712          

HSP 31 Score: 51.9878 bits (123), Expect = 4.119e-6
Identity = 56/253 (22.13%), Postives = 95/253 (37.55%), Query Frame = 2
Query:  776 QSFRSSRSGSVAHLDEIT--DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV-VRLL 1525
            Q   ++  GS A    +   +PPSF+K  E      +   +S T +   AG P +++ W KD   L      + SFE   A L +       SG Y+C AKN  G+++               L    P ++ E   +++ +   P                               V LE  V    +  L ++W K+G+ +     F++ F+   A   I  V+ +D+G Y     N  G +  +  +R+L
Sbjct: 6039 QCIIANEGGSCACSARVALKEPPSFIKKIENVTTVLK---SSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVATLQVRSVDNGHSGRYTCQAKNESGIERC-----------YAFLLVQEPAQIIEKAKSVDVTEKDP-------------------------------VTLECVVAGTPE--LKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVL 6244          

HSP 32 Score: 51.9878 bits (123), Expect = 4.959e-6
Identity = 49/214 (22.90%), Postives = 82/214 (38.32%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFC 1474
            PP+F+  P +      G  A     V  +G P + + W KDG  L+       +       L++     +D G YSC A N FG D           + +++   H  +E+     A+++++N                               + +HLE +V    D  + I W K+G+ L  G  + I F+   A L+I     +D+G Y C
Sbjct: 4563 PPTFLSRP-KALTTFVGKAAKFLCTV--SGTPVIEIIWQKDGAALSPSPDCRVTDADNKHSLELSNLTVQDRGIYSCKASNKFGADI-------CQAELTIIDKPHFIKEL----EAVQSAIN-------------------------------KKIHLECQV--DEDRKVTITWSKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYTC 4729          
BLAST of Titin vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 118.242 bits (295), Expect = 2.517e-26
Identity = 105/401 (26.18%), Postives = 173/401 (43.14%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGS--RFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-----------------LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P+FV   E+ +  N  + + L  +V   G+PN  + W K+   +      R      RG A L I     +DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+    R  Q       LY+                 L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP  ++ +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1562 PAFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTR---CKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHL----RYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPDGKKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRR 1947          

HSP 2 Score: 86.2705 bits (212), Expect = 1.690e-16
Identity = 79/301 (26.25%), Postives = 120/301 (39.87%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS-----------------PSTLNVNLDESVVLNSHL----PQEMTESI----------AAIEASLNTPK------------------TQDIHID------APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + S  ++ S ++  + E   PPSF +  +  +    G P +LT R+   G   + V WY+DGV L        SF    A L IL T    SG+YSC A N  G   ++                 P +++V   ES     H+    P  +T S             I    NTP                   T D+  D      +   PP+F+K +      + G+S+ LE ++    +  +V  WF+N   L+   ++N+ F    A+L I    +EDTGDY C A N  G A  +
Sbjct: 6148 ENSIGTAASKTIFRIQERQLPPSFARQLKDIE-QTVGLPVTLTCRL--NGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVV--WFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCS 6443          

HSP 3 Score: 83.5741 bits (205), Expect = 1.167e-15
Identity = 83/376 (22.07%), Postives = 144/376 (38.30%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRN 2002
             +GDPA+L  +   +G   ++ +W+KDG  L  G ++  S     +IL I+ T K+DSGEY+   +N+ G                               ++ +AS+N        +D  I PP F K +  + +++G     ++   I      + I+WFK+ + ++   +    F    A L+I  +   D+G Y C A NKAG +Q +                            L ++                     P+F  KP +  V  G   +    V G     I+WF +   + P + + V+ D + + LE    K       +    N +G   + AT+ V     F   +K+  P ++LRN
Sbjct: 4597 TQGDPATLQVKF--SGTKEISAKWFKDGQELTLGPKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGR------------------------------SSCKASINV-------LDL-IIPPSFTKKLRKMDSIKGS---FIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCS--------------------------GHLTVKEP-------------------PYFVEKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIFVKEPPQF---IKKPSPVLVLRN 4881          

HSP 4 Score: 80.4925 bits (197), Expect = 7.982e-15
Identity = 90/343 (26.24%), Postives = 142/343 (41.40%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQ-AQSNVVRL------LVATEE-------TVVTKSQL---PQESVQYLQ-----------------SLDIQNTEDVDRSNF-RYXXXXXXXSLPHFDIKPINLT--VEEGNPARFLVKVSGYPRPQIQWFLNE 1783
             E DP +L   V  AG P L V+W KDG  +     F+ SFE   A   I    K+DSG+Y+   +N+FG   +  + L V LD                             QDI       PP F K +  +  +  G S+H+E +V   +PI+      +WFK+G+ ++   ++ +V       L++  +  EDT +Y C   N AG  A S ++ +      LV  E        TV  K+ L   P   +++L+                 S    N   VD S   +Y  +  N+  P   +K +  +  ++ G+ AR   K++G P  Q+ W+ NE
Sbjct: 5159 TEKDPVTLECVV--AGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFG-SSSCDAYLRV-LD-----------------------------QDI-------PPSFTKKLTKMDKVL-GSSIHMECKVSGSLPIS-----AQWFKDGKEISTSAKYRLVCHENTVSLEVSNLELEDTANYTCKVSNVAGDNACSGILTVKEPPSFLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWLKDDVELVSGPKCFIGLEGSTSFLNLYSVDSSKTGQYTCQVTNDVEPPKFVKKLEASKIIKAGDSARLECKITGSPEIQVVWYRNE 5455          

HSP 5 Score: 80.1073 bits (196), Expect = 1.272e-14
Identity = 67/244 (27.46%), Postives = 100/244 (40.98%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            + +P   ++  E  QV   GDPA+L   V  +G P L  +WYKDG PL A  ++  SF+   A L        DSG+Y+    N  G   +S  T    LD  +                                     P F KP+  + ++ GG +  L+ ++       + + WFK+G+ L    R+ I F  G A L+I  V   D G++ C A N  G   S+   L+V    + VTK
Sbjct: 4019 VKEPAKIIERAELIQV-TAGDPATLEYTV--SGTPELKPKWYKDGRPLVASKKYRISFKNNIAQLKFYSAELHDSGQYTFEISNEVG--SSSCETTFTVLDRDIA------------------------------------PLFTKPLRNVDSVVGG-ACRLDCKI--AGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGA-LIVQEPPSFVTK 4217          

HSP 6 Score: 77.7962 bits (190), Expect = 5.789e-14
Identity = 86/389 (22.11%), Postives = 147/389 (37.79%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFV+ P+   V   G   + T+  I  G P  TV W+K    L  G+R N S +     L++       SGEY+C+  N  G                                   AS  T     + + AP     FVK +   Y+++ G+ + LE   +   PI+     + W KNG  +    R NI      AIL+I+    ED+G Y C+  N +G+   +   L++                                               P+F   ++P+ +TV  G+ A    +++G P   + W+  +  + PT+  K++   +++ L F +         +  A+N +GE V+++T   + E    P   R
Sbjct: 7765 VREPPSFVQKPDPMDVLT-GSNVTFTS--IVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAG----------------------------------RASCTT----RLFVKAPA---IFVKRL-NDYSIEKGKPLILEGTFSGTPPIS-----VTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEP---------------------------------------------PYFVKQLEPVKVTV--GDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGE-VSSSTFLTVQEQKLPPSFSR 8055          

HSP 7 Score: 77.7962 bits (190), Expect = 6.039e-14
Identity = 91/389 (23.39%), Postives = 145/389 (37.28%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFVK PE  +V   G   + T+ +   G P   V W++    L  G+R N  FE   A L++       SGEY+CV  NN G    +  T  + + E                                      P  FVK +   ++++ G+S+ LE   T  +PI+     + W K+G  +    R NIV      IL+I+     D G Y C   N+AG+   +    LV+T E                                           P+F  +++P+  +V  G+      +V+G P   + WF  +  +  T   + Y   +++ L F +  I         A+N +G A A+ T+  I E    P   R
Sbjct: 5883 VQEPPSFVKEPEPLEVL-PGKNITFTSVI--RGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQ---ASCTTRLFVKE--------------------------------------PATFVKKLSD-HSVEPGKSIILEGTYTGTLPIS-----VTWKKDGVSITPSERCNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDA---LVSTLEP------------------------------------------PYFVTELEPLEASV--GDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTA-ASKTIFRIQERQLPPSFAR 6173          

HSP 8 Score: 77.7962 bits (190), Expect = 6.300e-14
Identity = 118/489 (24.13%), Postives = 176/489 (35.99%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWF------LNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP-------ENDFRPELKRTDPAI--------------LLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPSAVQLSN---YERGAPRSKEASDAENLYANVQSRLRRSDKLS 2203
            PPSF K         EG+   L  RV  AG   +TV WYK+ V +   S     F+    +L +      D+G Y+C A N+ G      S L                                 T  I I  P +PP F + +  +   + G SV L   V       + I+W K GR +    R +  F  G A+L++      D+GDY C A N AG   S+  +  V  +E                          VD   F             F  +P ++ V E   A F+ KV G P P ++W       LN+   I      ++  G  + LE +             A NK GE  +N  L V         E D R  LK+T PA+              LL+N +P  + K + +  +     L  AF   K S  + ++    E      ++  + E L A +Q RL +++ ++
Sbjct: 8242 PPSFTKKLSETVEETEGNSFKLEGRV--AGSQPITVAWYKNNVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAG------SALC--------------------------------TSSIVIKEPKKPPVFDQHLAPVTASE-GDSVQLSCHV--QGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAG---SDTSKCKVTIKEKPAAAPA--------------AKKAAVDGKLF-------------FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRI-----LIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKT-PALKKGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEELEKSERDEKEFEELVAFIQQRLTQTEPVT 8651          

HSP 9 Score: 73.9442 bits (180), Expect = 8.985e-13
Identity = 64/231 (27.71%), Postives = 98/231 (42.42%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVV 1516
            + +P + V+ PE   V   G+P +L   V  AG P L+ +W+KDG  L++GSR + +F R  A L I      D G Y+   +N  G    S  T++V++ + VV                                   PP FV+ +    +   G SV LE RV     + + + WF +G  + +  +    F      L +  +   DTG Y C A N AGQ +S+ V
Sbjct: 6635 VLEPATIVEKPEPMTVTT-GNPFTLECVV--AGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVG---KSSCTVSVHVSDRVV-----------------------------------PPSFVRRLKDT-SATLGASVVLECRV--SGSAPISVGWFLDGNEIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAV 6821          

HSP 10 Score: 72.4034 bits (176), Expect = 2.653e-12
Identity = 87/372 (23.39%), Postives = 133/372 (35.75%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHID--APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +PP FV   E  + A+ GD  SL  +V  AG P +TV W+K    L +   + T F    A L        DSGEY+C+A+N+ G   T+ S     + E       LP      +  IE ++  P T    ++  API+                                   + W+++G  L +     + F    A L I+      +G Y C A N  G A S     L A E         P++S                               P FDIKP+++ V  G  A F   V+G    ++ W  +   + P     +   G+  +L   +            A N +G+ + +A LSV
Sbjct: 6071 EPPYFVTELEPLE-ASVGDSVSLQCQV--AGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIG---TAASKTIFRIQE-----RQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQ-----------------------------------VCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTA--RLTARE---------PKKS-------------------------------PFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSV 6354          

HSP 11 Score: 71.633 bits (174), Expect = 5.221e-12
Identity = 85/374 (22.73%), Postives = 141/374 (37.70%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +V  PE  QV  E        G PA   A +  +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  V P+      + G+    + +V   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L A E  +        E +     ++++    + R                  I+P+ + +  G+ A+F  ++ G P  + QWF     +  +    + S   +S LE  R ++         A N+ G     ATL+V
Sbjct: 3238 YVNAPEPPQVLQELQPVTVQSGKPARFCAVI--SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIVTPLQDTVTSE-GRPARFQCQV---SGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEAPESIL-------HERIGQQIEMEMKAAPVIKRR-----------------IEPLEVAL--GHLAKFTCEIQGAPNVRFQWFKAGREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV 3551          

HSP 12 Score: 71.2478 bits (173), Expect = 5.446e-12
Identity = 59/225 (26.22%), Postives = 95/225 (42.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQF-VKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  ++ ++  + +      ++   G P + V WYKD V +   S+F  SFE   AIL++     EDSG+Y+C A+N  G   +S ++L V                                          PP F  KP P +  L+G   VHLE  +         + W K+ R L +G ++ I+ +     + I+ V + D G+Y C A N  G
Sbjct: 7295 VQEPPRFIKKLDQSRIVKQDEYTRYECKI--GGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSS-TSLKVK----------------------------------------EPPVFRKKPFP-VETLKGAD-VHLECEL--QGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVG 7472          

HSP 13 Score: 70.8626 bits (172), Expect = 7.969e-12
Identity = 57/234 (24.36%), Postives = 92/234 (39.32%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            + +PPSFVK  +   +   G+ A L  ++   G P + V W+K+   L+  +    SF    AILDI     +DSG YSC A N+ G D  S           VV+                                  PP F+K +     ++G  ++ L+  +         + WFK+ + + +  ++ +   + F  L+I    S D GDY C   N+ G+       LL
Sbjct: 3739 VREPPSFVKKVDPSYLMLPGESARLHCKL--KGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCS---------TEVVIK--------------------------------EPPSFIKTLEPADIVRGANAL-LQCEI--AGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLL 3926          

HSP 14 Score: 69.707 bits (169), Expect = 1.920e-11
Identity = 68/250 (27.20%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM-TESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+  V WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     + L ++  TE    +E+      +T  T++         P F+   P +  L  G SV  E ++    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   L  A  E +V   Q
Sbjct:  945 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFIS-KPVVQKLVEGGSVVFECQI--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYEALVKTQQ 1187          

HSP 15 Score: 69.707 bits (169), Expect = 2.003e-11
Identity = 94/437 (21.51%), Postives = 161/437 (36.84%), Query Frame = 2
Query:  779 SFRSSRSGS-VAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG-QAQSNVVRL-----LVATEETVVTKSQLPQE---SVQYLQSLDIQ---NTEDVDR--SNFRYXXXXXXXSLPHFDIKPIN-----------------------------------LTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            S  SS++G     +    +PP FVK  E  ++   GD A L  ++   G P + V WY++   L A  ++  +F    A++ +     EDSG++ C A+N  G   TS ST  V + E  V +S  P  + E++   E SL          +    PP                                 + W+K+ R L +  ++ +      A + I+ V S D G+Y C A+N+ G  A    V+L      ++   ++   +  P E   S++  Q + +Q     E+V R   N R        +L    ++P N                                   +TV  G       KV+G P   ++W+ +  L+  +   K      IS L+    +           +N +G++   A + V
Sbjct: 5397 SVDSSKTGQYTCQVTNDVEPPKFVKKLEASKIIKAGDSARLECKI--TGSPEIQVVWYRNEHELTASDKYQMTFIDSVAVIQMNSLGTEDSGDFICEAQNPAG--STSCST-KVIVKEPPVFSSFPP--IVETLKNTEVSL--------ECELSGTPP-------------------------------FEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDV 5787          

HSP 16 Score: 68.9366 bits (167), Expect = 2.833e-11
Identity = 57/232 (24.57%), Postives = 91/232 (39.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P + V+ PE  +V   GD  +L   V  +G P L+ +W+KDG  L + +++  SF    + L I+     DSG YS   +N  G D    S                                      I +   I PP F + +     L  G SV +E +V    PI+     + WF +G  +++G ++          L +  +   D GDY C A N AG  + +
Sbjct: 7576 VLEPAAIVEKPESIKVTT-GDTCTLECTV--SGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVVPGDSGVYSFEVQNPVGKDSCKVS--------------------------------------IQVSDRIIPPSFTRKLKETNGLS-GSSVVMECKVYGSPPIS-----VLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECS 7760          

HSP 17 Score: 68.1662 bits (165), Expect = 5.078e-11
Identity = 93/413 (22.52%), Postives = 151/413 (36.56%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPI-NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKV---YSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP 2011
            RSS   S+  LD I  PPSF K   + +  +    + +    I AG   +++QW+KD   ++A  +   SF    A L+I      DSG Y+C A N  G  Q S                HL      ++      +  P++QD++    ++          L  L GG +        P+T     I+WFK+ + L+ G   ++  D    IL++    + D+G Y C   N  G   S           T+  K                                      P F  KP   L +  G    F  +V+G P  ++ W+L+   +  T ++K    + DG ++  +    ++      V  A+N  G     A+ S+        ELK  +P I +R   P
Sbjct: 4665 RSSCKASINVLDLII-PPSFTK---KLRKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCS---------------GHL------TVKEPPYFVEKPQSQDVNPGTRVQ----------LKALVGGTA--------PMT-----IKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKA---------TIFVKEP------------------------------------PQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEI--TDLRKYGISFVDG-LATFQISNARVENSGTYVCEARNDAG----TASCSI--------ELKVKEPPIFIRELEP 4969          

HSP 18 Score: 65.4698 bits (158), Expect = 3.317e-10
Identity = 65/241 (26.97%), Postives = 89/241 (36.93%), Query Frame = 2
Query:  788 SSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            S+ SG+   L E  +PP F   P     A  G+ A L   V   G   + V W KD   + +G  +  S+    A L I+   K DSG+Y+C A N  G D     T  +N+ E ++                                   PP F K +        G S  LE RV    PIT     + W+KN   ++      I+F     +L +      D G Y C A N AG A
Sbjct: 8131 SASSGAKLILTEGKNPP-FFDIPLAPMDAVVGESADLECHV--TGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDS---CTAQLNIKERLI-----------------------------------PPSFTKKLSETVEETEGNSFKLEGRVAGSQPIT-----VAWYKNNVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAGSA 8325          

HSP 19 Score: 64.6994 bits (156), Expect = 6.578e-10
Identity = 66/262 (25.19%), Postives = 117/262 (44.66%), Query Frame = 2
Query: 1229 DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE----TVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            + P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +EE    T +T+ +   E  ++++S D+  T   D S    +      + P F  KP+   + EG    F  ++ G P+P + W  +    +P +    Y    +SY  +   C++          GE  IV+  +NK GE  A+A+L  + E D+   +K
Sbjct:  940 EVPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFDKETTLTE-KFATEEKRFVESRDVVMT---DTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECRLVISMTFADDAGEYTIVI--RNKHGETSASASL--LEEADYEALVK 1184          

HSP 20 Score: 64.3142 bits (155), Expect = 6.920e-10
Identity = 61/234 (26.07%), Postives = 89/234 (38.03%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            I +PP FVK  E  +V   GD ASL  ++  AG P + V WYK    L   +     F+   A L        DSGEY C A+N+ G  + S ST         V    LP   +  +  ++ ++  P   +  +                    G +         PI+     + W+K+G+PL +       F    A L+I       +G Y C A N  G A S    +L
Sbjct: 7951 ILEPPYFVKQLEPVKVTV-GDSASLQCQL--AGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVG--EVSSSTF------LTVQEQKLPPSFSRQLRDVQETVGLPVVFECAV-------------------SGSE---------PIS-----VSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATNPIGSASSGAKLIL 8140          

HSP 21 Score: 63.929 bits (154), Expect = 1.029e-9
Identity = 64/319 (20.06%), Postives = 109/319 (34.17%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQW 1771
            L  + +PP F++  E  + A  G+P +L  +V   G P + + WYK+   L +   +   F+   A L I      D GEY+C A+N+ G   +S           V+    LP      +  +  +L  P   +  I+                                     L + W+K+G  L +     + F    A L I+       G Y C A N  G A S+         + ++++ ++P                                  P FD+KP+++ +  G    F   V+G    +I W
Sbjct: 7007 LVSVLEPPYFIEPLEHVEAAI-GEPITLQCKV--DGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVL--------VIKERKLPPSFARKLKDVHETLGFPVAFECRING---------------------------------SEPLQVSWYKDGELLKDDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLGTASSSA--------KLILSEHEVP----------------------------------PFFDLKPVSVDLALGESGSFKCHVTGTAPIKITW 7239          

HSP 22 Score: 63.5438 bits (153), Expect = 1.240e-9
Identity = 81/376 (21.54%), Postives = 131/376 (34.84%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKN 1900
            + S  +  S +V  + E   PPSF +  +       G P +   R+   G   L V WYKDG  L   +    SF    A L IL T +   G+Y+C A N  G   T+ S+  + L E  V                                    P F    P   +L  G+S   +  V     + + I W K+ R +  G  + +      A L ++ V   D G Y C+A N AG+  S   +L V             QE  ++++ LD                                  V++    R+  K+ G P  ++ W+ +E  +  +S  ++  + S++ LE     +         A+N
Sbjct: 7089 ENSVGAVASSAVLVIKERKLPPSFARKLKDVH-ETLGFPVAFECRI--NGSEPLQVSWYKDGELLKDDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLG---TASSSAKLILSEHEV------------------------------------PPFFDLKPVSVDLALGESGSFKCHV--TGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVAKGDAGQYTCYASNVAGK-DSCSAQLGV-------------QEPPRFIKKLDQSR------------------------------IVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARN 7376          

HSP 23 Score: 63.1586 bits (152), Expect = 1.768e-9
Identity = 50/226 (22.12%), Postives = 83/226 (36.73%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +PP F+K P    V   G   +   +V   G P + V WY DG  +    ++  SF  G A   I     E+SG Y C A+N+ G   T+  ++ + + E                                      PP F++ +  +  ++    V LE  V+  T     + W KN + + +G ++ +        L I      D G+Y C   N+ G  
Sbjct: 4863 VKEPPQFIKKPSPVLVLRNGQSTTFECQV--TGTPEIRVSWYLDGNEITDLRKYGISFVDGLATFQISNARVENSGTYVCEARNDAG---TASCSIELKVKE--------------------------------------PPIFIRELEPVEVVK-DSDVELECEVMGTT--PFEVTWLKNNKEIRSGKKYTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSC 5042          

HSP 24 Score: 62.3882 bits (150), Expect = 3.141e-9
Identity = 51/225 (22.67%), Postives = 86/225 (38.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSV-HLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  +  +VA +G+   L  ++  +G P + V W+++   L    ++N SF    A+L I     ED+G+Y C A N  G D +  + L V                                          PP F +  P +  L+G   +   E    P       + W K+ + + +  +F I        L I  + + D G+Y C A N+ G
Sbjct: 6354 VKEPPKFIKKLDASKVAKQGESIQLECKI--SGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVG-DASCSTALKVKA----------------------------------------PPVFTQKPPPVGALKGSDVILQCEISGTP----PFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVG 6531          

HSP 25 Score: 62.3882 bits (150), Expect = 3.447e-9
Identity = 51/228 (22.37%), Postives = 86/228 (37.72%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +P +F++  E  Q+  +GD   L  +V   G P + + W+ +   L   S+   SF    A+L +     EDSGEY C A+N  G D  +           +V+    P   T+   +IE      K  D+ + A +   PP                                 I WFK+   L +G ++          L ++  ++ D G+Y C   N+ G +
Sbjct: 4301 VKEPATFIEKLEPSQLLKKGDGTQLACKV--TGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCT----------GIVIVKESPY-FTKEFKSIEVL----KEYDVMLLAEVAGTPP-------------------------------FEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSS 4480          

HSP 26 Score: 59.3066 bits (142), Expect = 2.596e-8
Identity = 66/244 (27.05%), Postives = 95/244 (38.93%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----------IEWFK-NGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            + E   PP F +H      A+EGD   L+  V   G   + +QW K G  +    R + SF  G A+L++  T K DSG+Y C A N  G D TS   + +                       E     P  +   +D              L+ +   QS+    RV+  T ++ +          ++W K   R LN G R  I      A L+I      D+G Y C A NK G+ +SNV
Sbjct: 8333 IKEPKKPPVFDQHLAPV-TASEGDSVQLSCHV--QGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSD-TSKCKVTIK----------------------EKPAAAPAAKKAAVDG------------KLFFVSEPQSI----RVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNV 8534          

HSP 27 Score: 59.3066 bits (142), Expect = 2.849e-8
Identity = 55/222 (24.77%), Postives = 87/222 (39.19%), Query Frame = 2
Query: 1334 DSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVY---SDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI-----PENDFRPELKR 1975
            D S  + W+   R L N  ++ I ++ G A + +  +   D G Y C   N  G+  S+   L V              + V+ +     + T+ V R   R +     E  P F +   N T   G   RF V ++ +P P++ W+ +   + P   +K Y   SD  +  L         ++   V A+NK GE    A L+V       E   RP  KR
Sbjct: 31638 DQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFDDGTYRCKVVNDYGE-DSSYAELFV--------------KGVREVYDYYCRRTKKVKR---RTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMFKR 31841          

HSP 28 Score: 54.6842 bits (130), Expect = 6.482e-7
Identity = 69/325 (21.23%), Postives = 120/325 (36.92%), Query Frame = 2
Query:  638 DTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFS--EPNMQQSFRSSRSGSVAHLDEITDPPSFV--------------------KHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER-GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEET 1543
            D  +  + +++ D  +   F   ++K ++++K  T+PPR    EP ++          V   + +T  P  V                    K  +  +     D A LT  V  +      V WYKDG  L     F   +   G   L I    + D GEY C      G  +TS      +  +S+        E T+S+     S    K++ I  ++    P  V    GL +         +  +    +    I W K+G+ +  G ++ +  ++   IL+I+   + D G Y C   N AG   S+    + A ++T
Sbjct: 32670 DEGNYSVVVENSDGKQEAQFTLTVQKARVIEKAVTSPPRVKSPEPRVKSPETVKSPKRVKSPEPVTSHPKAVSPTETKPTEKGQHLPVSAPPKITQSLKAEASKDIAKLTCAVESSALCAKEVAWYKDGKKLKENGHFQFHYSADGTYELKIHNLSESDCGEYVCEVSGEGGTSKTSFQFTGQSF-KSIHEQVSSISETTKSVQKTAESAEAKKSEPIAPESISSKPVIVT---GLRDTTVSSDSVAKFTIKVTGEPQPTITWTKDGKAIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTIKAVKDT 32990          

HSP 29 Score: 51.6026 bits (122), Expect = 5.579e-6
Identity = 56/253 (22.13%), Postives = 95/253 (37.55%), Query Frame = 2
Query:  776 QSFRSSRSGSVAHLDEIT--DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV-VRLL 1525
            Q   ++  GS A    +   +PPSF+K  E      +   +S T +   AG P +++ W KD   L      + SFE   A L +       SG Y+C AKN  G+++               L    P ++ E   +++ +   P                               V LE  V    +  L ++W K+G+ +     F++ F+   A   I  V+ +D+G Y     N  G +  +  +R+L
Sbjct: 5032 QCIIANEGGSCACSARVALKEPPSFIKKIENVTTVLK---SSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVATLQVRSVDNGHSGRYTCQAKNESGIERC-----------YAFLLVQEPAQIIEKAKSVDVTEKDP-------------------------------VTLECVVAGTPE--LKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVL 5237          

HSP 30 Score: 51.2174 bits (121), Expect = 7.067e-6
Identity = 49/214 (22.90%), Postives = 82/214 (38.32%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFC 1474
            PP+F+  P +      G  A     V  +G P + + W KDG  L+       +       L++     +D G YSC A N FG D           + +++   H  +E+     A+++++N                               + +HLE +V    D  + I W K+G+ L  G  + I F+   A L+I     +D+G Y C
Sbjct: 3556 PPTFLSRP-KALTTFVGKAAKFLCTV--SGTPVIEIIWQKDGAALSPSPDCRVTDADNKHSLELSNLTVQDRGIYSCKASNKFGADI-------CQAELTIIDKPHFIKEL----EAVQSAIN-------------------------------KKIHLECQV--DEDRKVTITWSKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYTC 3722          

HSP 31 Score: 50.8322 bits (120), Expect = 8.951e-6
Identity = 76/392 (19.39%), Postives = 150/392 (38.27%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQ-----------------TSPSTLN-----VNLDESVVLNSHL--PQEMTESIAAIEASLNTPKTQDIHIDAPIR-PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV---IEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSN---VVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            R    +EG+ A  +      G+P  TV W ++G  ++  +R   +  +  +  +I      D G YS V +N+ G  +                 TSP  +      V   E+V     +  P+ +T    A+  +   P  +  H+  P+  PP+  +      +L+   S  +      +  S+L    + W+K+G+ L     F   +   G   L I  +   D G+Y C    + G ++++     +   +  E V + S+  +   +  +S + + +E +   +          S P       + TV   + A+F +KV+G P+P I W  +   +   S  K+ S+     LE  + +         +  N  G   ++  L++
Sbjct: 32611 RSITVHEGESARFSCDT--DGEPVPTVTWLREGQVVSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSDGKQEAQFTLTVQKARVIEKAVTSPPRVKSPEPRVKSPETVKSPKRVKSPEPVTSHPKAVSPTETKPTEKGQHL--PVSAPPKITQ------SLKAEASKDIAKLTCAVESSALCAKEVAWYKDGKKLKENGHFQFHYSADGTYELKIHNLSESDCGEYVCEVSGEGGTSKTSFQFTGQSFKSIHEQVSSISETTKSVQKTAESAEAKKSEPIAPESI--------SSKPVIVTGLRDTTVSSDSVAKFTIKVTGEPQPTITWTKDGKAIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTI 32984          
BLAST of Titin vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 118.242 bits (295), Expect = 2.538e-26
Identity = 105/401 (26.18%), Postives = 173/401 (43.14%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGS--RFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-----------------LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P+FV   E+ +  N  + + L  +V   G+PN  + W K+   +      R      RG A L I     +DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+    R  Q       LY+                 L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP  ++ +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1562 PAFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTR---CKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHL----RYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPDGKKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRR 1947          

HSP 2 Score: 86.2705 bits (212), Expect = 1.676e-16
Identity = 79/301 (26.25%), Postives = 120/301 (39.87%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS-----------------PSTLNVNLDESVVLNSHL----PQEMTESI----------AAIEASLNTPK------------------TQDIHID------APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + S  ++ S ++  + E   PPSF +  +  +    G P +LT R+   G   + V WY+DGV L        SF    A L IL T    SG+YSC A N  G   ++                 P +++V   ES     H+    P  +T S             I    NTP                   T D+  D      +   PP+F+K +      + G+S+ LE ++    +  +V  WF+N   L+   ++N+ F    A+L I    +EDTGDY C A N  G A  +
Sbjct: 6148 ENSIGTAASKTIFRIQERQLPPSFARQLKDIE-QTVGLPVTLTCRL--NGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVV--WFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCS 6443          

HSP 3 Score: 83.5741 bits (205), Expect = 1.167e-15
Identity = 83/376 (22.07%), Postives = 144/376 (38.30%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRN 2002
             +GDPA+L  +   +G   ++ +W+KDG  L  G ++  S     +IL I+ T K+DSGEY+   +N+ G                               ++ +AS+N        +D  I PP F K +  + +++G     ++   I      + I+WFK+ + ++   +    F    A L+I  +   D+G Y C A NKAG +Q +                            L ++                     P+F  KP +  V  G   +    V G     I+WF +   + P + + V+ D + + LE    K       +    N +G   + AT+ V     F   +K+  P ++LRN
Sbjct: 4597 TQGDPATLQVKF--SGTKEISAKWFKDGQELTLGPKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGR------------------------------SSCKASINV-------LDL-IIPPSFTKKLRKMDSIKGS---FIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCS--------------------------GHLTVKEP-------------------PYFVEKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIFVKEPPQF---IKKPSPVLVLRN 4881          

HSP 4 Score: 80.4925 bits (197), Expect = 7.982e-15
Identity = 90/343 (26.24%), Postives = 142/343 (41.40%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQ-AQSNVVRL------LVATEE-------TVVTKSQL---PQESVQYLQ-----------------SLDIQNTEDVDRSNF-RYXXXXXXXSLPHFDIKPINLT--VEEGNPARFLVKVSGYPRPQIQWFLNE 1783
             E DP +L   V  AG P L V+W KDG  +     F+ SFE   A   I    K+DSG+Y+   +N+FG   +  + L V LD                             QDI       PP F K +  +  +  G S+H+E +V   +PI+      +WFK+G+ ++   ++ +V       L++  +  EDT +Y C   N AG  A S ++ +      LV  E        TV  K+ L   P   +++L+                 S    N   VD S   +Y  +  N+  P   +K +  +  ++ G+ AR   K++G P  Q+ W+ NE
Sbjct: 5159 TEKDPVTLECVV--AGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFG-SSSCDAYLRV-LD-----------------------------QDI-------PPSFTKKLTKMDKVL-GSSIHMECKVSGSLPIS-----AQWFKDGKEISTSAKYRLVCHENTVSLEVSNLELEDTANYTCKVSNVAGDNACSGILTVKEPPSFLVKPERQQAIPDSTVEFKAVLKGTPPFKIKWLKDDVELVSGPKCFIGLEGSTSFLNLYSVDSSKTGQYTCQVTNDVEPPKFVKKLEASKIIKAGDSARLECKITGSPEIQVVWYRNE 5455          

HSP 5 Score: 80.1073 bits (196), Expect = 1.272e-14
Identity = 67/244 (27.46%), Postives = 100/244 (40.98%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            + +P   ++  E  QV   GDPA+L   V  +G P L  +WYKDG PL A  ++  SF+   A L        DSG+Y+    N  G   +S  T    LD  +                                     P F KP+  + ++ GG +  L+ ++       + + WFK+G+ L    R+ I F  G A L+I  V   D G++ C A N  G   S+   L+V    + VTK
Sbjct: 4019 VKEPAKIIERAELIQV-TAGDPATLEYTV--SGTPELKPKWYKDGRPLVASKKYRISFKNNIAQLKFYSAELHDSGQYTFEISNEVG--SSSCETTFTVLDRDIA------------------------------------PLFTKPLRNVDSVVGG-ACRLDCKI--AGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGA-LIVQEPPSFVTK 4217          

HSP 6 Score: 77.7962 bits (190), Expect = 5.789e-14
Identity = 86/389 (22.11%), Postives = 147/389 (37.79%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFV+ P+   V   G   + T+  I  G P  TV W+K    L  G+R N S +     L++       SGEY+C+  N  G                                   AS  T     + + AP     FVK +   Y+++ G+ + LE   +   PI+     + W KNG  +    R NI      AIL+I+    ED+G Y C+  N +G+   +   L++                                               P+F   ++P+ +TV  G+ A    +++G P   + W+  +  + PT+  K++   +++ L F +         +  A+N +GE V+++T   + E    P   R
Sbjct: 7765 VREPPSFVQKPDPMDVLT-GSNVTFTS--IVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAG----------------------------------RASCTT----RLFVKAPA---IFVKRL-NDYSIEKGKPLILEGTFSGTPPIS-----VTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEP---------------------------------------------PYFVKQLEPVKVTV--GDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGE-VSSSTFLTVQEQKLPPSFSR 8055          

HSP 7 Score: 77.7962 bits (190), Expect = 6.039e-14
Identity = 91/389 (23.39%), Postives = 145/389 (37.28%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFVK PE  +V   G   + T+ +   G P   V W++    L  G+R N  FE   A L++       SGEY+CV  NN G    +  T  + + E                                      P  FVK +   ++++ G+S+ LE   T  +PI+     + W K+G  +    R NIV      IL+I+     D G Y C   N+AG+   +    LV+T E                                           P+F  +++P+  +V  G+      +V+G P   + WF  +  +  T   + Y   +++ L F +  I         A+N +G A A+ T+  I E    P   R
Sbjct: 5883 VQEPPSFVKEPEPLEVL-PGKNITFTSVI--RGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQ---ASCTTRLFVKE--------------------------------------PATFVKKLSD-HSVEPGKSIILEGTYTGTLPIS-----VTWKKDGVSITPSERCNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDA---LVSTLEP------------------------------------------PYFVTELEPLEASV--GDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTA-ASKTIFRIQERQLPPSFAR 6173          

HSP 8 Score: 77.7962 bits (190), Expect = 6.247e-14
Identity = 118/489 (24.13%), Postives = 176/489 (35.99%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWF------LNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP-------ENDFRPELKRTDPAI--------------LLRNENP--FRKLSTLKKVAVSPELQNAFRKTKPSAVQLSN---YERGAPRSKEASDAENLYANVQSRLRRSDKLS 2203
            PPSF K         EG+   L  RV  AG   +TV WYK+ V +   S     F+    +L +      D+G Y+C A N+ G      S L                                 T  I I  P +PP F + +  +   + G SV L   V       + I+W K GR +    R +  F  G A+L++      D+GDY C A N AG   S+  +  V  +E                          VD   F             F  +P ++ V E   A F+ KV G P P ++W       LN+   I      ++  G  + LE +             A NK GE  +N  L V         E D R  LK+T PA+              LL+N +P  + K + +  +     L  AF   K S  + ++    E      ++  + E L A +Q RL +++ ++
Sbjct: 8242 PPSFTKKLSETVEETEGNSFKLEGRV--AGSQPITVAWYKNNVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAG------SALC--------------------------------TSSIVIKEPKKPPVFDQHLAPVTASE-GDSVQLSCHV--QGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAG---SDTSKCKVTIKEKPAAAPA--------------AKKAAVDGKLF-------------FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRI-----LIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKKT-PALKKGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEELEKSERDEKEFEELVAFIQQRLTQTEPVT 8651          

HSP 9 Score: 73.9442 bits (180), Expect = 8.985e-13
Identity = 64/231 (27.71%), Postives = 98/231 (42.42%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVV 1516
            + +P + V+ PE   V   G+P +L   V  AG P L+ +W+KDG  L++GSR + +F R  A L I      D G Y+   +N  G    S  T++V++ + VV                                   PP FV+ +    +   G SV LE RV     + + + WF +G  + +  +    F      L +  +   DTG Y C A N AGQ +S+ V
Sbjct: 6635 VLEPATIVEKPEPMTVTT-GNPFTLECVV--AGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVG---KSSCTVSVHVSDRVV-----------------------------------PPSFVRRLKDT-SATLGASVVLECRV--SGSAPISVGWFLDGNEIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAV 6821          

HSP 10 Score: 72.4034 bits (176), Expect = 2.609e-12
Identity = 87/372 (23.39%), Postives = 133/372 (35.75%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHID--APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +PP FV   E  + A+ GD  SL  +V  AG P +TV W+K    L +   + T F    A L        DSGEY+C+A+N+ G   T+ S     + E       LP      +  IE ++  P T    ++  API+                                   + W+++G  L +     + F    A L I+      +G Y C A N  G A S     L A E         P++S                               P FDIKP+++ V  G  A F   V+G    ++ W  +   + P     +   G+  +L   +            A N +G+ + +A LSV
Sbjct: 6071 EPPYFVTELEPLE-ASVGDSVSLQCQV--AGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIG---TAASKTIFRIQE-----RQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQ-----------------------------------VCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTA--RLTARE---------PKKS-------------------------------PFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSV 6354          

HSP 11 Score: 71.633 bits (174), Expect = 5.133e-12
Identity = 85/374 (22.73%), Postives = 141/374 (37.70%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +V  PE  QV  E        G PA   A +  +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  V P+      + G+    + +V   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L A E  +        E +     ++++    + R                  I+P+ + +  G+ A+F  ++ G P  + QWF     +  +    + S   +S LE  R ++         A N+ G     ATL+V
Sbjct: 3238 YVNAPEPPQVLQELQPVTVQSGKPARFCAVI--SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIVTPLQDTVTSE-GRPARFQCQV---SGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEAPESIL-------HERIGQQIEMEMKAAPVIKRR-----------------IEPLEVAL--GHLAKFTCEIQGAPNVRFQWFKAGREIYESDKCSIRSSNYVSSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV 3551          

HSP 12 Score: 71.2478 bits (173), Expect = 5.400e-12
Identity = 59/225 (26.22%), Postives = 95/225 (42.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQF-VKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  ++ ++  + +      ++   G P + V WYKD V +   S+F  SFE   AIL++     EDSG+Y+C A+N  G   +S ++L V                                          PP F  KP P +  L+G   VHLE  +         + W K+ R L +G ++ I+ +     + I+ V + D G+Y C A N  G
Sbjct: 7295 VQEPPRFIKKLDQSRIVKQDEYTRYECKI--GGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSS-TSLKVK----------------------------------------EPPVFRKKPFP-VETLKGAD-VHLECEL--QGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVG 7472          

HSP 13 Score: 70.8626 bits (172), Expect = 7.969e-12
Identity = 57/234 (24.36%), Postives = 92/234 (39.32%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            + +PPSFVK  +   +   G+ A L  ++   G P + V W+K+   L+  +    SF    AILDI     +DSG YSC A N+ G D  S           VV+                                  PP F+K +     ++G  ++ L+  +         + WFK+ + + +  ++ +   + F  L+I    S D GDY C   N+ G+       LL
Sbjct: 3739 VREPPSFVKKVDPSYLMLPGESARLHCKL--KGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCS---------TEVVIK--------------------------------EPPSFIKTLEPADIVRGANAL-LQCEI--AGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLL 3926          

HSP 14 Score: 69.707 bits (169), Expect = 1.904e-11
Identity = 68/250 (27.20%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM-TESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+  V WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     + L ++  TE    +E+      +T  T++         P F+   P +  L  G SV  E ++    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   L  A  E +V   Q
Sbjct:  945 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFIS-KPVVQKLVEGGSVVFECQI--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYEALVKTQQ 1187          

HSP 15 Score: 69.707 bits (169), Expect = 1.970e-11
Identity = 94/437 (21.51%), Postives = 161/437 (36.84%), Query Frame = 2
Query:  779 SFRSSRSGS-VAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG-QAQSNVVRL-----LVATEETVVTKSQLPQE---SVQYLQSLDIQ---NTEDVDR--SNFRYXXXXXXXSLPHFDIKPIN-----------------------------------LTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            S  SS++G     +    +PP FVK  E  ++   GD A L  ++   G P + V WY++   L A  ++  +F    A++ +     EDSG++ C A+N  G   TS ST  V + E  V +S  P  + E++   E SL          +    PP                                 + W+K+ R L +  ++ +      A + I+ V S D G+Y C A+N+ G  A    V+L      ++   ++   +  P E   S++  Q + +Q     E+V R   N R        +L    ++P N                                   +TV  G       KV+G P   ++W+ +  L+  +   K      IS L+    +           +N +G++   A + V
Sbjct: 5397 SVDSSKTGQYTCQVTNDVEPPKFVKKLEASKIIKAGDSARLECKI--TGSPEIQVVWYRNEHELTASDKYQMTFIDSVAVIQMNSLGTEDSGDFICEAQNPAG--STSCST-KVIVKEPPVFSSFPP--IVETLKNTEVSL--------ECELSGTPP-------------------------------FEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDV 5787          

HSP 16 Score: 68.9366 bits (167), Expect = 2.833e-11
Identity = 57/232 (24.57%), Postives = 91/232 (39.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P + V+ PE  +V   GD  +L   V  +G P L+ +W+KDG  L + +++  SF    + L I+     DSG YS   +N  G D    S                                      I +   I PP F + +     L  G SV +E +V    PI+     + WF +G  +++G ++          L +  +   D GDY C A N AG  + +
Sbjct: 7576 VLEPAAIVEKPESIKVTT-GDTCTLECTV--SGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVVPGDSGVYSFEVQNPVGKDSCKVS--------------------------------------IQVSDRIIPPSFTRKLKETNGLS-GSSVVMECKVYGSPPIS-----VLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECS 7760          

HSP 17 Score: 68.1662 bits (165), Expect = 5.078e-11
Identity = 93/413 (22.52%), Postives = 151/413 (36.56%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPI-NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKV---YSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP 2011
            RSS   S+  LD I  PPSF K   + +  +    + +    I AG   +++QW+KD   ++A  +   SF    A L+I      DSG Y+C A N  G  Q S                HL      ++      +  P++QD++    ++          L  L GG +        P+T     I+WFK+ + L+ G   ++  D    IL++    + D+G Y C   N  G   S           T+  K                                      P F  KP   L +  G    F  +V+G P  ++ W+L+   +  T ++K    + DG ++  +    ++      V  A+N  G     A+ S+        ELK  +P I +R   P
Sbjct: 4665 RSSCKASINVLDLII-PPSFTK---KLRKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCS---------------GHL------TVKEPPYFVEKPQSQDVNPGTRVQ----------LKALVGGTA--------PMT-----IKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKA---------TIFVKEP------------------------------------PQFIKKPSPVLVLRNGQSTTFECQVTGTPEIRVSWYLDGNEI--TDLRKYGISFVDG-LATFQISNARVENSGTYVCEARNDAG----TASCSI--------ELKVKEPPIFIRELEP 4969          

HSP 18 Score: 65.4698 bits (158), Expect = 3.345e-10
Identity = 65/241 (26.97%), Postives = 89/241 (36.93%), Query Frame = 2
Query:  788 SSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            S+ SG+   L E  +PP F   P     A  G+ A L   V   G   + V W KD   + +G  +  S+    A L I+   K DSG+Y+C A N  G D     T  +N+ E ++                                   PP F K +        G S  LE RV    PIT     + W+KN   ++      I+F     +L +      D G Y C A N AG A
Sbjct: 8131 SASSGAKLILTEGKNPP-FFDIPLAPMDAVVGESADLECHV--TGTQPIKVTWAKDNREIRSGGNYQISYLENSAHLTIVKVDKGDSGQYTCYAVNEVGKDS---CTAQLNIKERLI-----------------------------------PPSFTKKLSETVEETEGNSFKLEGRVAGSQPIT-----VAWYKNNVEIHPTSNCEIMFKNNALLLQVKRASMADAGLYTCKATNDAGSA 8325          

HSP 19 Score: 64.6994 bits (156), Expect = 6.578e-10
Identity = 66/262 (25.19%), Postives = 117/262 (44.66%), Query Frame = 2
Query: 1229 DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE----TVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            + P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +EE    T +T+ +   E  ++++S D+  T   D S    +      + P F  KP+   + EG    F  ++ G P+P + W  +    +P +    Y    +SY  +   C++          GE  IV+  +NK GE  A+A+L  + E D+   +K
Sbjct:  940 EVPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFDKETTLTE-KFATEEKRFVESRDVVMT---DTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECRLVISMTFADDAGEYTIVI--RNKHGETSASASL--LEEADYEALVK 1184          

HSP 20 Score: 64.3142 bits (155), Expect = 6.862e-10
Identity = 61/234 (26.07%), Postives = 89/234 (38.03%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            I +PP FVK  E  +V   GD ASL  ++  AG P + V WYK    L   +     F+   A L        DSGEY C A+N+ G  + S ST         V    LP   +  +  ++ ++  P   +  +                    G +         PI+     + W+K+G+PL +       F    A L+I       +G Y C A N  G A S    +L
Sbjct: 7951 ILEPPYFVKQLEPVKVTV-GDSASLQCQL--AGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVG--EVSSSTF------LTVQEQKLPPSFSRQLRDVQETVGLPVVFECAV-------------------SGSE---------PIS-----VSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATNPIGSASSGAKLIL 8140          

HSP 21 Score: 63.929 bits (154), Expect = 1.012e-9
Identity = 64/319 (20.06%), Postives = 109/319 (34.17%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQW 1771
            L  + +PP F++  E  + A  G+P +L  +V   G P + + WYK+   L +   +   F+   A L I      D GEY+C A+N+ G   +S           V+    LP      +  +  +L  P   +  I+                                     L + W+K+G  L +     + F    A L I+       G Y C A N  G A S+         + ++++ ++P                                  P FD+KP+++ +  G    F   V+G    +I W
Sbjct: 7007 LVSVLEPPYFIEPLEHVEAAI-GEPITLQCKV--DGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYTCKAENSVGAVASSAVL--------VIKERKLPPSFARKLKDVHETLGFPVAFECRING---------------------------------SEPLQVSWYKDGELLKDDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLGTASSSA--------KLILSEHEVP----------------------------------PFFDLKPVSVDLALGESGSFKCHVTGTAPIKITW 7239          

HSP 22 Score: 63.5438 bits (153), Expect = 1.209e-9
Identity = 81/376 (21.54%), Postives = 131/376 (34.84%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKN 1900
            + S  +  S +V  + E   PPSF +  +       G P +   R+   G   L V WYKDG  L   +    SF    A L IL T +   G+Y+C A N  G   T+ S+  + L E  V                                    P F    P   +L  G+S   +  V     + + I W K+ R +  G  + +      A L ++ V   D G Y C+A N AG+  S   +L V             QE  ++++ LD                                  V++    R+  K+ G P  ++ W+ +E  +  +S  ++  + S++ LE     +         A+N
Sbjct: 7089 ENSVGAVASSAVLVIKERKLPPSFARKLKDVH-ETLGFPVAFECRI--NGSEPLQVSWYKDGELLKDDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLG---TASSSAKLILSEHEV------------------------------------PPFFDLKPVSVDLALGESGSFKCHV--TGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVAKGDAGQYTCYASNVAGK-DSCSAQLGV-------------QEPPRFIKKLDQSR------------------------------IVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARN 7376          

HSP 23 Score: 63.1586 bits (152), Expect = 1.768e-9
Identity = 50/226 (22.12%), Postives = 83/226 (36.73%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +PP F+K P    V   G   +   +V   G P + V WY DG  +    ++  SF  G A   I     E+SG Y C A+N+ G   T+  ++ + + E                                      PP F++ +  +  ++    V LE  V+  T     + W KN + + +G ++ +        L I      D G+Y C   N+ G  
Sbjct: 4863 VKEPPQFIKKPSPVLVLRNGQSTTFECQV--TGTPEIRVSWYLDGNEITDLRKYGISFVDGLATFQISNARVENSGTYVCEARNDAG---TASCSIELKVKE--------------------------------------PPIFIRELEPVEVVK-DSDVELECEVMGTT--PFEVTWLKNNKEIRSGKKYTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSC 5042          

HSP 24 Score: 62.3882 bits (150), Expect = 3.114e-9
Identity = 51/225 (22.67%), Postives = 86/225 (38.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSV-HLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  +  +VA +G+   L  ++  +G P + V W+++   L    ++N SF    A+L I     ED+G+Y C A N  G D +  + L V                                          PP F +  P +  L+G   +   E    P       + W K+ + + +  +F I        L I  + + D G+Y C A N+ G
Sbjct: 6354 VKEPPKFIKKLDASKVAKQGESIQLECKI--SGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVG-DASCSTALKVKA----------------------------------------PPVFTQKPPPVGALKGSDVILQCEISGTP----PFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVG 6531          

HSP 25 Score: 62.3882 bits (150), Expect = 3.418e-9
Identity = 51/228 (22.37%), Postives = 86/228 (37.72%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +P +F++  E  Q+  +GD   L  +V   G P + + W+ +   L   S+   SF    A+L +     EDSGEY C A+N  G D  +           +V+    P   T+   +IE      K  D+ + A +   PP                                 I WFK+   L +G ++          L ++  ++ D G+Y C   N+ G +
Sbjct: 4301 VKEPATFIEKLEPSQLLKKGDGTQLACKV--TGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCT----------GIVIVKESPY-FTKEFKSIEVL----KEYDVMLLAEVAGTPP-------------------------------FEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSS 4480          

HSP 26 Score: 59.3066 bits (142), Expect = 2.574e-8
Identity = 66/244 (27.05%), Postives = 95/244 (38.93%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----------IEWFK-NGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            + E   PP F +H      A+EGD   L+  V   G   + +QW K G  +    R + SF  G A+L++  T K DSG+Y C A N  G D TS   + +                       E     P  +   +D              L+ +   QS+    RV+  T ++ +          ++W K   R LN G R  I      A L+I      D+G Y C A NK G+ +SNV
Sbjct: 8333 IKEPKKPPVFDQHLAPV-TASEGDSVQLSCHV--QGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSD-TSKCKVTIK----------------------EKPAAAPAAKKAAVDG------------KLFFVSEPQSI----RVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNV 8534          

HSP 27 Score: 59.3066 bits (142), Expect = 2.825e-8
Identity = 55/222 (24.77%), Postives = 87/222 (39.19%), Query Frame = 2
Query: 1334 DSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVY---SDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI-----PENDFRPELKR 1975
            D S  + W+   R L N  ++ I ++ G A + +  +   D G Y C   N  G+  S+   L V              + V+ +     + T+ V R   R +     E  P F +   N T   G   RF V ++ +P P++ W+ +   + P   +K Y   SD  +  L         ++   V A+NK GE    A L+V       E   RP  KR
Sbjct: 31638 DQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFDDGTYRCKVVNDYGE-DSSYAELFV--------------KGVREVYDYYCRRTKKVKR---RTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMFKR 31841          

HSP 28 Score: 53.9138 bits (128), Expect = 1.221e-6
Identity = 69/325 (21.23%), Postives = 119/325 (36.62%), Query Frame = 2
Query:  638 DTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFS--EPNMQQSFRSSRSGSVAHLDEITDPPSFV--------------------KHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER-GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEET 1543
            D  +  + +++ D  +   F   ++K ++++K  T+PPR    EP ++          V   + +T  P  V                    K  +  +     D A LT  V  +      V WYKDG  L     F   +   G   L I    + D GEY C      G  +TS      +  +S+        E T+S+     S    K + I  ++    P  V    GL +         +  +    +    I W K+G+ +  G ++ +  ++   IL+I+   + D G Y C   N AG   S+    + A ++T
Sbjct: 32670 DEGNYSVVVENSDGKQEAQFTLTVQKARVIEKAVTSPPRVKSPEPRVKSPETVKSPKRVKSPEPVTSHPKAVSPTETKPTEKGQHLPVSAPPKITQSLKAEASKDIAKLTCAVESSALCAKEVAWYKDGKKLKENGHFQFHYSADGTYELKIHNLSESDCGEYVCEVSGEGGTSKTSFQFTGQSF-KSIHEQVSSISETTKSVQKTAESAEAKKQEPIAPESISSKPVIVT---GLRDTTVSSDSVAKFTIKVTGEPQPTITWTKDGKAIAQGSKYKLSSNKEEFILEILKTETSDGGLYACTVTNSAGSVSSSCKLTIKAVKDT 32990          

HSP 29 Score: 51.6026 bits (122), Expect = 5.579e-6
Identity = 56/253 (22.13%), Postives = 95/253 (37.55%), Query Frame = 2
Query:  776 QSFRSSRSGSVAHLDEIT--DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV-VRLL 1525
            Q   ++  GS A    +   +PPSF+K  E      +   +S T +   AG P +++ W KD   L      + SFE   A L +       SG Y+C AKN  G+++               L    P ++ E   +++ +   P                               V LE  V    +  L ++W K+G+ +     F++ F+   A   I  V+ +D+G Y     N  G +  +  +R+L
Sbjct: 5032 QCIIANEGGSCACSARVALKEPPSFIKKIENVTTVLK---SSATFQSTVAGSPPISITWLKDDQILEENDNVHISFEDSVATLQVRSVDNGHSGRYTCQAKNESGIERC-----------YAFLLVQEPAQIIEKAKSVDVTEKDP-------------------------------VTLECVVAGTPE--LKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVL 5237          

HSP 30 Score: 51.2174 bits (121), Expect = 7.067e-6
Identity = 49/214 (22.90%), Postives = 82/214 (38.32%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFC 1474
            PP+F+  P +      G  A     V  +G P + + W KDG  L+       +       L++     +D G YSC A N FG D           + +++   H  +E+     A+++++N                               + +HLE +V    D  + I W K+G+ L  G  + I F+   A L+I     +D+G Y C
Sbjct: 3556 PPTFLSRP-KALTTFVGKAAKFLCTV--SGTPVIEIIWQKDGAALSPSPDCRVTDADNKHSLELSNLTVQDRGIYSCKASNKFGADI-------CQAELTIIDKPHFIKEL----EAVQSAIN-------------------------------KKIHLECQV--DEDRKVTITWSKDGQKLPAGKDYKIYFEDKIASLEIPLAKLKDSGTYTC 3722          
BLAST of Titin vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 118.242 bits (295), Expect = 2.595e-26
Identity = 105/401 (26.18%), Postives = 173/401 (43.14%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGS--RFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-----------------LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P+FV   E+ +  N  + + L  +V   G+PN  + W K+   +      R      RG A L I     +DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+    R  Q       LY+                 L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP  ++ +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1516 PAFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTR---CKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHL----RYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPDGKKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRR 1901          

HSP 2 Score: 87.8113 bits (216), Expect = 5.366e-17
Identity = 102/421 (24.23%), Postives = 163/421 (38.72%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK--SQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL-------------------PHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP 2011
            +V  PE  QV  E        G PA   A +  +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  V P+      + G+    + +V   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L A E  +  +   Q+  E  +    L  +       S+ R     E   L                   P F  +I  + ++VE  + A+  V V+G P+P+IQWF N  L+ P++  K   DG    L     +   E      A N+ G+AV +A L + P  +   E++  +   L + + P
Sbjct: 3192 YVNAPEPPQVLQELQPVTVQSGKPARFCAVI--SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIVTPLQDTVTSE-GRPARFQCQV---SGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEAPESILHERIGQQIEMEMKEIASLLSAEEDFQTYSSDLRLPNANETLELLSEPPARSTQFDSRQEGAAPVFIREISDVEISVE--DVAKLSVTVTGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEGEYTCLASNEYGKAVCSAHLRISPRGERSTEMESGEKKALEKPKGP 3576          

HSP 3 Score: 69.3218 bits (168), Expect = 2.176e-11
Identity = 68/250 (27.20%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM-TESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+  V WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     + L ++  TE    +E+      +T  T++         P F+   P +  L  G SV  E ++    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   L  A  E +V   Q
Sbjct:  899 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFIS-KPVVQKLVEGGSVVFECQI--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYEALVKTQQ 1141          

HSP 4 Score: 64.6994 bits (156), Expect = 6.241e-10
Identity = 66/262 (25.19%), Postives = 117/262 (44.66%), Query Frame = 2
Query: 1229 DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE----TVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            + P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +EE    T +T+ +   E  ++++S D+  T   D S    +      + P F  KP+   + EG    F  ++ G P+P + W  +    +P +    Y    +SY  +   C++          GE  IV+  +NK GE  A+A+L  + E D+   +K
Sbjct:  894 EVPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFDKETTLTE-KFATEEKRFVESRDVVMT---DTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECRLVISMTFADDAGEYTIVI--RNKHGETSASASL--LEEADYEALVK 1138          

HSP 5 Score: 59.6918 bits (143), Expect = 1.848e-8
Identity = 66/258 (25.58%), Postives = 106/258 (41.09%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHL-----PQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQG-----GQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQES 1576
            P F++     +++ E D A L+  V   G P   +QW+ +G+ L   + +   F+     L IL+T  +D GEY+C+A N +G                 V ++HL      +  TE  +  + +L  PK        P  PP F K +  ++   G       SVH E         +  + WFK   PL     + I+    G     +      D+G Y C A+N  G++ +    LLV  E+T V  +   +ES
Sbjct: 3463 PVFIREISDVEISVE-DVAKLSVTV--TGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEGEYTCLASNEYG---------------KAVCSAHLRISPRGERSTEMESGEKKALEKPK-------GPC-PPYFFKELKPVHCGPGIPAVFEYSVHGE--------PAPTVLWFKEDMPLYTSVCYTIIHSPDGSGTFIVNDPQRGDSGLYLCKAQNLWGES-TCAAELLVLPEDTDVPDASCKEES 3685          

HSP 6 Score: 59.3066 bits (142), Expect = 2.402e-8
Identity = 55/222 (24.77%), Postives = 87/222 (39.19%), Query Frame = 2
Query: 1334 DSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVY---SDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI-----PENDFRPELKR 1975
            D S  + W+   R L N  ++ I ++ G A + +  +   D G Y C   N  G+  S+   L V              + V+ +     + T+ V R   R +     E  P F +   N T   G   RF V ++ +P P++ W+ +   + P   +K Y   SD  +  L         ++   V A+NK GE    A L+V       E   RP  KR
Sbjct: 25057 DQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFDDGTYRCKVVNDYGE-DSSYAELFV--------------KGVREVYDYYCRRTKKVKR---RTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMFKR 25260          
BLAST of Titin vs. UniProt/SwissProt
Match: sp|Q9I7U4|TITIN_DROME (Titin OS=Drosophila melanogaster OX=7227 GN=sls PE=1 SV=3)

HSP 1 Score: 199.134 bits (505), Expect = 4.610e-51
Identity = 130/404 (32.18%), Postives = 215/404 (53.22%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK-TQDIHIDA-----PIR--PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLD-IQNTE--------DVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE-NDFRPELK 1972
            ++E+  PP F        V +E +      +V P  DP+L V+WY++G PL +G R+   F+ GF  LDILY + EDSGEY C A NN+G D+T  +T++     +++L + +P+ M  S A  +      K T ++H+       P R  PP+FV  +     L        E ++ P+ D ++ +EWF NG+PL +  RF  ++D G+  ++   V  ED+G+Y C A N  G+ ++  + + V+ +  +V  SQLP     ++QS+D I+  E        +VD        + +  + P F  K    TVEEG+PARF V+V+G+PRP++ W +N   V+  S  K+ +DG + +L+  + +      + V A+N +GE++A   L V+   +D+R  LK
Sbjct: 3804 VEEVFGPPKFTTQITSVTV-DEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRTR-ATVSCKKLPTILLQNQVPRGMKRSDALTQMEATIKKYTSEVHLTEDDLFDPDRKQPPRFVTQIKEQLTLTEMAVTKFECQLAPVGDPNMKVEWFFNGKPLLHKNRFQPIYDFGYVAMNFGWVYPEDSGEYVCRATNLYGKDETRAI-IKVSGKPGIVYDSQLP----AHMQSIDRIREMEASWQVVPDEVD-------PDAKPRTKPVFVSKLEPQTVEEGDPARFCVRVTGHPRPRVMWLINGHTVVHGSRYKLTNDG-MFHLDVPKTRQYDTGKVEVIARNSVGESIATTELKVVARSDDYRNVLK 4192          

HSP 2 Score: 182.57 bits (462), Expect = 9.549e-46
Identity = 120/383 (31.33%), Postives = 184/383 (48.04%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT---ESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ------ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PP F+          EG  A   AR+ P  DP+L V+WY +G  L  G RF T  + G  ILDILY ++E+SG Y   A+N +G D T  S L      S++L+S LP+ M    E IA +E S+     ++   +   + P F  P+  + NL+ G++ H E R+ P  D  L +EW+ NGRPL  G RF    D GF IL+I  V  ED+G+Y C A N+ G+A +    + +  + +++ +SQLP+      + +  L+ L  ++TE        +  +++    P F   P ++ + E   A F  ++     P  ++ WF N   +   S  K  +D     LE   C           A NK GEA  +  L V
Sbjct: 3259 VAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRAS-LKCASKSSLILDSQLPRGMEGGLEKIANLEYSM-VRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTAT-MKIQGKRSIIMESQLPKGMEGTIDRIAELEGLGSRSTE--------FVPDDDTGKPPEFITSPFDMVIGENALAHFECRLQPINDPSMRVDWFHNGKALWAGSRIKTINDFGFVILEIAGCYQRDSGLYTCKATNKHGEATVSCKLQV 3630          

HSP 3 Score: 179.489 bits (454), Expect = 1.127e-44
Identity = 120/365 (32.88%), Postives = 191/365 (52.33%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNL--DESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
             EG+ A L  RV P  DPNL ++W+ +G  L  G R+ T+ + G+  LDILY + ED+G Y C A N  G    + +T NV +    S++L++  P  + E I  +E+ +   +T+    DAPI PP F   + G   +  GQ+ H E +V P+ D +L IE++ NG+PL +  RF+I FD G+  LDI   ++ED G+Y   A N  GQA S+   L V    T+++ +Q P+  E ++ L+S      ++ +    R   +    + P  +I  IN    E   A F  ++   G P  +++W+ NE ++  +S I K +  G +S L+    +   E   +  A N LGEAV  A++ V+ E
Sbjct: 2102 KEGEHAHLECRVEPINDPNLKIEWFCNGKQLPTGHRYRTTHDFGYVALDILYVYGEDTGTYICKATNQLG---EAVNTCNVRVLNRRSMILDTQHPDAL-EKIQKLESKVPNARTE--VGDAPISPPHFTAELRGSTEIYEGQTAHFEAQVAPVHDPNLRIEFYHNGKPLPSASRFHITFDFGYVSLDITHAVAEDAGEYSVRAVNALGQAVSS-TNLRVIPRGTIISDTQHPEGLEKIRKLESTAPHQRQEPETPGTR---QRPVFTQPLQNIDRIN----EHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVS-LDISHIRKEDEGVYMCRAVNPLGEAVTTASMRVVSE 2451          

HSP 4 Score: 164.466 bits (415), Expect = 6.876e-40
Identity = 123/396 (31.06%), Postives = 183/396 (46.21%), Query Frame = 2
Query:  764 PNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL-DIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P +Q     S+   ++  DE          P R     E       AR+IP GDP LTV+W ++G P+ A +R  T  + G+  L++ Y   EDSG Y+C A N  G   TS S L V    S+ L +     M   I  +E      + ++         P FV  + G  NL  GQS H E R+ P  D +L +EWF NG+PL+ G RF   +D GFA LDI+ V +ED+G+Y C   N  G+A +++V         V ++S +  E+ Q+ ++L  IQ+ ED  R   + +EE+ +   P F     N  V EG P      L+ V+  P  +++W+ N   +      K   D     L+            +  AKN +GEAV    ++V
Sbjct: 1666 PRLQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSAS-LIVQSKTSIQLETQHEAAM-HKIHQLEDHSRYQRREEEEYTV-TTAPVFVTKLIGPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNGKPLSTGHRFRTTYDFGFAALDILTVYAEDSGEYTCRVTNNLGEAINSIVL-------NVTSRSSIIHET-QHEEALTKIQHLEDTSRFQRKTDEEQFHAERPQFGRPLRNAKVNEGAPVHLEATLIPVND-PTMKVEWYCNGRPIQTGHRFKTTYDFGFVALDILYAHAEDTGTYMCKAKNAIGEAVTTCAVNV 2049          

HSP 5 Score: 159.073 bits (401), Expect = 3.218e-38
Identity = 116/379 (30.61%), Postives = 189/379 (49.87%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT--ESIAAIEASLN---TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARF---LVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            P F+ H    +   E D       V PA DP ++++W+ +G PL A ++F + ++ G+  LD+  ++ E+SG Y+C A N+ G   TS  TL     +++ L++  PQ     E++   E  L    T KT       P  PP + KP+   ++L   Q +HLE  V P  D +L IEW+ NG+ LN+G RF +  + GF  +D+I V + D G Y C A NKAG+A ++   +  +++E ++  +Q P+ +    Q   IQ+ ED  R +    E+ +    P F  + +N+  + EG  A F   L+ V G     I+WF N + L     ++ +Y+ G+++ LE    KI         A NK G A  +  L  +
Sbjct: 2754 PVFITHLNNIE-CKESDNVRFECNVEPARDPTMSIEWFYNGQPLQAAAKFKSIYDFGYCALDLTNSYAENSGVYTCKATNSKGSATTS-GTLKCTGGKTMFLDTQHPQGEAGLEAVQETEEELANRYTSKTTKPETQYP--PPVWTKPLQAEFHLSEAQPIHLEANVEPKEDPNLFIEWYFNGKMLNHGSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAYNKAGEAFTSTT-IFCSSKENIIESTQHPKGAEGLEQ---IQDLEDSLRKDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPV-GDQSMVIEWFYNGKVLEASHRVRTIYAFGTVA-LEVLGTKIEDTGTYTCRATNKHGTAEISCNLECV 3122          

HSP 6 Score: 158.688 bits (400), Expect = 4.408e-38
Identity = 119/375 (31.73%), Postives = 176/375 (46.93%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVR--LLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINL-TVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P F  H +  +   +G  A     +IP  DP+L V+WY +G  +   +R  T  + G+ +LDI Y    DSGEY C A N +G D T  +TLN      V  +S  P    +S+  I   L  P+ Q     AP+   PP+F+  +  +  L  GQS H E R+ PITD  LV+EW+ NG+ L +G RF    D G  ILDI+    E++G Y   ARNK G+   +V R  L  A++ +++  SQLP+     L+   I N E           EE     P F +   N+  + EG  A F  +++    P+ +++W+ N   +   S  + + D     LE               A N+ GEAV  AT+ +
Sbjct: 3130 PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTR-TTLNCGGRGGVFYDSLQP----DSLQRI-RELECPQGQQADTSAPLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGE---DVTRASLKCASKSSLILDSQLPRGMEGGLEK--IANLEYSMVRTREETTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFRTFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTATMKI 3493          

HSP 7 Score: 150.984 bits (380), Expect = 1.199e-35
Identity = 96/305 (31.48%), Postives = 157/305 (51.48%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETV-VTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARF---LVKVSGYPRPQIQWFLN 1780
            EG    L  R+ P GDP++ ++W+ +G P+  G RF  ++E  +  LD+L  +  DSG Y+C A+N  G   TS S   +  ++ ++   +  +   + I  +E S    +++ +     IRP +F+     L N + G   H E ++ P+TD +L +EWFKNGRP+  G RF  + D G+  LDI+ +I+ED+G Y C A N  G  ++ V     + E+ V VT+++   E + YL        ED  R   R E +E  +  P F     N+ ++E   A F   L+ VS  P  +++W+ N
Sbjct: 1304 EGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDLILETQN--ESGLQKIQYLEDSTRHRRSEFVDEVVNIRP-RFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVELQCRSGEQIVTVTQNEAGLEQIHYL--------EDRSRYTRREEIDESTKQAPVFTTSLKNVEIKENQRAHFECRLIPVSD-PSMRVEWYHN 1596          

HSP 8 Score: 149.058 bits (375), Expect = 4.341e-35
Identity = 86/256 (33.59%), Postives = 139/256 (54.30%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMT-ESIAAIEASL--NTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE--TVVTKSQLPQ 1570
            DE  +PP F +  +      EG P     RV P GDP + ++W+ +G  +A GSR +   + GF  LD+ Y +  DSGEY+C A N +G   TS + +      ++V  S LP+ MT E +  +E       PK     ++    PP+F   +  +  +   ++V  E +V P TD SL +EW++NG+PL +G R+  +FD GF  LDI+ V  ED+G+Y C A N  G+ ++   R  V+ ++  T++ ++Q+P+
Sbjct: 3670 DEQPNPPKFTEEIKDNLDVPEGGPIHFDCRVEPVGDPTMRIEWFYNGHVMATGSRVHQLNDFGFIALDVDYIYARDSGEYTCRATNKWGTATTS-AKVTCKGKHNIVYESQLPEGMTSEKLKELERGRIPEAPKV----VEEVFGPPKFTTQITSV-TVDEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLDILYVYGEDSGEYVCRAINNYGEDRT---RATVSCKKLPTILLQNQVPR 3916          

HSP 9 Score: 148.673 bits (374), Expect = 5.301e-35
Identity = 112/397 (28.21%), Postives = 185/397 (46.60%), Query Frame = 2
Query:  770 MQQSFRSSRSGSVAHLDEITD-PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ----LPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKV--SGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            ++ S R  RS  V   DE+ +  P F+ HP+      EG  A    ++ P  DPNL V+W+K+G P+  G RF    + G+  LDI++   EDSG Y+C A N  G D+T    L     E +V  +     + E I  +E      + ++I  ++  + P F   +  +  ++  Q  H E R+IP++D S+ +EW+ N  PL +G RF    + GF  LDI+  + ED G Y C A N  G+A ++ V  +V T++++  +SQ    LP+          +Q+ ED  +      ++E     P F +   ++ V E     F  ++   G P+  ++W  N   +  ++      D     L  +             A N+LG+AV +A+L V
Sbjct: 1404 LEDSTRHRRSEFV---DEVVNIRPRFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGHRFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQ-VELQCRSGEQIVTVTQNEAGL-EQIHYLEDRSRYTRREEID-ESTKQAPVFTTSLKNV-EIKENQRAHFECRLIPVSDPSMRVEWYHNNLPLKSGSRFTETNNFGFVALDIMSTLPEDAGTYTCRAYNAVGEAITSAV-AVVHTKKSIYLESQHETALPR----------LQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFEARLIPVGDPKLTVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNELGQAVTSASLIV 1782          

HSP 10 Score: 146.747 bits (369), Expect = 2.144e-34
Identity = 111/363 (30.58%), Postives = 174/363 (47.93%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQ-SNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            EG  A   ARV P  D  L ++WY +G  + A +R  T ++ G+  LDI     ED+G Y  VA+N  G  Q   +T+ V    S+  +S + + + E    +E         DI  +     P FV P+     +  G+++HLE R+ P+ D ++ +EWF NGRP+  G RF   +D GF  LDII   + D+G+Y   A N  G A  S  VR++  T+  VVT++Q  Q S++ +Q L     ED  R + + E+    ++ P F     N+   EG       ++   G P  +I+WF+N   V      +   +     L+   C           A+N+LGEAV + ++ +I +ND 
Sbjct: 1038 EGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQ-ATMIVETRSSIDTSS-MHRGLYEKTQNLENKPFVEPQYDIE-EISKSKPVFVTPLSDPKPIHDGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTD--VVTETQNEQ-SLEQIQLL-----EDSRRRHHQEEDITIMQA-PQFTRGLHNIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDLLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDL 1388          

HSP 11 Score: 144.821 bits (364), Expect = 1.003e-33
Identity = 124/401 (30.92%), Postives = 177/401 (44.14%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQV-ANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEAS--LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF-----DIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            +S +   V    E   PP F K P + Q+   E   A   AR+ P GD  + V+W KDG PL A SR  T    G+  L I      D+G Y+C A N  G D T+ + L V     +V  S  P  + + I  +E S      + ++ +I    + P+F+ P+ G   +  GQ  H E RV P +D  LVIEW+ NGR +    R    +D G+  LDI  V +ED G Y   ARNK G+AQ     +       V T+S +   S+        QN E+      +Y+ EE ++S P F     D KPI+    +G       ++   G P  +++WF N   V   S  + Y D     L+  +          V A N LG A  +A + VI   D 
Sbjct:  873 KSQQRRHVQEAAEAIAPPQF-KTPIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQD-TTVAQLTVISKNEIVSESQHPGGL-QKIQHLEDSSRYGRREEEETYI---TQAPRFLGPLKGTTKILEGQRAHFEARVEPQSDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQATMI-------VETRSSIDTSSMHRGLYEKTQNLENKPFVEPQYDIEEISKSKPVFVTPLSDPKPIH----DGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEYTVRATNHLGTAHTSACVRVIDHTDV 1256          

HSP 12 Score: 143.665 bits (361), Expect = 1.971e-33
Identity = 111/387 (28.68%), Postives = 189/387 (48.84%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL--PHFDIKPI--NLTVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            D +  PP F+   +  Q   EG    + AR+ P GDP + V+WY +G PLAA +R  + F+ GF  LD+L     DSGEY C   N  G+ + S + L+V    S+  +S  P  + + I  +E      +T+   ID  + + PQF++P+  L   + G++VH E +V P+ D S+ +EW+K+G P+    R   +F+ G+  L+I+ + +ED G Y   A N+ G+A S    + V +   V     +P++  +Y++   ++  ED  +S  R   +E  E++  P F   PI   L + E   A F  ++   G    +++W  +   +  +S    Y +     L  ++  I         A N +G+    A L+VI +N+ 
Sbjct:  612 DRVYPPPQFIIPLQNVQ-QTEGGRVHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAE-SRAILSVVQRPSIEQSSQNPNSL-QYINQLEDYSRYQRTE--SIDEQLNQAPQFIRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVSLNILHLRAEDAGTYTVRAVNRIGEAISQ-SSIRVHSRSQVTADLGIPEQQ-RYIEK--VEELEDYRKSQQRRHVQEAAEAIAPPQFKT-PIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQPLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQDTTVAQLTVISKNEI 988          

HSP 13 Score: 137.117 bits (344), Expect = 2.282e-31
Identity = 105/360 (29.17%), Postives = 164/360 (45.56%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVS--GYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            NE   A   AR+IP GDPNL V+WY++   +   SR     + GF  LDI +  KED G Y C A N  G   T+ S + V  + S+ +++  P  ++  I  +E  L    T+   +      P F + + G   L  G   H E RV+P+ D SL  EWF NG  L  G R     D GF  LDI  V+ ED G Y C A N AG+A S+   + V T+  +  +  +P+  E+++ L+   +    ++   +   +       L  +D       + EG       +V     P  +I+WF N   L   + I+  +  G ++ L     +    +     A N++GEAV+ ++L +
Sbjct: 2369 NEHQTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVSLDISHIRKEDEGVYMCRAVNPLGEAVTTAS-MRVVSEASIQMDTQHPDSIS-RIHQLEKPLAPRPTEPERL---FEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAGEAVSSTA-MKVKTKSNIDGQPLIPESWEAIR-LKEAAMNRVPEMFVDSTPQQAPVFTTHLQSYD------KLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVT-LSINGLRADDSAIYTCKATNQVGEAVSTSSLKI 2714          

HSP 14 Score: 130.183 bits (326), Expect = 3.419e-29
Identity = 94/296 (31.76%), Postives = 132/296 (44.59%), Query Frame = 2
Query:  626 SIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDA-PIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            SIQ DT HP    +     KP                    PR +EP                 + + + P F +         EG  A   ARV+P GDP+L  +W+ +GV L  GSR  T+ + GF  LDI     ED+G Y C A N  G +  S + + V    ++     +P E  E+I   EA++N  +  ++ +D+ P + P F   +     L  GQ V LE +V P  D +L IEWFKNG  L  G R    FD G   L I G+ ++D+  Y C A N+ G+A S 
Sbjct: 2453 SIQMDTQHPDSISRIHQLEKP------------------LAPRPTEP-----------------ERLFEKPIFTQLLTGPSELWEGTHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDITAVVPEDAGVYMCRAYNAAG-EAVSSTAMKVKTKSNIDGQPLIP-ESWEAIRLKEAAMN--RVPEMFVDSTPQQAPVFTTHLQSYDKLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRIRSTFDFGLVTLSINGLRADDSAIYTCKATNQVGEAVST 2709          

HSP 15 Score: 127.872 bits (320), Expect = 1.718e-28
Identity = 106/386 (27.46%), Postives = 175/386 (45.34%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFG-------------MDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINL--TVEEGNPARFLVKVS--GYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P FV+      V  EG+P +++A  I  G P   + W KDGV +++ +      + G   L+I      D+G Y C A+N  G              +Q +     +NL     +    P    E I         P  +    D    PPQF+ P+  +   +GG+ VH+E R+ P+ D ++V+EW+ NGRPL    R   VF  GF  LD++ ++  D+G+Y C   N +G A+S  + L V    ++   SQ P  S+QY+  L     ED  R       +E+    P F I+P+      EEG    F  +V+    P  +++W+ +   +  +S I  +++ G +S L     +        V A N++GEA++ +++ V
Sbjct:  471 PQFVQRFSTMTV-REGEPITMSANAI--GTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYVEVPREQPNYEQRRLNLPRPTKVIEPEPIPGPEIIYLRHVERAKPHLRPGEEDRVYPPPQFIIPLQNVQQTEGGR-VHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYMCRVTNASGVAESRAI-LSVVQRPSIEQSSQNPN-SLQYINQL-----EDYSRYQRTESIDEQLNQAPQF-IRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVS-LNILHLRAEDAGTYTVRAVNRIGEAISQSSIRV 843          

HSP 16 Score: 125.176 bits (313), Expect = 1.278e-27
Identity = 100/392 (25.51%), Postives = 166/392 (42.35%), Query Frame = 2
Query:  767 NMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARFLVKVSGYPRPQ--IQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATL 1933
            +++ S R  + GS     ++  PP F           EG+ A   A +IP GD ++ ++W+ +G  L A  R  T +  G   L++L T  ED+G Y+C A N  G      + ++ NL+                       ++ P+ Q          P+F   +  L  L+ GQS H E  +IP+ D  L +EW+ NG+ + +  R   V D G+ +LDI  +   D+G+Y C A NK G+  +    L       V   S  P +S+Q ++ L+    +  D S             P F  + +++T + EG  A F  +++    P   ++W+ N   +      + + D  I  L+   C           A+NK GE V  A+L
Sbjct: 3008 DLEDSLR--KDGSKPEQPDLGIPPRFTTEFVNIADIGEGELAHFEANLIPVGDQSMVIEWFYNGKVLEASHRVRTIYAFGTVALEVLGTKIEDTGTYTCRATNKHGT-----AEISCNLE----------------------CVDKPRGQK---------PRFTSHIQPLEGLKDGQSAHFECTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKYGEDFTRTT-LNCGGRGGVFYDSLQP-DSLQRIRELECPQGQQADTS------APLVAEPPKFITQIVDVTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEENSGVYEARARNKYGEDVTRASL 3353          

HSP 17 Score: 83.1889 bits (204), Expect = 8.805e-15
Identity = 83/342 (24.27%), Postives = 127/342 (37.13%), Query Frame = 2
Query:  920 GDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            G+PN TV+WY++  P+            G +IL I   F EDS  +SCVA+N  G   T+  + N+ ++E                                    I+PP FV  +     +  GQ    + +V       L + W KNG  +    +F ++ +     L II   +ED+G Y C A N AG+A+ +         + +V     P++                            +E  PH   +  + TVEEG+   F  +V G P P  +W   E  V P+   ++   G    L         E      A+NKLG    +A L V P
Sbjct: 4419 GEPNPTVKWYRESFPIQNSPDLQIHTFSGKSILIIRQVFVEDSAVFSCVAENRGG---TAKCSANLVVEERRRAGK----------------------------GGIQPPSFVTTIQST-TVATGQLARFDAKV--TGTRPLDVYWLKNGMKIQPSIKFKMLEEDSVHTLLIIEPFAEDSGRYECVAVNAAGEARCDG--------DCIVQSPSKPEKPT-----------------------TPGSEKAPHIVEQLKSQTVEEGSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQMSRQGEYYQLVISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRP 4695          

HSP 18 Score: 72.7886 bits (177), Expect = 1.516e-11
Identity = 90/364 (24.73%), Postives = 131/364 (35.99%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNT---PKTQDIHID----APIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            EG  A  TARV     P LT  W+ +G  L A  ++  S+  G A L +      D G Y+ +A+N  G                 V++S        ++ A+E +  T   PK  D+  +        PP FVK   G   +  G+    + RV   P  +    + W  NGR + +     I+ +  G   L I  V   D G   C ARNKAG+      +L V  +E VV                                        P F  +   +TV EG P        G P+P+I W  +   +  T+ + V  DG  + LE  R       +   +A+N  G     A L V
Sbjct:  268 EGSDAVFTARVGSNPKPRLT--WFHNGQRLVASQKYEISYSSGVATLRVKNATARDGGHYTLLAENLQG----------------CVVSS--------AVLAVEPAAETAYEPKPVDVMAEQLEAGKALPPAFVKAF-GDREITEGRMTRFDCRVTGNPYPE----VFWLINGRQVRDDASHKILVNESGSHSLMITNVTRLDAGAVQCLARNKAGEVAIE-AQLNVLEKEQVVA---------------------------------------PQFVQRFSTMTVREGEPITMSANAIGTPQPRITWQKDGVQISSTAERFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYV 560          

HSP 19 Score: 60.077 bits (144), Expect = 1.125e-7
Identity = 65/255 (25.49%), Postives = 104/255 (40.78%), Query Frame = 2
Query:  851 HPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISE-DTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ 1606
             P R  V  EG+   L+ +++  G+P   V WYKDG P+      N   ++    L ++   K + GEY+  A N  G  +T   T N+ ++E    N+                                PP FV+        Q G+ + L  +V   P+ +    ++W  N  PL    R   V+D     L I     E D+GDY C A N  G+  S+  R++V  +E   TK      +++ +QSL ++
Sbjct: 16732 EPLRNMVIREGESVVLSTQIV--GNPPPKVTWYKDGKPVK-----NAKSDKDLHTLTLITPQKSEKGEYTVKAVNPLGSVET---TANLTIEEPAGGNAE-------------------------------PPLFVERFEEQNVPQKGE-IRLPAKVSGNPVPE----VQWLFNNTPLFPSERIQQVYDGENIELIIKDANPETDSGDYKCIASNPIGKT-SHGARVIVEVDEVTFTKKLKKTITIEEVQSLTLE 16939          

HSP 20 Score: 58.9214 bits (141), Expect = 2.731e-7
Identity = 94/404 (23.27%), Postives = 163/404 (40.35%), Query Frame = 2
Query:  797 SGSVAHLDEITD----PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ----NTEDV-DRS-NFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKV--YSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV---IPENDFR 1960
            SGSV   D+  D    PP F+  P   +   E + A + A  I   +P  + QW+    P+ + +      +   + L I     +  G ++C A+N  G   +  ST  VNL         +PQE  E   +                     P+FV+ +     +  G+++ L  +V      +  +EW+ N   +       I  D +G   L I  V  E+ G Y C A NK G++               V+K+ +  ++ +Y+   +I     + ED+ DR+ +   +  +  + LP   I+P     +EG  A+  VKV G P+P+++W  ++  +  +   ++  + DG+ S L            I   A N LG AV  A  +V   +   D+R
Sbjct: 6824 SGSVVVSDQKPDEQIKPPRFI-QPLEPKYFGEHEVAIIEA--IVESEPLSSFQWFVHNEPIKSSNEVRIVSQANKSTLLIENFQSKFVGPFTCRAENVGG---SVTSTATVNL---------IPQEEAEEFES---------------------PRFVEELVQPVEVMDGEALLLTCQVT--GKPTPKVEWYHNAEKITENKETTISQDLQGVCQLQITEVFPENEGQYECVATNKIGKS---------------VSKTNVKIQAFEYIPDSEITGLTGSEEDLLDRTLSIDEQAPKIIKKLPE-KIEP-----KEGEQAKLEVKVVGKPKPKVKWLRDDEQIFASEEYQIENFEDGT-SVLVINHVYPDDLGTISFEAYNPLGVAVTTALFAVEGIVGSKDYR 7167          
BLAST of Titin vs. UniProt/SwissProt
Match: sp|A2ASS6|TITIN_MOUSE (Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 2.144e-25
Identity = 105/401 (26.18%), Postives = 173/401 (43.14%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGS--RFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-----------------LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLP--QESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P+FV   E+ +  N  + + L  +V   G+PN  + W K+   +      R      RG A L I     +DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+    R  Q       LY+                 L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP  ++ +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1562 PAFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPRIRIEGTRGEAALKIDSIISQDSAWYTATAINKAGRDTTR---CKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHL----RYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGAAYSRDSGVITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPDGKKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVTEHKVKLEIQQREDFRSVLRR 1947          

HSP 2 Score: 88.1965 bits (217), Expect = 2.615e-16
Identity = 102/421 (24.23%), Postives = 163/421 (38.72%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK--SQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL-------------------PHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENP 2011
            +V  PE  QV  E        G PA   A +  +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  V P+      + G+    + +V   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L A E  +  +   Q+  E  +    L  +       S+ R     E   L                   P F  +I  + ++VE  + A+  V V+G P+P+IQWF N  L+ P++  K   DG    L     +   E      A N+ G+AV +A L + P  +   E++  +   L + + P
Sbjct: 3238 YVNAPEPPQVLQELQPVTVQSGKPARFCAVI--SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIVTPLQDTVTSE-GRPARFQCQV---SGTDLKVSWYCKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYAFVANNAVGQVSSTATLRLEAPESILHERIGQQIEMEMKEIASLLSAEEDFQTYSSDLRLPNANETLELLSEPPARSTQFDSRQEGAAPVFIREISDVEISVE--DVAKLSVTVTGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEGEYTCLASNEYGKAVCSAHLRISPRGERSTEMESGEKKALEKPKGP 3622          

HSP 3 Score: 86.2705 bits (212), Expect = 1.173e-15
Identity = 79/301 (26.25%), Postives = 120/301 (39.87%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS-----------------PSTLNVNLDESVVLNSHL----PQEMTESI----------AAIEASLNTPK------------------TQDIHID------APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + S  ++ S ++  + E   PPSF +  +  +    G P +LT R+   G   + V WY+DGV L        SF    A L IL T    SG+YSC A N  G   ++                 P +++V   ES     H+    P  +T S             I    NTP                   T D+  D      +   PP+F+K +      + G+S+ LE ++    +  +V  WF+N   L+   ++N+ F    A+L I    +EDTGDY C A N  G A  +
Sbjct: 7042 ENSIGTAASKTIFRIQERQLPPSFARQLKDIE-QTVGLPVTLTCRL--NGSAPIQVCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFIKKLDASKVAKQGESIQLECKISGSPEIKVV--WFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVGDASCS 7337          

HSP 4 Score: 83.9593 bits (206), Expect = 5.968e-15
Identity = 83/376 (22.07%), Postives = 144/376 (38.30%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRN 2002
             +GDPA+L  +   +G   ++ +W+KDG  L  G ++  S     +IL I+ T K+DSGEY+   +N+ G                               ++ +AS+N        +D  I PP F K +  + +++G     ++   I      + I+WFK+ + ++   +    F    A L+I  +   D+G Y C A NKAG +Q +                            L ++                     P+F  KP +  V  G   +    V G     I+WF +   + P + + V+ D + + LE    K       +    N +G   + AT+ V     F   +K+  P ++LRN
Sbjct: 5479 TQGDPATLQVKF--SGTKEISAKWFKDGQELTLGPKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGR------------------------------SSCKASINV-------LDL-IIPPSFTKKLRKMDSIKGS---FIDLECIVAGSHPISIQWFKDDQEISASDKHKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHSQCS--------------------------GHLTVKEP-------------------PYFVEKPQSQDVNPGTRVQLKALVGGTAPMTIKWFKDNKELHPGAARSVWKDDTSTILELFSAKAADSGTYICQLSNDVGTTSSKATIFVKEPPQF---IKKPSPVLVLRN 5763          

HSP 5 Score: 80.1073 bits (196), Expect = 7.577e-14
Identity = 67/244 (27.46%), Postives = 100/244 (40.98%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            + +P   ++  E  QV   GDPA+L   V  +G P L  +WYKDG PL A  ++  SF+   A L        DSG+Y+    N  G   +S  T    LD  +                                     P F KP+  + ++ GG +  L+ ++       + + WFK+G+ L    R+ I F  G A L+I  V   D G++ C A N  G   S+   L+V    + VTK
Sbjct: 4901 VKEPAKIIERAELIQV-TAGDPATLEYTV--SGTPELKPKWYKDGRPLVASKKYRISFKNNIAQLKFYSAELHDSGQYTFEISNEVG--SSSCETTFTVLDRDIA------------------------------------PLFTKPLRNVDSVVGG-ACRLDCKI--AGSLPMRVSWFKDGKELTASDRYQIAFVEGTASLEISRVDMNDAGNFTCRATNSVGSKDSSGA-LIVQEPPSFVTK 5099          

HSP 6 Score: 78.1814 bits (191), Expect = 3.223e-13
Identity = 86/389 (22.11%), Postives = 147/389 (37.79%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFV+ P+   V   G   + T+  I  G P  TV W+K    L  G+R N S +     L++       SGEY+C+  N  G                                   AS  T     + + AP     FVK +   Y+++ G+ + LE   +   PI+     + W KNG  +    R NI      AIL+I+    ED+G Y C+  N +G+   +   L++                                               P+F   ++P+ +TV  G+ A    +++G P   + W+  +  + PT+  K++   +++ L F +         +  A+N +GE V+++T   + E    P   R
Sbjct: 8659 VREPPSFVQKPDPMDVLT-GSNVTFTS--IVKGSPPFTVSWFKGSTELVPGARCNVSLQDSVGELELFDVDTSQSGEYTCIVSNEAG----------------------------------RASCTT----RLFVKAPA---IFVKRL-NDYSIEKGKPLILEGTFSGTPPIS-----VTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDSGQYNCYIENASGKDSCSAQILILEP---------------------------------------------PYFVKQLEPVKVTV--GDSASLQCQLAGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVGE-VSSSTFLTVQEQKLPPSFSR 8949          

HSP 7 Score: 78.1814 bits (191), Expect = 3.629e-13
Identity = 91/389 (23.39%), Postives = 145/389 (37.28%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFVK PE  +V   G   + T+ +   G P   V W++    L  G+R N  FE   A L++       SGEY+CV  NN G    +  T  + + E                                      P  FVK +   ++++ G+S+ LE   T  +PI+     + W K+G  +    R NIV      IL+I+     D G Y C   N+AG+   +    LV+T E                                           P+F  +++P+  +V  G+      +V+G P   + WF  +  +  T   + Y   +++ L F +  I         A+N +G A A+ T+  I E    P   R
Sbjct: 6777 VQEPPSFVKEPEPLEVL-PGKNITFTSVI--RGTPPFKVGWFRGARELVKGNRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQ---ASCTTRLFVKE--------------------------------------PATFVKKLSD-HSVEPGKSIILEGTYTGTLPIS-----VTWKKDGVSITPSERCNIVTTEKTCILEILSSTKGDAGHYSCEIENEAGRDACDA---LVSTLEP------------------------------------------PYFVTELEPLEASV--GDSVSLQCQVAGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIGTA-ASKTIFRIQERQLPPSFAR 7067          

HSP 8 Score: 77.0258 bits (188), Expect = 6.620e-13
Identity = 60/210 (28.57%), Postives = 91/210 (43.33%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
             E DP +L   V  AG P L V+W KDG  +     F+ SFE   A   I    K+DSG+Y+   +N+FG   +  + L V LD                             QDI       PP F K +  +  +  G S+H+E +V   +PI+      +WFK+G+ ++   ++ +V       L++  +  EDT +Y C   N AG
Sbjct: 6041 TEKDPVTLECVV--AGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFG-SSSCDAYLRV-LD-----------------------------QDI-------PPSFTKKLTKMDKVL-GSSIHMECKVSGSLPIS-----AQWFKDGKEISTSAKYRLVCHENTVSLEVSNLELEDTANYTCKVSNVAG 6204          

HSP 9 Score: 74.3294 bits (181), Expect = 5.176e-12
Identity = 64/231 (27.71%), Postives = 98/231 (42.42%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVV 1516
            + +P + V+ PE   V   G+P +L   V  AG P L+ +W+KDG  L++GSR + +F R  A L I      D G Y+   +N  G    S  T++V++ + VV                                   PP FV+ +    +   G SV LE RV     + + + WF +G  + +  +    F      L +  +   DTG Y C A N AGQ +S+ V
Sbjct: 7529 VLEPATIVEKPEPMTVTT-GNPFTLECVV--AGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTFEVENRVG---KSSCTVSVHVSDRVV-----------------------------------PPSFVRRLKDT-SATLGASVVLECRV--SGSAPISVGWFLDGNEIISSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAV 7715          

HSP 10 Score: 72.4034 bits (176), Expect = 1.678e-11
Identity = 87/372 (23.39%), Postives = 133/372 (35.75%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHID--APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +PP FV   E  + A+ GD  SL  +V  AG P +TV W+K    L +   + T F    A L        DSGEY+C+A+N+ G   T+ S     + E       LP      +  IE ++  P T    ++  API+                                   + W+++G  L +     + F    A L I+      +G Y C A N  G A S     L A E         P++S                               P FDIKP+++ V  G  A F   V+G    ++ W  +   + P     +   G+  +L   +            A N +G+ + +A LSV
Sbjct: 6965 EPPYFVTELEPLE-ASVGDSVSLQCQV--AGTPEITVSWFKGDTKLRSTPEYRTYFTNNVATLVFNKVSINDSGEYTCMAENSIG---TAASKTIFRIQE-----RQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQ-----------------------------------VCWYRDGVLLRDDENLQMSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSTA--RLTARE---------PKKS-------------------------------PFFDIKPVSIDVIAGESADFECHVTGAQPMRVTWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSV 7248          

HSP 11 Score: 71.633 bits (174), Expect = 3.085e-11
Identity = 93/430 (21.63%), Postives = 159/430 (36.98%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG-QAQSNVVRL-----LVATEETVVTKSQLPQE---SVQYLQSLDIQ---NTEDVDR--SNFRYXXXXXXXSLPHFDIKPIN-----------------------------------LTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            S S   +  +T+PP FVK  E  ++   GD A L  ++   G P + V WY++   L A  ++  +F    A++ +     EDSG++ C A+N  G   TS ST  V + E  V +S  P  + E++   E SL          +    PP                                 + W+K+ R L +  ++ +      A + I+ V S D G+Y C A+N+ G  A    V+L      ++   ++   +  P E   S++  Q + +Q     E+V R   N R        +L    ++P N                                   +TV  G       KV+G P   ++W+ +  L+  +   K      IS L+    +           +N +G++   A + V
Sbjct: 6298 SDSCTTMLLVTEPPKFVKKLEASKIIKAGDSARLECKI--TGSPEIQVVWYRNEHELTASDKYQMTFIDSVAVIQMNSLGTEDSGDFICEAQNPAG--STSCST-KVIVKEPPVFSSFPP--IVETLKNTEVSL--------ECELSGTPP-------------------------------FEVVWYKDKRQLRSSKKYKVASKNFHASIHILNVESTDIGEYHCKAQNEVGSDACVCAVKLKEPPKFISKLNSLTVVAGEPAELQASIEGAQPISVQWLKEKEEVIRESENIRISFVNNVATLQFAKVEPANAGKYICQVKNDGGVRENMATLTVLEPAVIIEKAGSMTVTVGETCALECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLKILSVEKEDAGTYTFQVQNNVGKSSCTAVVDV 6681          

HSP 12 Score: 71.633 bits (174), Expect = 3.111e-11
Identity = 59/225 (26.22%), Postives = 95/225 (42.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQF-VKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  ++ ++  + +      ++   G P + V WYKD V +   S+F  SFE   AIL++     EDSG+Y+C A+N  G   +S ++L V                                          PP F  KP P +  L+G   VHLE  +         + W K+ R L +G ++ I+ +     + I+ V + D G+Y C A N  G
Sbjct: 8189 VQEPPRFIKKLDQSRIVKQDEYTRYECKI--GGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSS-TSLKVK----------------------------------------EPPVFRKKPFP-VETLKGAD-VHLECEL--QGTPPFQVSWHKDKRELRSGKKYKIMSENLLTSIHILNVDTADIGEYQCKATNDVG 8366          

HSP 13 Score: 70.8626 bits (172), Expect = 4.912e-11
Identity = 57/234 (24.36%), Postives = 92/234 (39.32%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            + +PPSFVK  +   +   G+ A L  ++   G P + V W+K+   L+  +    SF    AILDI     +DSG YSC A N+ G D  S           VV+                                  PP F+K +     ++G  ++ L+  +         + WFK+ + + +  ++ +   + F  L+I    S D GDY C   N+ G+       LL
Sbjct: 4621 VREPPSFVKKVDPSYLMLPGESARLHCKL--KGSPVIQVTWFKNNKELSESNTVRMSFVNSEAILDITDVKVDDSGTYSCEATNDVGSDSCS---------TEVVIK--------------------------------EPPSFIKTLEPADIVRGANAL-LQCEI--AGTGPFEVNWFKDKKQIRSSKKYRLFTQKTFVYLEISSFNSADVGDYECVVANEVGKCGCVATHLL 4808          

HSP 14 Score: 69.707 bits (169), Expect = 1.310e-10
Identity = 68/250 (27.20%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEM-TESIAAIEAS----LNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            PP+ V   +   V  EG+  +L   +  +G P+  V WY++   + +   F  +F+ G A L I   F EDSG ++C A N  G   TS   L V + E     + L ++  TE    +E+      +T  T++         P F+   P +  L  G SV  E ++    +    + W K+G PL  G R+ + +++  G   L I    ++D G+Y    RNK G+  ++   L  A  E +V   Q
Sbjct:  945 PPTLVSGLKNVTVI-EGESVTLECHI--SGYPSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTS-CYLAVQVSEEFDKETTLTEKFATEEKRFVESRDVVMTDTSITEEQAGPGEPAAPFFIS-KPVVQKLVEGGSVVFECQI--GGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECRLVISMTFADDAGEYTIVIRNKHGETSASASLLEEADYEALVKTQQ 1187          

HSP 15 Score: 68.9366 bits (167), Expect = 1.885e-10
Identity = 57/232 (24.57%), Postives = 91/232 (39.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P + V+ PE  +V   GD  +L   V  +G P L+ +W+KDG  L + +++  SF    + L I+     DSG YS   +N  G D    S                                      I +   I PP F + +     L  G SV +E +V    PI+     + WF +G  +++G ++          L +  +   D GDY C A N AG  + +
Sbjct: 8470 VLEPAAIVEKPESIKVTT-GDTCTLECTV--SGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVVPGDSGVYSFEVQNPVGKDSCKVS--------------------------------------IQVSDRIIPPSFTRKLKETNGLS-GSSVVMECKVYGSPPIS-----VLWFHDGNEISSGRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECS 8654          

HSP 16 Score: 64.6994 bits (156), Expect = 4.230e-9
Identity = 61/234 (26.07%), Postives = 89/234 (38.03%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            I +PP FVK  E  +V   GD ASL  ++  AG P + V WYK    L   +     F+   A L        DSGEY C A+N+ G  + S ST         V    LP   +  +  ++ ++  P   +  +                    G +         PI+     + W+K+G+PL +       F    A L+I       +G Y C A N  G A S    +L
Sbjct: 8845 ILEPPYFVKQLEPVKVTV-GDSASLQCQL--AGTPEIGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVDSSDSGEYICRAENSVG--EVSSSTF------LTVQEQKLPPSFSRQLRDVQETVGLPVVFECAV-------------------SGSE---------PIS-----VSWYKDGKPLKDSPNIQTSFLDNIATLNIFKTDRSLSGQYSCTATNPIGSASSGAKLIL 9034          

HSP 17 Score: 64.6994 bits (156), Expect = 4.603e-9
Identity = 66/262 (25.19%), Postives = 117/262 (44.66%), Query Frame = 2
Query: 1229 DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE----TVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            + P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +EE    T +T+ +   E  ++++S D+  T   D S    +      + P F  KP+   + EG    F  ++ G P+P + W  +    +P +    Y    +SY  +   C++          GE  IV+  +NK GE  A+A+L  + E D+   +K
Sbjct:  940 EVPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPKVTWYREDYQIESSIDFQITFQGGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFDKETTLTE-KFATEEKRFVESRDVVMT---DTSITEEQAGPGEPAAPFFISKPVVQKLVEGGSVVFECQIGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECRLVISMTFADDAGEYTIVI--RNKHGETSASASL--LEEADYEALVK 1184          

HSP 18 Score: 63.929 bits (154), Expect = 6.676e-9
Identity = 81/376 (21.54%), Postives = 131/376 (34.84%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKN 1900
            + S  +  S +V  + E   PPSF +  +       G P +   R+   G   L V WYKDG  L   +    SF    A L IL T +   G+Y+C A N  G   T+ S+  + L E  V                                    P F    P   +L  G+S   +  V     + + I W K+ R +  G  + +      A L ++ V   D G Y C+A N AG+  S   +L V             QE  ++++ LD                                  V++    R+  K+ G P  ++ W+ +E  +  +S  ++  + S++ LE     +         A+N
Sbjct: 7983 ENSVGAVASSAVLVIKERKLPPSFARKLKDVH-ETLGFPVAFECRI--NGSEPLQVSWYKDGELLKDDANLQMSFVHHVATLQILQTDQSHVGQYNCSASNPLG---TASSSAKLILSEHEV------------------------------------PPFFDLKPVSVDLALGESGSFKCHV--TGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVAKGDAGQYTCYASNVAGK-DSCSAQLGV-------------QEPPRFIKKLDQSR------------------------------IVKQDEYTRYECKIGGSPEIKVLWYKDEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARN 8270          

HSP 19 Score: 63.1586 bits (152), Expect = 1.137e-8
Identity = 50/226 (22.12%), Postives = 83/226 (36.73%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +PP F+K P    V   G   +   +V   G P + V WY DG  +    ++  SF  G A   I     E+SG Y C A+N+ G   T+  ++ + + E                                      PP F++ +  +  ++    V LE  V+  T     + W KN + + +G ++ +        L I      D G+Y C   N+ G  
Sbjct: 5745 VKEPPQFIKKPSPVLVLRNGQSTTFECQV--TGTPEIRVSWYLDGNEITDLRKYGISFVDGLATFQISNARVENSGTYVCEARNDAG---TASCSIELKVKE--------------------------------------PPIFIRELEPVEVVKDSD-VELECEVMGTT--PFEVTWLKNNKEIRSGKKYTMSEKMSVFYLHITKCDPSDVGEYQCIIANEGGSC 5924          

HSP 20 Score: 62.3882 bits (150), Expect = 1.904e-8
Identity = 51/225 (22.67%), Postives = 86/225 (38.22%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSV-HLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  +  +VA +G+   L  ++  +G P + V W+++   L    ++N SF    A+L I     ED+G+Y C A N  G D +  + L V                                          PP F +  P +  L+G   +   E    P       + W K+ + + +  +F I        L I  + + D G+Y C A N+ G
Sbjct: 7248 VKEPPKFIKKLDASKVAKQGESIQLECKI--SGSPEIKVVWFRNDSELHESWKYNMSFVNSVALLTINEASAEDTGDYICEAHNGVG-DASCSTALKVKA----------------------------------------PPVFTQKPPPVGALKGSDVILQCEISGTP----PFEVVWVKDRKQVRSSKKFKITSKNFDTSLHIFNLEAPDIGEYHCKATNEVG 7425          

HSP 21 Score: 62.3882 bits (150), Expect = 2.089e-8
Identity = 51/228 (22.37%), Postives = 86/228 (37.72%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +P +F++  E  Q+  +GD   L  +V   G P + + W+ +   L   S+   SF    A+L +     EDSGEY C A+N  G D  +           +V+    P   T+   +IE      K  D+ + A +   PP                                 I WFK+   L +G ++          L ++  ++ D G+Y C   N+ G +
Sbjct: 5183 VKEPATFIEKLEPSQLLKKGDGTQLACKV--TGTPPIKITWFANDRELRESSKHKMSFAESTAVLRLTDVAIEDSGEYMCEAQNEAGSDHCT----------GIVIVKESPY-FTKEFKSIEVL----KEYDVMLLAEVAGTPP-------------------------------FEITWFKDNTTLRSGRKYKTFLQDQLVSLQVLKFVAADAGEYQCRVTNEVGSS 5362          

HSP 22 Score: 60.077 bits (144), Expect = 1.104e-7
Identity = 66/258 (25.58%), Postives = 106/258 (41.09%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHL-----PQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQG-----GQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQES 1576
            P F++     +++ E D A L+  V   G P   +QW+ +G+ L   + +   F+     L IL+T  +D GEY+C+A N +G                 V ++HL      +  TE  +  + +L  PK        P  PP F K +  ++   G       SVH E         +  + WFK   PL     + I+    G     +      D+G Y C A+N  G++ +    LLV  E+T V  +   +ES
Sbjct: 3509 PVFIREISDVEISVE-DVAKLSVTV--TGCPKPKIQWFFNGMLLTPSADYKFVFDGDTHSLIILFTRFQDEGEYTCLASNEYG---------------KAVCSAHLRISPRGERSTEMESGEKKALEKPK-------GPC-PPYFFKELKPVHCGPGIPAVFEYSVHGE--------PAPTVLWFKEDMPLYTSVCYTIIHSPDGSGTFIVNDPQRGDSGLYLCKAQNLWGES-TCAAELLVLPEDTDVPDASCKEES 3731          

HSP 23 Score: 59.6918 bits (143), Expect = 1.446e-7
Identity = 66/244 (27.05%), Postives = 95/244 (38.93%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----------IEWFK-NGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            + E   PP F +H      A+EGD   L+  V   G   + +QW K G  +    R + SF  G A+L++  T K DSG+Y C A N  G D TS   + +                       E     P  +   +D              L+ +   QS+    RV+  T ++ +          ++W K   R LN G R  I      A L+I      D+G Y C A NK G+ +SNV
Sbjct: 9227 IKEPKKPPVFDQHLAPV-TASEGDSVQLSCHV--QGSEPIRIQWLKAGREVKPSDRCSFSFASGTAMLELKETAKADSGDYVCKASNVAGSD-TSKCKVTIK----------------------EKPAAAPAAKKAAVDG------------KLFFVSEPQSI----RVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNV 9428          

HSP 24 Score: 59.3066 bits (142), Expect = 1.847e-7
Identity = 55/222 (24.77%), Postives = 87/222 (39.19%), Query Frame = 2
Query: 1334 DSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVY---SDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI-----PENDFRPELKR 1975
            D S  + W+   R L N  ++ I ++ G A + +  +   D G Y C   N  G+  S+   L V              + V+ +     + T+ V R   R +     E  P F +   N T   G   RF V ++ +P P++ W+ +   + P   +K Y   SD  +  L         ++   V A+NK GE    A L+V       E   RP  KR
Sbjct: 33384 DQSTQVTWYFGVRQLENSEKYEITYEDGVATMYVKDITKFDDGTYRCKVVNDYGE-DSSYAELFV--------------KGVREVYDYYCRRTKKVKR---RTDAMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDEKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKHGEDSCKAKLTVTLHPPPTETTLRPMFKR 33587          
BLAST of Titin vs. UniProt/SwissProt
Match: sp|Q8WZ42|TITIN_HUMAN (Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4)

HSP 1 Score: 115.546 bits (288), Expect = 1.289e-24
Identity = 105/401 (26.18%), Postives = 173/401 (43.14%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYN-----------------LQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            P FV   E+ +  N  + + L  +V   G+PN  + W K+   +          E  +G A L I  T  +DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+    R  Q       LY+                 L+     H E R+ PI D ++V+EW  +G+PL    R  ++ + G+  LD     S D+G   C A NK G   ++   L+V  E+++V +SQLP+  + +Q ++ L+    E           +++ +  P   + P  + V EG  ARF  +V+GYP+P++ W+LN  L+  +   +V  DG I YL+   CK      + V+A+N  G       L +    DFR  L+R
Sbjct: 1556 PMFV---EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTR---CKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHL----RYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT-LIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTG---VTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRR 1941          

HSP 2 Score: 89.7373 bits (221), Expect = 1.020e-16
Identity = 81/301 (26.91%), Postives = 120/301 (39.87%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS-----------------PSTLNVNLDESVVLNSHL----PQEMTESI----------AAIEASLNTPK------------------TQDIHID------APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + S  ++ S +V  + E   PPSF +  +  +    G P +LT R+   G   + V WY+DGV L       TSF    A L IL T    SG+YSC A N  G   +S                 P +++V   ES     H+    P  +T S             I    NTP                   T D+  D      +   PP+FVK +      + G+S+ LE ++       + + WF+N   L+   ++N+ F    A+L I    +ED+GDY C A N  G A  +
Sbjct: 7081 ENSIGTASSKTVFRIQERQLPPSFARQLKDIE-QTVGLPVTLTCRL--NGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKI--SGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCS 7376          

HSP 3 Score: 83.9593 bits (206), Expect = 4.828e-15
Identity = 97/395 (24.56%), Postives = 151/395 (38.23%), Query Frame = 2
Query:  842 FVKHPERYQVANE--------GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK--SQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL--------PHFD----------IKPI-NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +V  PE  QV  E        G PA   A +  +G P   + WYK+   L+ G +     +     L ++  F ED+  Y+C AKN++G+  TS S L+V + E V  +    QEM                       P+ PP  + P+      + GQ    + RV   + + L + W+   + +     F +        L+I     ED G Y   A N  GQ  S     L A E  +  +   ++  E  ++  S      E +  +  +  +  E   L          FD          IK + N  +  G+ A   V V G P+P+IQWF N  L+ P++  K   DG    L     K+  E      A N  G+ + +A L +
Sbjct: 3232 YVNAPEPPQVLQELQPVTVQSGKPARFCAVI--SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS-LSVEVPEVVSPD----QEM-----------------------PVYPPAIITPLQDTVTSE-GQPARFQCRV---SGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3592          

HSP 4 Score: 83.1889 bits (204), Expect = 8.374e-15
Identity = 84/376 (22.34%), Postives = 143/376 (38.03%), Query Frame = 2
Query:  875 NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRN 2002
             +GDPA+L  +   +G   +T +W+KDG  L  GS++  S     +IL I+ T K+DSGEY+   +N+ G                               ++ +A +N        +D  I PP F K +  + +++G     ++   I      + I+WFK+ + ++   ++   F    A L+I  +   D+G Y C A NKAG  Q +                            L ++                     P+F  KP +  V      +    V G     I+WF +   +   + + V+ D + + LE    K       +    N +G A + ATL V     F   +K+  P ++LRN
Sbjct: 5518 TQGDPATLQVKF--SGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGR------------------------------SSCKARINV-------LDL-IIPPSFTKKLKKMDSIKGS---FIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCS--------------------------GHLTVKEP-------------------PYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQF---IKKPSPVLVLRN 5802          

HSP 5 Score: 82.4185 bits (202), Expect = 1.490e-14
Identity = 87/377 (23.08%), Postives = 145/377 (38.46%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + +PPSFV+ P+   V   G   + T+  I  G P  +V W+K    L  G R N S E   A L++       SGEY+C+  N  G                                  +AS  T     ++I AP +   FVK +   Y+++ G+ + LE   T   PI+     + W KNG  +    R NI      AIL+I     ED G Y C+  N +G+   +   L++                                               P+F   ++P+ ++V  G+ A    +++G P   + W+  +  + PT+  K++   +++ L F +  I      +  A+N +GE  A+  L+V
Sbjct: 8698 VREPPSFVQKPDPMDVLT-GTNVTFTS--IVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAG----------------------------------KASCTT----HLYIKAPAK---FVKRL-NDYSIEKGKPLILEGTFTGTPPIS-----VTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP---------------------------------------------PYFVKQLEPVKVSV--GDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTV 8977          

HSP 6 Score: 79.7221 bits (195), Expect = 9.602e-14
Identity = 74/273 (27.11%), Postives = 112/273 (41.03%), Query Frame = 2
Query:  764 PNMQQSF-------RSSRSGSVAHLDE--ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTK 1555
            P++Q SF         + +GS   + E  + +P   ++  E  QV   GDPA+L   V  AG P L  +WYKDG PL A  ++  SF+   A L        DSG+Y+    N  G   +S  T    LD  +                                     P F KP+  + ++  G +  L+ ++       + + WFK+G+ +    R+ I F  G A L+II V   D G++ C A N  G   S+   L+V    + VTK
Sbjct: 4911 PDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQV-TAGDPATLEYTV--AGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVG--SSSCETTFTVLDRDIA------------------------------------PFFTKPLRNVDSVVNG-TCRLDCKI--AGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGA-LIVQEPPSFVTK 5138          

HSP 7 Score: 78.5666 bits (192), Expect = 2.258e-13
Identity = 89/389 (22.88%), Postives = 145/389 (37.28%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLE---TRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHF--DIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKR 1975
            + +PPSFVK PE  +V   G   + T+ +   G P   V W++    L  G R N  FE   A L++       SGEY+CV  NN G    +  T  + + E                                      P  F+K +   ++++ G+S+ LE   T  +PI+     + W K+G  +    + NIV      IL+I+     D G Y C   N+AG+   +V   LV+T E                                           P+F  +++P+   V  G+      +V+G P   + W+  +  + PT   + Y   +++ L F +  I         A+N +G A ++ T+  I E    P   R
Sbjct: 6816 VQEPPSFVKEPEPLEVL-PGKNVTFTSVI--RGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQ---ASCTTRLFVKE--------------------------------------PAAFLKRLSD-HSVEPGKSIILESTYTGTLPIS-----VTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGR---DVCGALVSTLEP------------------------------------------PYFVTELEPLEAAV--GDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTA-SSKTVFRIQERQLPPSFAR 7106          

HSP 8 Score: 77.0258 bits (188), Expect = 7.264e-13
Identity = 75/283 (26.50%), Postives = 125/283 (44.17%), Query Frame = 2
Query:  713 KMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKS 1558
            ++Q+ K N+T       P     F S + G+          P F+K      ++  GD A+L+  VI  G P   +QW+ +GV L   + +   F+     L IL+T  ED GEY+C+A N++G    S + L +N       +     + TE+ +A+  SL         +  P  PP F+K +  +   QG  ++   T V    + +  + WFK  + L     + I+ +  G     +     ED+G Y C A N  G++ +    LLV  E+T +T +
Sbjct: 3471 ELQLSKINETLELLSESPVYPTKFDSEKEGT---------GPIFIKEVSNADISM-GDVATLSVTVI--GIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICS-AYLKIN-------SKGEGHKDTETESAVAKSLE-------KLGGPC-PPHFLKELKPIRCAQGLPAIFEYTVV---GEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGES-TCAAELLVLLEDTDMTDT 3721          

HSP 9 Score: 76.2554 bits (186), Expect = 1.090e-12
Identity = 59/227 (25.99%), Postives = 98/227 (43.17%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +P   V+  +   V  E DP +L   V  AG P L V+W KDG  +     F+ SFE   A   I    K+DSG+Y+   +N+FG      S+ +  L    VL+ ++P   T+ +  ++  L                               G S+H+E +V   +PI+      +WFK+G+ ++   ++ +V       L++  +  EDT +Y C   N AG
Sbjct: 6064 VQEPAQIVEKAKSVDV-TEKDPMTLECVV--AGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGS-----SSCDAYLR---VLDQNIPPSFTKKLTKMDKVL-------------------------------GSSIHMECKVSGSLPIS-----AQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAG 6243          

HSP 10 Score: 72.4034 bits (176), Expect = 2.108e-11
Identity = 67/226 (29.65%), Postives = 85/226 (37.61%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIE--WFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            I D P F+K  E  Q A       L  +V    D  +TV W KDG  L  G  +   FE   A L+I     +DSG Y C A N  G    S +T+ V                                          PP FVK +   Y +  G+S  L  ++      S VI+  WFKN + L+      + F    AILDI  V  ED+G Y C A N  G
Sbjct: 4567 IIDKPHFIKELEPVQSAI-NKKVHLECQV--DEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCS-ATVTVR----------------------------------------EPPSFVKKVDPSYLMLPGESARLHCKL----KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVG 4744          

HSP 11 Score: 71.633 bits (174), Expect = 3.356e-11
Identity = 72/293 (24.57%), Postives = 126/293 (43.00%), Query Frame = 2
Query: 1136 VLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATE----ETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            +  + + +E  E +   EA +         ++ P+ PP  V  +  +  ++G +SV LE  +      S  + W++    + +   F I F  G A L I    +ED+G + C A N+AG   ++    +  +E    ET     +   E  ++++S D+  T   D S    +      + P+F  KP+   + EG    F  +V G P+P + W  +    +P +    Y    +SY  +   CK+          GE  IVV  +NK GE  A+A+L  + E D+   +K
Sbjct:  906 ITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEG-ESVTLECHISGY--PSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMT---DTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSG---VPLTTGYRY---KVSYNKQTGECKLVISMTFADDAGEYTIVV--RNKHGETSASASL--LEEADYELLMK 1182          

HSP 12 Score: 71.2478 bits (173), Expect = 3.875e-11
Identity = 89/372 (23.92%), Postives = 130/372 (34.95%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHID--APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +PP FV   E  + A  GD  SL  +V  AG P +TV WYK    L     + T F    A L        DSGEY+C A+N+ G   T+ S     + E       LP      +  IE ++  P T    ++  API+                                   + W+++G  L +       F    A L I+      +G Y C A N  G A S+    L A E         P++S                               P FDIKP+++ V  G  A F   V+G    +I W  +   + P     +   G+  +L   +            A N +G+ + +A LSV
Sbjct: 7004 EPPYFVTELEPLEAAV-GDSVSLQCQV--AGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIG---TASSKTVFRIQE-----RQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQ-----------------------------------VCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSA--RLTARE---------PKKS-------------------------------PFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSV 7287          

HSP 13 Score: 70.8626 bits (172), Expect = 5.767e-11
Identity = 60/232 (25.86%), Postives = 95/232 (40.95%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI---PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P + V+ PE  +V   GD  +L   V  AG P L+ +W+KDG  L + +++  SF    + L I+     DSG YS   +N  G D  + S L V+ D +V                                    PP F + +     L  G SV +E +V    PI+     + WF  G  +++G ++          L +  +   D+GDY C A N AG  + +
Sbjct: 8509 VLEPATIVEKPESIKVTT-GDTCTLECTV--AGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTAS-LQVS-DRTV------------------------------------PPSFTRKLKETNGLS-GSSVVMECKVYGSPPIS-----VSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECS 8693          

HSP 14 Score: 70.4774 bits (171), Expect = 6.383e-11
Identity = 98/434 (22.58%), Postives = 163/434 (37.56%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTS--IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFR----KLSTLK-KVAVSPELQNAFRK 2077
            S S   +  +T+PP FVK  E  ++   GD + L  ++  AG P + V W+++   L A  ++  +F    A++ +     EDSG++ C A+N  G   TS ST  V + E  V +S  P  + E++   E SL          +    PP                                 + W+K+ R L +  ++ I        + I+ V + D G+Y C A+N+ G              +T V   +L +                                 P F  K  +LTV  G PA     + G     +QW   +  VI  S  I+  + + +++ L+F + +       +   KN  G     ATL V+            +PA+++    P      +  TL+ KVA +PEL   + K
Sbjct: 6337 SDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKI--AGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAG--STSCST-KVIVKEPPVFSSFPP--IVETLKNAEVSL--------ECELSGTPP-------------------------------FEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGS-------------DTCVCTVKLKEP--------------------------------PRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVE-NVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL------------EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYK 6666          

HSP 15 Score: 67.781 bits (164), Expect = 4.464e-10
Identity = 59/243 (24.28%), Postives = 93/243 (38.27%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            S S +    + +PPSFVK  +   +   G+ A L  ++   G P + V W+K+   L+  +     F    AILDI     EDSG YSC A N+ G D  S                      TE +                      PP F+K +     ++G  ++ L+  V         I WFK+ + + +  ++ +   +    L+I    S D G+Y C   N+ G+       LL
Sbjct: 4651 SSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKL--KGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCS----------------------TEIVIK-------------------EPPSFIKTLEPADIVRGTNAL-LQCEV--SGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLL 4847          

HSP 16 Score: 67.781 bits (164), Expect = 4.657e-10
Identity = 57/225 (25.33%), Postives = 87/225 (38.67%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFV-KPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP FVK  E  +VA +G+   L  ++  +G P + V W+++   L    ++N SF    A+L I     EDSG+Y C A N  G D +  + L V                                          PP F  KP P       G  V L+  +       +V  W K+ + + N  +F I        L I+ + + D G+Y C A N+ G
Sbjct: 7287 VKEPPKFVKKLEASKVAKQGESIQLECKI--SGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVG-DASCSTALTVKA----------------------------------------PPVFTQKPSP--VGALKGSDVILQCEISGTPPFEVV--WVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVG 7464          

HSP 17 Score: 67.3958 bits (163), Expect = 5.851e-10
Identity = 53/224 (23.66%), Postives = 90/224 (40.18%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            + +PP F+K  E  ++  + +      ++   G P + V WYKD   +   S+F  SF    A+L++     EDSG+Y+C A +N     +S ++L V          H               + T K  D+H++                 LQG    H              + W+K+ R L +G ++ I+ +     + I+ V + D G+Y C A N  G
Sbjct: 8228 VQEPPRFIKKLEPSRIVKQDEFTRYECKI--GGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEA-HNAAGSASSSTSLKVKEPPIFRKKPH--------------PIETLKGADVHLEC---------------ELQGTPPFH--------------VSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVG 8405          

HSP 18 Score: 66.2402 bits (160), Expect = 1.446e-9
Identity = 84/392 (21.43%), Postives = 138/392 (35.20%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETR--VIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV----IPENDFRPELKRTD 1981
            + + P F K  +  +V  E D   L A V  AG P   + W+KD   L +G ++ T  +     L IL     D+GEY C   N  G   +S  +  V L E                                      PP F+K +    +L+GG +    T    +PIT     + W K+   +       + F+   A L + G+  +  G Y C A+N AG  + +   LL   E   +T+                                           + +++ V +G+PA   VK SG      +WF +   +   S  K+    ++S L+    +           +N +G +   A ++V    IP + F  +LK+ D
Sbjct: 5316 VKESPYFTKEFKPIEVLKEYD-VMLLAEV--AGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVG---SSICSARVTLRE--------------------------------------PPSFIKKIESTSSLRGGTAAFQATLKGSLPIT-----VTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSA--LLSVKEPATITE-------------------------------------------EAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPS-FTKKLKKMD 5612          

HSP 19 Score: 65.4698 bits (158), Expect = 2.225e-9
Identity = 63/234 (26.92%), Postives = 90/234 (38.46%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            I +PP FVK  E  +V+  GD ASL  ++  AG P + V WYK    L   + +   F    A L        DSGEY C A+N+ G  + S ST         V    LP   +  +  ++ ++  P   D  I                    G +         PI+     + W+K+G+PL +       F    A L+I        G Y C A N  G A S+   +L
Sbjct: 8884 ILEPPYFVKQLEPVKVSV-GDSASLQCQL--AGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVG--EVSASTF------LTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAI-------------------SGSE---------PIS-----VSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLIL 9073          

HSP 20 Score: 63.5438 bits (153), Expect = 9.681e-9
Identity = 55/206 (26.70%), Postives = 77/206 (37.38%), Query Frame = 2
Query:  881 GDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQ 1498
            G P +   R+   G   L V WYKDGV L   +   TSF    A L IL T +   G+Y+C A N  G   T+ S+  + L E  V                                    P F    P   +L  G+S   +  V     + + I W K+ R +  G  + +      A L ++ V   D G Y C+A N AG+
Sbjct: 8057 GFPVAFECRI--NGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLG---TASSSAKLILSEHEV------------------------------------PPFFDLKPVSVDLALGESGTFKCHVT--GTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGK 8219          

HSP 21 Score: 63.1586 bits (152), Expect = 1.216e-8
Identity = 69/319 (21.63%), Postives = 111/319 (34.80%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQW 1771
            L  + +PP F++ P  +  A  G+PA+L  +V   G P + + WYK+   L +   +   F+   A L I      D GEYSC A N+ G   +S   +                                      I A   PP F + +  ++   G   V  E R+       L + W+K+G  L +       F    A L I+       G Y C A N  G A S+         + ++++ ++P                                  P FD+KP+++ +  G    F   V+G    +I W
Sbjct: 7940 LVSVLEPPYFIE-PLEHVEAVIGEPATLQCKV--DGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLV--------------------------------------IKARKLPPFFARKLKDVHETLGF-PVAFECRI--NGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSA--------KLILSEHEVP----------------------------------PFFDLKPVSVDLALGESGTFKCHVTGTAPIKITW 8172          

HSP 22 Score: 62.7734 bits (151), Expect = 1.452e-8
Identity = 54/228 (23.68%), Postives = 86/228 (37.72%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            + +P +FV+  E  Q+  +GD   L  +V   G P + + W+ +   +   S+   SF    A+L +     EDSGEY C A+N  G D  S          S+V+    P   T+    IE      K  D+ + A +   PP                                 I WFK+   L +G ++          L I+  ++ D G+Y C   N+ G +
Sbjct: 5222 VKEPATFVEKLEPSQLLKKGDATQLACKV--TGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCS----------SIVIVKESPY-FTKEFKPIEVL----KEYDVMLLAEVAGTPP-------------------------------FEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSS 5401          

HSP 23 Score: 62.003 bits (149), Expect = 2.624e-8
Identity = 89/392 (22.70%), Postives = 148/392 (37.76%), Query Frame = 2
Query:  779 SFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNG---RPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLN-ECLVIPTSIQKVYSDGSISYLEFQRCKIPGES-FIVVSAKNKLGEAVANATLSV 1939
            + RS +  SVA +   +     V     + V  EG       + I   D +  V WY     L    ++  ++E G AIL +    K D G Y C   N++G D +        + E  V + +  + M +    I+   +T +  +       RPP+F  P   LYN       ++   V         + W+K+G   +P +N  ++    D+G   L I  V ++D  +Y   ARNK G+             +  VT    P +                  S  R          P F     N   +EG    F ++VSG P P ++W  + + L +  +I+ ++ +G   Y    R  +P ++ +  V+A N  G     A L V
Sbjct: 32475 AIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCK-IENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVRE--VYDYYCRRTMKK----IKRRTDTMRLLE-------RPPEFTLP---LYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKA--------KLTVTLHPPPTD------------------STLR----------PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIH-EGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 32812          

HSP 24 Score: 60.4622 bits (145), Expect = 8.858e-8
Identity = 60/213 (28.17%), Postives = 85/213 (39.91%), Query Frame = 2
Query:  926 PNLTVQWYKDGVPLAAG---SRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAG----QAQSNVVRLLVATEE 1540
            P   V WYK G  +  G    ++    ++G   L I     +D  EY+ VA+N +G D                             A +  +L+ P T     D+ +RP    K +      Q GQSV  E RV  I   +L  +W K+G+PL+ G    I+ +   +  L I   + EDTG Y   A N AG    QA   V RL    +E
Sbjct: 32644 PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCK--------------------------AKLTVTLHPPPT-----DSTLRP--MFKRLLANAECQEGQSVCFEIRVSGIPPPTL--KWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQE 32821          

HSP 25 Score: 60.4622 bits (145), Expect = 9.085e-8
Identity = 50/229 (21.83%), Postives = 82/229 (35.81%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +PP F+K P    V   G   +   ++   G P + V WY DG  + A  +   SF  G A   I     E+SG Y C A+N+ G   T+  ++ + + E                                      PP F++ +  +  ++    V LE  V         + W KN R + +  ++ +        L I      DTG+Y C   N+ G    +
Sbjct: 5784 VKEPPQFIKKPSPVLVLRNGQSTTFECQI--TGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAG---TASCSIELKVKE--------------------------------------PPTFIRELKPVEVVK-YSDVELECEV--TGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCS 5966          

HSP 26 Score: 54.6842 bits (130), Expect = 5.018e-6
Identity = 79/392 (20.15%), Postives = 146/392 (37.24%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNV---NLDESVVLN---SHLPQEMTESIAAIEASLN---------------------TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV----IEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            R     EG+ A  +      G+P  TV W + G  L+  +R   +  +  +  +I      D G YS V +N+ G  Q +  TL +    + E  V +      P+   +S  A+++                        T K Q + + AP +  QF+K           ++     ++  + +SS++    + W+K+G+ L     F   +   G   L I  +   D G+Y C    + G +++N+  +  A +      S++ +      +  D + TE         +  E   S P       + TV   + A+F VK +G PRP   W  +   +      K+  D    +LE  +           + KN  G   ++  L++
Sbjct: 33495 RSMTVYEGESARFSCDT--DGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEG-KQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLK----------AEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISE-----TKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 33868          
BLAST of Titin vs. UniProt/SwissProt
Match: sp|O01761|UNC89_CAEEL (Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3)

HSP 1 Score: 90.8929 bits (224), Expect = 3.999e-17
Identity = 94/326 (28.83%), Postives = 138/326 (42.33%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSR--FNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNI-VFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV---VRLLVATEETVVTKSQLPQESVQYLQSLDIQNTE-DVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQW 1771
            + E  + P FV+  + Y+V  +G PA L  RV   G P   V+W+KDGVP+A  ++       E G   L I  T   D G+Y+C A N  G D+T             V    +P+   E   A E                   P F++P+   + ++G  +V LE +V    +S   I++FKN +P+  G    + V + G   L I     ED G Y C A N AG+A +N    ++     EE V  +S   +E  Q+    D  +++ D  R              P F     + TV E   A    KV G PRP+I+W
Sbjct: 3573 VQEEIEAPLFVQGLKPYEV-EQGKPAELVVRV--EGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKAGKDET-------------VGELKIPKYSFEKQTAEEVK-----------------PLFIEPLKETFAVEG-DTVVLECKVN--KESHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAAKVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRG------------APEFVELLRSCTVTEKQQAILKCKVKGEPRPKIKW 3850          

HSP 2 Score: 77.411 bits (189), Expect = 4.978e-13
Identity = 89/362 (24.59%), Postives = 142/362 (39.23%), Query Frame = 2
Query:  872 ANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSR--FNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD--RGFAILDIIGVISEDTGDYFCFARNKAGQAQS-NVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            A+ GD  S T +    GDP   ++WY++G  L  G R    TS + G   L +  +   D G Y C A+N  G                        +  T++ A ++ +L   KT+   +D   +PP+F+  +  + ++  G  + LE +V  + + S  ++W K+G PL    RF    +  +G   L I      D G Y C A N+ G A + + VR+       VVT SQ P+                                   F +K  ++   EG P +   KV   P P++ W+ +  +V P+  IQ   S   ++ L    C    +    V A N  G A    T +V
Sbjct: 5498 ADRGD--SFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPD-GSCSLTVNESTMSDEGIYRCEAENAHG------------------------KAKTQATAHVQMALG--KTEKPKMDEG-KPPKFILELSDM-SVSLGNVIDLECKVTGLPNPS--VKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQPPR-----------------------------------FTLKMGDVRTTEGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATV 5791          

HSP 3 Score: 75.8702 bits (185), Expect = 1.758e-12
Identity = 95/381 (24.93%), Postives = 145/381 (38.06%), Query Frame = 2
Query:  845 VKHPERYQVANEGDPASLTARVIPAGDP-----------NLTVQWYKDG--VPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVI--PTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +++P R+ V        L  R IP GDP              V+W+KDG  +   A +    + + G   + I+   + D G Y CVA N  G  +T  +T  V + E      H+ +E     A        PK         I PP   K       + GGQ + L  +V  I  +S+V  W+K+G PL    R +I ++  G A L I     ED G Y C A N  G   ++       +    V K ++ +E  +                             P F    ++L  + G+       V+G P P+I+W+ N  L+   P ++ +   DGS S L      +  E      A+N  G+A   AT  V
Sbjct: 5273 LRYPPRFNVP-------LWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVD-GACRIKIIPFEESDIGVYMCVAVNELGQAETQ-ATYQVEILE------HVEEEKRREYA--------PK---------INPPLEDK------TVNGGQPIRLSCKVDAIPRASVV--WYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINTS------CSVNVKVPKQEVKKEGEE-----------------------------PFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPDGSCS-LTVNESTMSDEGIYRCEAENAHGKAKTQATAHV 5577          

HSP 4 Score: 70.8626 bits (172), Expect = 5.198e-11
Identity = 102/385 (26.49%), Postives = 146/385 (37.92%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQT-SPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIE--WFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPI-NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTS-IQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRP 1963
            PP F+       V+  G+   L  +V   G PN +V+W KDG PL   SRF  S E  +G   L I      D G Y CVA N  G   T S   ++  L   VV  S                               +PP+F   M G      GQ + LE +V    D+S + E  W+K+G  +    R  I     G A L I   + +D G Y   A N +G AQ          ++   T  +LP++S     +         DR  F      +    P   ++P+ N+ + E    R   K SG P+P I+WF +   V P   +Q + S   +  L                A+N  G A  +  ++VI   D +P
Sbjct: 5594 PPKFILELSDMSVSL-GNVIDLECKV--TGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTAS-------------------------------QPPRFTLKM-GDVRTTEGQPLKLECKV----DASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQ----------DKGTATVKKLPRDSGARRSA---------DRDVF------DANKAPKL-MEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVI-RGDRKP 5912          

HSP 5 Score: 63.1586 bits (152), Expect = 1.359e-8
Identity = 63/219 (28.77%), Postives = 85/219 (38.81%), Query Frame = 2
Query:  908 VIPAGDPNLTVQWYKDGVPLAA----GSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIR-----PPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLV------IEWFKNGRPLNNGCRFNI-VFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVV 1516
            V   G P  TV+WYKDG  +      G R   + ERG   L I+    +D GEYS  A N  G  +T                              E SLN  + + I  DA  R     PP FV+ +         ++ H+   +  I D  +V      +EWF NG+ +  G R  I     G   L I+    ED G+Y   A+N  G A S+ V
Sbjct: 6059 VCATGIPTPTVKWYKDGQEIVGDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKT------------------------------EGSLNIIRPRHI-ADADERGGMPFPPGFVRQL---------KNKHVFNHMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAV 6237          
BLAST of Titin vs. UniProt/SwissProt
Match: sp|G4SLH0|TTN1_CAEEL (Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 5.180e-13
Identity = 95/371 (25.61%), Postives = 157/371 (42.32%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDP-ASLTARVIPAGDPNLTVQWYKDGVPLAAGS-RFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSL---VIEWFKNGRPLN-NGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKV-YSDGSISY---LEFQRCKIPGESFIVVSAKNKLGEA 1915
            PS  K  E   VAN GD  A+L+  V   G P+  VQWYKD   L   S ++++ +  G A L +    + D+G+Y+C A N+ G   T  + L+V  DE     S        S A IE   +   ++ + I+  I  PP F       + LQ  ++   E +++ +T+++L    ++W+ NG  ++ N   +    D+G   L I+ V S D G +    +N  G+ +S     +V           +P    QY                            P F  +  ++   E +  +  V +   P P+I WF NE  +  +   ++ + DGS +Y   +     +  GE   V  AKNK+G+A
Sbjct: 16268 PSVKKQLEDI-VANVGDLIATLSCDV--DGVPSPKVQWYKDDKELTVPSMKYDSFYNEGLAELTVKNIVESDAGKYTCRATNDLGSIMTH-AKLSVKADEKKKKKSKT------SPAVIEKKKDRKTSKVVVIEEMIDMPPNF------HHLLQDDEAKIGEPKILVVTNTTLPEPTVDWYHNGEHISINDSNYLRKHDKGRYELHILSVDSTDEGKWKAVGKNAFGECESEAKLTVV-----------IP--DGQY---------------------------APSFGKQLSDVKCSESDILKLEVNIQANPAPEINWFRNESEIEHSQHHRLQFDDGSGNYSLTIIDAYAEDSGEYKCV--AKNKIGKA 16580          

HSP 2 Score: 70.0922 bits (170), Expect = 1.044e-10
Identity = 75/301 (24.92%), Postives = 109/301 (36.21%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLN 1780
            +G    L A ++ A +P L ++W ++ V +     F+ S       L I   F ED GEY+  AKN  G+ + +   L+V  +E  V +                    P+  D        P     P         G SV L  +VI   D   VI W K G+ LNN  ++ +  +    IL I  V   D G Y   A N +GQA + +   +V + +TV  K                                      P F+  PI++   E N A      SG P P  +WF N
Sbjct: 18240 DGSRVELAAELVQASEP-LQIRWLRNKVTIVDSPSFSYSRSENMVFLTIADVFPEDGGEYTVEAKNQSGIARCT-MQLDVRNNERSVAD------------------EAPRVFDFE------PTTRSDP---------GVSVELRAKVIGHPDP--VISWTKAGQKLNNEEKYMMRNEGDKFILRIANVTRADAGKYELTAINPSGQANAELELTVVQSTKTVGAK--------------------------------------PKFNESPISVQTCEKNRAELRASFSGTPAPACRWFYN 18465          

HSP 3 Score: 68.9366 bits (167), Expect = 2.391e-10
Identity = 71/265 (26.79%), Postives = 112/265 (42.26%), Query Frame = 2
Query:  752 RFSEPNMQQSFRSSRSGSVAHLDEITDP----------PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNG-RPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            R  EP      R   S + A LDE+             P F+  P+  +V  E    SL  +   +G+P   V W K+G+ L  G++++   +  F  L++ +    D G Y+C A NN G+  T  S ++V           LP +  E  AA  A   + K          + P F++ +PG       +S+ +E  V     +S++  W +N  R L    R+ + +D   A L  I V   D G Y C A N+ G A +N+
Sbjct: 17971 RLDEPRASIDSRP-ESAANAALDEVRAAINSRNKRVCRPKFMVKPKPRKVLEEY--KSLRLKTAISGNPMPQVHWDKEGIILETGNKYSIYNDGDFYYLEVHHVSTFDKGFYNCTAANNEGI-ITCTSEIDV-----------LPNK--EDSAAQVAKRKSRK--------EAKAPNFIEVLPGRSQANLNESLCVECSVSAYPCASII--WTRNSVRLLPQADRYTMSYDGECASLKFISVTPGDEGTYACEAVNELGSAVTNM 18208          

HSP 4 Score: 66.6254 bits (161), Expect = 1.182e-9
Identity = 53/206 (25.73%), Postives = 85/206 (41.26%), Query Frame = 2
Query:  920 GDPNLTVQWYKDGVPLAAGSRFNTSFER-GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSV-HLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVA 1531
            G P  T+ WYKDG+ L   +R     +R G + L+I+     D GEY+C A N+ G D T  +   V++  S          +T   +   +   +P      I    RPP   +P+      +G + +  +E    P    +  IEW+ +G+ +         FD   A L I     E  G Y C   NK G  ++  + ++ A
Sbjct: 16730 GKPIPTITWYKDGLKLIIENRMLQYTDRKGVSRLNIMNVVMNDDGEYTCEAVNSLGKDFTHCTVKVVDMGLSKT-------RLTPVRSRSRSRSRSPSVVGGEIQ---RPPVVTRPLADATVTEGNRELLEVEVDGFP----TPTIEWYHDGKLVAESRTLRTYFDGRVAFLKIYEAHEEHNGQYVCKVSNKLGAVETRAIVVVEA 16921          

HSP 5 Score: 61.2326 bits (147), Expect = 4.479e-8
Identity = 56/225 (24.89%), Postives = 98/225 (43.56%), Query Frame = 2
Query:  884 DPASLTARVIPAGDPNLTVQWYKDGVPLAA----GSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPG-LYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIV-FDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV-VRLLVATE 1537
            D  +++ R     +P+  V W KD V +           T  + G   L     F ED+G Y C A N  G   T+ +   +N++ +  +  H   E++ES+           T D+HI   I PP+F++ +     N Q    V +   V  +  + + + W K+G  +    ++ ++ F  G  IL I    + D+G Y C A ++ G + S+  V L ++ E
Sbjct:  834 DGQAMSLRCKITANPSAAVVWSKDDVNVEDWVLNKDVTTTVLDGGVCELLNPECFAEDAGLYKCTATNPHG---TAETAAFINVEGAEYIKDHEEAEISESVL----------TDDVHI---ILPPKFIETLTAETDNFQQLGYVRMVATVRSV--APITVSWQKDGMDIYENEKYEVMQFADGAQILTIRAPTNLDSGVYTCTAESEHGVSNSSCQVELTISAE 1040          

HSP 6 Score: 58.151 bits (139), Expect = 3.702e-7
Identity = 51/233 (21.89%), Postives = 95/233 (40.77%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTS--------PSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQS 1507
            P F   P+   +AN  D   +      +G P  +V+WYK+ + +    + + +     +IL++    +E++G ++C+ +N  G    S        P++L    D S+  N          +  ++ +LN                          + Q GQ + L  R+   ++S++   WFK+   + +  R+ +  D +    L    V S+DTG Y C   NK G A+S
Sbjct: 17249 PQFTISPQSKIIANRDDEFEIAVEF--SGTPTPSVKWYKENLQIVPDEKIDVATTSTSSILNL--KSQEENGTFNCLIENELGQASASCQVTIFNKPASLQSTPDHSLERN---------LVPTLQKALNN------------------------ESAQAGQQIMLTCRISSRSESTVA--WFKDDERIESAGRYELSSDKKSNHKLVCHAVQSQDTGKYRCVVTNKYGYAES 17442          
BLAST of Titin vs. TrEMBL
Match: A0A4E0RJF1 (Titin OS=Fasciola hepatica OX=6192 GN=D915_002543 PE=4 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 3.228e-128
Identity = 233/523 (44.55%), Postives = 327/523 (62.52%), Query Frame = 2
Query:  680 SKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQ-QSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQE-MTESIAAIEASL--NTPKTQDIHIDA--PIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSI---QKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAP---RS---KEASDAENLYANVQSRLRRSDKLS 2203
            S+PPV ++ ++ +Q+ ++  +A    S+ N++ +S     S S+  LD  T PP FV+HP      NEG+P S+T+RV PAGD  L V+WYK+G PLAA SRF T+F+RG+A+LD LYT ++D+G+YSCVA NN G DQ+S   + V  +E VV ++ LP+E M  S+AA+E  +  N       + D   P RPP F+KP+     ++     H ET + P  D+SL +EW+K+G+P++ GCRFN + DRGFAILDI+    ED G Y+C A+N  GQ QSNVV L  A E  +VT S L +ESV YLQSLD  N+E +   +    EE+E  + P FDI P+ +TV EG+PARF+VK  G+PRP++QW+++  L+         ++Y DG IS+LEF R   P    I V A+N LGE+  +  L + P+ DFRP+L+  +P      ENPFRKL+ LKKV  S EL +AF +T+P A+ L   ER +    RS    E+ +AENLY  VQ+ LR S + S
Sbjct:  372 SRPPVHQS-VDNLQVRRRLPSAGGAGSQRNIKVRSLPMRGSASMEALD-ATGPPQFVQHPCSQATVNEGEPLSITSRVRPAGDSTLRVEWYKNGKPLAASSRFTTTFDRGYAVLDFLYTNEDDTGDYSCVATNNQGQDQSSGCRITVVPEEGVVTDTQLPEESMVASLAAMENQMMQNGLDRGSRYRDESRPTRPPTFLKPLNPQVGIRESTPAHFETLIEPANDASLTVEWYKDGKPVSMGCRFNAILDRGFAILDILYCYPEDNGAYWCIAKNALGQVQSNVVDLQCAGEANIVTSSVLSKESVSYLQSLDNWNSEQMAGYDTVKVEEQETPAAPTFDILPVPITVTEGSPARFMVKAGGFPRPKVQWYIDGELLASQGGGGNWRIYQDGGISHLEFHRVGSPCTQQIRVVARNNLGESAVDTVLVIEPQVDFRPDLRHVEP------ENPFRKLAQLKKVERSNELSSAFNRTRPKALDLRRIERESEIKGRSVADAESIEAENLYTRVQAGLRTSRRSS 886          
BLAST of Titin vs. TrEMBL
Match: A0A504Y520 (Titin OS=Fasciola gigantica OX=46835 GN=FGIG_04181 PE=4 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 5.616e-127
Identity = 232/523 (44.36%), Postives = 327/523 (62.52%), Query Frame = 2
Query:  680 SKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQ-QSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQE-MTESIAAIEASL--NTPKTQDIHID--APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSI---QKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAP---RS---KEASDAENLYANVQSRLRRSDKLS 2203
            S+PPV ++ ++ +Q+ ++    P   S+ N++ +S     S S+  LD  T PP FV+HP      NEG+P S+T+RV PAGD +L V+WYK+G PLAA SRF T+F+RG+A+LD LYT ++D+G+YSCVA NN G DQ+S   + V  +E VV ++ LP+E M  S+AA+E  +  N       + D   P RPP F+KP+     ++     H ET + P  D++L +EW+K+G+P++ GCRFN + DRGFAILDI+    ED G Y+C A+N  GQ QSNVV L  A E  +VT S L +ESV YLQSLD  N+E +   +    EE+E  + P FDI P+ +TV EG+PARF+VK  G+PRP++QW+++  L+         ++Y DG IS+LEF R   P    I V A+N LGE+  +  L + P+ DFRP+L+  +P      ENPFRKL+ LKKV  S EL +AF +T+P A+ L   ER +    RS    E+ +AENLY  VQ+ LR S + S
Sbjct:  374 SRPPVHQS-VDNLQVRRR---LPSAGSQRNIKVRSLPMRGSASMEALD-ATGPPQFVQHPVSQATVNEGEPLSITSRVRPAGDSSLRVEWYKNGKPLAASSRFTTTFDRGYAVLDFLYTNEDDTGDYSCVATNNQGQDQSSGCRITVVPEEGVVTDTQLPEESMVASLAAMENQMMQNGLDRGSRYRDESKPTRPPTFLKPLNPQVGIRESTPAHFETLIEPANDATLTVEWYKDGKPVSMGCRFNAILDRGFAILDILYCYPEDNGAYWCIAKNALGQVQSNVVDLQCAGEANIVTSSVLSKESVSYLQSLDNWNSEQMAGYDTVKVEEQETPAAPTFDILPVPITVTEGSPARFMVKAGGFPRPKVQWYIDGELLASQGGGGNWRIYQDGGISHLEFHRVGNPCTQQIRVVARNNLGESAVDTVLVIEPQVDFRPDLRHVEP------ENPFRKLAQLKKVERSNELSSAFNRTRPKALDLRRIERESEIKGRSVADAESIEAENLYTRVQAGLRTSRRSS 885          
BLAST of Titin vs. TrEMBL
Match: A0A3R7CUY5 (Titin OS=Clonorchis sinensis OX=79923 GN=sls PE=4 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 4.969e-121
Identity = 225/479 (46.97%), Postives = 303/479 (63.26%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQE-MTESIAAIEASL--NTPKTQDIHIDAP--IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSI---QKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGA------PRSKEASDAENLYANVQSRLRRS 2191
            S S+  LD  T PP FV+HP      NEG+P ++TARV PAGD +L V+WYK+G PL+A SRFN  F+RG+A+L+ LYT ++D+G+YSCVA N+ G DQ+S   +NV  +E+V+ +S LP E M  ++AA+E  +  N       + D P   R PQFVKP+     L+     H ET + P  DSSL +EW+K+G+P++ GCRFN + DRGFA+LDI+    ED G Y+C A+N  GQ QSNVV L  + E ++VT S L +ESV YLQSLD   +E +   +    E+EE  S P FDI P+ +TV EGNPARFLVK  G+PRP++QW+L+  L+  T      +VY DG IS+LEF R   P    ++  A+N LGEA A   L + P+ DFRP+L+  +P      ENPF+KL+ LKKV  + EL +AF + +P A+ L   ER A          EA +AENLYA VQS+LR S
Sbjct:  359 SASIDGLDS-TGPPQFVQHPVGQINVNEGEPTNVTARVRPAGDSSLRVEWYKNGKPLSASSRFNAIFDRGYAVLEFLYTNEDDTGDYSCVATNDSGQDQSSSCHINVIPEENVITDSQLPDESMIANLAAMENQMMQNGLARGTRYRDEPKSTRLPQFVKPLNPQTGLRESAPAHFETIIEPANDSSLEVEWYKDGKPVSMGCRFNAILDRGFAVLDILYCYPEDNGAYWCMAKNSLGQVQSNVVELQCSPEASIVTNSVLSKESVSYLQSLDNWGSEQMSGYDRPRIEDEEAPSAPSFDILPVAITVTEGNPARFLVKAGGFPRPRVQWYLDGELLASTGGGGNWRVYQDGGISHLEFHRVGPPCTQKVLAVARNNLGEASAETVLVIEPQIDFRPDLRHVEP------ENPFKKLAQLKKVERTSELNSAFNRPRPQALDLRRIERQAEYNARAAAENEALEAENLYARVQSQLRTS 830          
BLAST of Titin vs. TrEMBL
Match: H2KSJ1 (Titin OS=Clonorchis sinensis OX=79923 GN=CLF_109481 PE=4 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 5.696e-121
Identity = 225/479 (46.97%), Postives = 303/479 (63.26%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQE-MTESIAAIEASL--NTPKTQDIHIDAP--IRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSI---QKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGA------PRSKEASDAENLYANVQSRLRRS 2191
            S S+  LD  T PP FV+HP      NEG+P ++TARV PAGD +L V+WYK+G PL+A SRFN  F+RG+A+L+ LYT ++D+G+YSCVA N+ G DQ+S   +NV  +E+V+ +S LP E M  ++AA+E  +  N       + D P   R PQFVKP+     L+     H ET + P  DSSL +EW+K+G+P++ GCRFN + DRGFA+LDI+    ED G Y+C A+N  GQ QSNVV L  + E ++VT S L +ESV YLQSLD   +E +   +    E+EE  S P FDI P+ +TV EGNPARFLVK  G+PRP++QW+L+  L+  T      +VY DG IS+LEF R   P    ++  A+N LGEA A   L + P+ DFRP+L+  +P      ENPF+KL+ LKKV  + EL +AF + +P A+ L   ER A          EA +AENLYA VQS+LR S
Sbjct:  359 SASIDGLDS-TGPPQFVQHPVGQINVNEGEPTNVTARVRPAGDSSLRVEWYKNGKPLSASSRFNAIFDRGYAVLEFLYTNEDDTGDYSCVATNDSGQDQSSSCHINVIPEENVITDSQLPDESMIANLAAMENQMMQNGLARGTRYRDEPKSTRLPQFVKPLNPQTGLRESAPAHFETIIEPANDSSLEVEWYKDGKPVSMGCRFNAILDRGFAVLDILYCYPEDNGAYWCMAKNSLGQVQSNVVELQCSPEASIVTNSVLSKESVSYLQSLDNWGSEQMSGYDRPRIEDEEAPSAPSFDILPVAITVTEGNPARFLVKAGGFPRPRVQWYLDGELLASTGGGGNWRVYQDGGISHLEFHRVGPPCTQKVLAVARNNLGEASAETVLVIEPQIDFRPDLRHVEP------ENPFKKLAQLKKVERTSELNSAFNRPRPQALDLRRIERQAEYNARAAAENEALEAENLYARVQSQLRTS 830          
BLAST of Titin vs. TrEMBL
Match: A0A183A5N1 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS2266 PE=4 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 7.911e-120
Identity = 217/486 (44.65%), Postives = 299/486 (61.52%), Query Frame = 2
Query:  794 RSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQE-MTESIAAIEASL------NTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSI---QKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYER------GAPRSKEASDAENLYANVQSRLRRSDKLS 2203
            RS       + T PP F++HP      NEG+P S+ ARV PAGD +L V+WYK+G PLAA SRF T+F+RG+A+LD LYT ++D+G+YSCVA N+ G DQ+S   + V  +E VV  + LP+E M  S+AA+E  +        P+ +D     P RPP F+KP+     ++     H ET + P  D++L +EW+K+G+P++ GCRFN + DRGFAILDI+    ED G Y+C A+N  GQ QSNVV L    E  +VT S L +ESV YLQSLD  +++ +   +    EEEE  + P FDI P+ LTV EG+PARF+VK  G+PRP++QW+++  L+  T      ++Y DG IS+LEF R   P    I   AKN LGEA  +  L + P+ DFRP+L+  +P      ENPFRKL+ LKKV  S EL +AF + +P A+ L   ER       +    E+ +AENLY  VQ++LR S + S
Sbjct:  404 RSSQSMEAIDATGPPQFIQHPIPQSTVNEGEPLSINARVRPAGDSSLRVEWYKNGKPLAASSRFTTTFDRGYAVLDFLYTNEDDTGDYSCVATNSQGQDQSSGCRITVIPEEGVVTETQLPEESMVASLAAMENQMMQNGMDRGPRYRD--EGRPTRPPTFLKPLNPQTGIREAAPAHFETLIEPANDATLTVEWYKDGKPVSMGCRFNAILDRGFAILDILYCYPEDNGAYWCVAKNALGQVQSNVVDLQCVGEANIVTSSVLSKESVSYLQSLDNWSSDQMAGYDTVKVEEEEAPAAPTFDILPVALTVTEGSPARFMVKAGGFPRPKVQWYIDGELLASTGGGGNWRIYQDGGISHLEFHRVGNPCTQQIRAVAKNNLGEAAVDTVLVIEPQADFRPDLRHVEP------ENPFRKLAQLKKVERSNELSSAFNRPRPQALDLRRIERENEFKARSAAEAESIEAENLYTRVQAQLRTSRRSS 881          
BLAST of Titin vs. Ensembl Cavefish
Match: ENSAMXT00000044348.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:23245281:23271894:-1 gene:ENSAMXG00000032661.1 transcript:ENSAMXT00000044348.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 3.547e-23
Identity = 74/248 (29.84%), Postives = 119/248 (47.98%), Query Frame = 2
Query: 1247 PQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ----ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRT 1978
            P F K +  +   Q G  VH E R+ PI D ++++EW  +G+PL    R  +V + G+  LD     + D+G   C A NK G  Q++   LLV   + +V ++QLP+    + +  ++ L  +    V       + +      P   + P  + V EG  A+F  +V+GYP P++ W+LN  LV+ +   ++  DG I YLE   CK      + V A+N  G         V  + DFR  L++T
Sbjct:   23 PHFKKKLTSVRLKQFG-PVHFECRLTPIGDPTMIVEWLHDGKPLEAANRLRMVNEFGYCSLDYEAAYARDSGVITCRATNKFGIDQTSAT-LLVREGKGLVEETQLPEGRSAQRIDEIKRLAHEGPSGVSGEEVTEKIK------PEIVLLPEPVRVLEGETAKFRCRVTGYPAPKVNWYLNGQLVLKSKRFRLLFDG-IHYLEVVDCKSYDAGEMKVLAENPEGVIEHTVKFEVQQKEDFRTVLRQT 261          

HSP 2 Score: 99.3673 bits (246), Expect = 4.481e-22
Identity = 92/363 (25.34%), Postives = 145/363 (39.94%), Query Frame = 2
Query:  887 PASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQ-EMTESIAAIE--ASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYS--DGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            P     R+ P GDP + V+W  DG PL A +R     E G+  LD    +  DSG  +C A N FG+DQTS +TL V   + +V  + LP+    + I  I+  A           +   I+P   + P P    +  G++     RV         + W+ NG+ +    RF ++FD G   L+++   S D G+    A N                          P+  +++    ++Q  ED  R+  R  +             P   TV  G  A F  +V+G P P +QW  + C + P     + +  DGS  +L+    +          A N  GEA  +A L V    +++
Sbjct:   39 PVHFECRLTPIGDPTMIVEWLHDGKPLEAANRLRMVNEFGYCSLDYEAAYARDSGVITCRATNKFGIDQTS-ATLLVREGKGLVEETQLPEGRSAQRIDEIKRLAHEGPSGVSGEEVTEKIKPEIVLLPEP--VRVLEGETAKFRCRVTGYPAPK--VNWYLNGQLVLKSKRFRLLFD-GIHYLEVVDCKSYDAGEMKVLAEN--------------------------PEGVIEHTVKFEVQQKEDF-RTVLRQTKG------------PAPCTV--GGNAVFEYRVAGVPLPSVQWLKDSCHIQPGKFCNMVNNVDGS-GFLKIINVQKNDSGLYSCRASNLRGEASCSADLIVFLGTNYK 353          
BLAST of Titin vs. Ensembl Cavefish
Match: OBSCN (obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF [Source:HGNC Symbol;Acc:HGNC:15719])

HSP 1 Score: 92.0485 bits (227), Expect = 1.401e-18
Identity = 103/407 (25.31%), Postives = 161/407 (39.56%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQF-VKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDV---------------------DRSNFRYXX--XXXXXSLPHFDIKPI---NLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            P F+  P+ + ++  G  A+L+  V+  G P   V W K  + +  G RF T+ +     L I     +DSG+Y C AKN  G +  +  TL V L E VV                                  R P F VKP+     L G  +        P  +     EW K+GR L    R  I  D   + L I  + S D+G Y C A+N  G+AQ+  V L+V  ++T +  S      + +LQ    +  +D+                     D  N R     E++  SL H  +K +      V EG  A+    V+G+P+PQI W  +   +       +Y D + ++ L+   CK         +A N  G+  +   + V P+  F+ +L+
Sbjct:   10 PRFLTRPKAFSLSV-GRDATLSCTVV--GTPVPAVTWEKGKLHICTGGRFKTAEDGDVYRLTIYDLTLDDSGQYMCRAKNTVG-EAYAAVTLKVGLPEPVV---------------------------------DRAPAFTVKPVSSRVGLGGDVTFFCRVAARPTAN----FEWEKDGRYLGETNRIKITSDSESSSLRIQSIRSMDSGTYTCRAQNPIGRAQAAAV-LVVDLQDTRLLSSDKSTSLLSHLQKRKEEMCKDISLYRMSDSAALSSSSSSRIVEDHVNLRLTTDQEQQVSSLTHKLLKGVFTRTCMVTEGKHAKLSCFVTGHPKPQIIWRKDRGNISEGRRHIMYEDQAENFILKILYCKQSDNGLYTCNASNMAGQTYSAVLVIVKPKVPFKRKLE 374          
BLAST of Titin vs. Ensembl Cavefish
Match: OBSCN (obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF [Source:HGNC Symbol;Acc:HGNC:15719])

HSP 1 Score: 89.7373 bits (221), Expect = 1.020e-17
Identity = 96/373 (25.74%), Postives = 150/373 (40.21%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQF-VKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
            P F+  P+ + ++  G  A+L+  V+  G P   V W K  + +  G RF T+ +     L I     +DSG+Y C AKN  G +  +  TL V L E VV                                  R P F VKP+     L G  +        P  +     EW K+GR L    R  I  D   + L I  + S D+G Y C A+N  G+AQ+  V L+V  ++T +  S      + +LQ    +  +D+  S +R         +    +      V EG  A+    V+G+P+PQI W  +   +       +Y D + ++ L+   CK         +A N  G+  + A L ++ E
Sbjct:   10 PRFLTRPKAFSLSV-GRDATLSCTVV--GTPVPAVTWEKGKLHICTGGRFKTAEDGDVYRLTIYDLTLDDSGQYMCRAKNTVG-EAYAAVTLKVGLPEPVV---------------------------------DRAPAFTVKPVSSRVGLGGDVTFFCRVAARPTAN----FEWEKDGRYLGETNRIKITSDSESSSLRIQSIRSMDSGTYTCRAQNPIGRAQAAAV-LVVDLQDTRLLSSDKSTSLLSHLQKRKEEMCKDI--SLYR---------MSDSGVFTRTCMVTEGKHAKLSCFVTGHPKPQIIWRKDRGNISEGRRHIMYEDQAENFILKILYCKQSDNGLYTCNASNMAGQTYS-AVLVIVKE 328          

HSP 2 Score: 74.3294 bits (181), Expect = 4.847e-13
Identity = 90/365 (24.66%), Postives = 144/365 (39.45%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER-GFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI----RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWF----LNECLVIPTSI--QKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            +G P S    +I  G P  +V+W+KDG  L     +  + ++ G   L I      D G Y CVA+N+ G+  +S + L V +  S   ++      T S  + +  +++ + +D      +    + PQ V  +  L+   G  +  +  RV         + WFK+G PL    R  +  +RG   L+I  V  EDTG+Y  +  N AG A S+   +++   E      ++P                     ++   + +E    P F  +  N TV++G      VKV G P P I W     + E L I       KV S G +  L                A N  G+ +  A L V
Sbjct: 4706 DGYPVSFDCVII--GKPPPSVRWFKDGKMLQEDDHYMINEDQEGCHQLIITAVRPVDMGVYRCVAENDSGI-ASSKAELRVEMSCSSDYDTAADATETSSYVSAKGYVSSSEHRDTEAFESVVEDEQLPQVVDELHDLFLSPGAPNAKMSVRVKGFPAPK--VYWFKDGSPLQPSKRILVSSERGVYSLEIAEVTREDTGEYSAYISNAAGSAYSSARMVILGPGE------RMP---------------------DYGKRDSKEPLKPPRFLERFCNRTVKQGASITLSVKVEGSPAPTINWLKEEPMKEVLWIKADTPGYKVASSGCLHSLILMDVGKEHSGTYTCIATNSAGQTLNTARLDV 5038          
BLAST of Titin vs. Ensembl Cavefish
Match: ENSAMXT00000046570.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:23526696:23532900:-1 gene:ENSAMXG00000029102.1 transcript:ENSAMXT00000046570.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 1.235e-14
Identity = 87/400 (21.75%), Postives = 160/400 (40.00%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSL-----------DIQNTEDVD--RSNFRYXXXXXXXSLPHFDIKPIN------------------LTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            PSF +  +  + + +G  A L   V  +G   +++ W+K+   + A  +    F    A L+I      DSG Y+C+A N  G DQ S   L V                                          PP+F +    +  ++ G++V  E +V+   +  + I WF++G  ++   +  + F    A L+I G  ++D+G Y+C ARN+AG ++S  + + V  E  V+ K   P E V    +L           +I   +D    +++ ++   ++N S+   D++  +                  + V  G+P  F  KV+G P  +++W      VIP+    +    S S L+ Q  ++      +    N +       TL+V+
Sbjct:   67 PSFTRKLKEME-SIKGSFAQLDCLV--SGSLPISITWFKENKEIEADEKHKCIFYENAASLEITRLDSSDSGSYTCIATNKAGTDQCS-GVLKVK----------------------------------------EPPKFTRKPDRVSVVRPGEAVFFECQVVGTPE--IDIYWFRDGNEISQSSKHKMSFSDSLARLEITGAETKDSGVYYCEARNEAG-SESCSMEMKVK-EPPVIVKPFSPVEVVNGFNALFECQVKGTAPFEITWQKDSKEIKASTKHLISQKNGSVMILDVQKCDALDVGEYNCIITNEVGKIINVTAGDPVSFECKVTGTPELKVKWSKGGKEVIPSRQHSLAFSNSTSNLKIQSVQLEDGGSYLFEVSNHISVCKCEVTLNVV 418          

HSP 2 Score: 61.6178 bits (148), Expect = 1.642e-9
Identity = 51/227 (22.47%), Postives = 84/227 (37.00%), Query Frame = 2
Query:  821 EITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRG-FAILDIIGVISEDTGDYFCFARNKAGQ 1498
            ++ +PP F + P+R  V   G+      +V+  G P + + W++DG  ++  S+   SF    A L+I     +DSG Y C A+N  G +  S                            +E  +  P      I  P  P + V     L+  Q   +   E            I W K+ + +    +  I    G   ILD+    + D G+Y C   N+ G+
Sbjct:  155 KVKEPPKFTRKPDRVSVVRPGEAVFFECQVV--GTPEIDIYWFRDGNEISQSSKHKMSFSDSLARLEITGAETKDSGVYYCEARNEAGSESCS----------------------------MEMKVKEPPV----IVKPFSPVEVVNGFNALFECQVKGTAPFE------------ITWQKDSKEIKASTKHLISQKNGSVMILDVQKCDALDVGEYNCIITNEVGK 335          
BLAST of Titin vs. Ensembl Cavefish
Match: ENSAMXT00000050397.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:23536752:23542443:-1 gene:ENSAMXG00000030310.1 transcript:ENSAMXT00000050397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 6.860e-13
Identity = 56/236 (23.73%), Postives = 92/236 (38.98%), Query Frame = 2
Query:  803 SVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            ++  L +I +P   V       V   GD A+L   V  +G P+L V+W +DG  +    ++  SF+   A L IL   + DS EY+    N  G D++                                               I PP F K +  + +   G SV ++ +V       + + WFK G+ +  G ++ I F    A L I  + + D G + C A N AG ++++
Sbjct:  118 TIILLFKIPEPAKIVDKAPSISV-TAGDSATLECTV--SGSPDLKVKWLRDGKEMTTSRKYKISFKENVACLKILSAERGDSSEYTVEVSNKVGKDRSD---------------------------------------------KIIPPTFTKSLKKV-DSNVGASVQMDCKVSG--SQPMTVSWFKEGKEITPGEKYQIEFRESTATLKISHLETSDAGVFTCRATNAAGHSETS 302          
BLAST of Titin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000826.1 (pep scaffold:Pmarinus_7.0:GL476876:251045:270583:1 gene:ENSPMAG00000000753.1 transcript:ENSPMAT00000000826.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.783 bits (299), Expect = 9.327e-28
Identity = 108/414 (26.09%), Postives = 174/414 (42.03%), Query Frame = 2
Query:  806 VAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESI--AAIEASLNTPKTQDIHI-------------DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLD------IQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRT 1978
            V    E  + P FV+ P    V  EG    LTAR I    P++  Q   D +       +     +G + L I      D   Y+ +A N  G      +     +    +L+   P+   + I    +   +  P  + +H+             D   +   F K       L+    VH E ++ PI D  +V+EW  +G+PL    RF IV + G+  LD       D+G   C A NK G  Q++   L+V  E+++V +SQLP+       LQ L+        + EDV  +  +          P+F + P    V +G  AR+  +V+G P+P++ WFLN   +  +   ++  DG I YLE   CK      + + A+N  G     A L ++P+ DFR  L+++
Sbjct:  280 VVEAKERLEKPRFVEKPNNVCV-KEGSAVQLTARAIGNPTPDIVWQRNNDIIFPHKFPHYEVENTKGESTLTIYSAKPSDMAWYTIIALNRAGR-----TMARCKVQVEAMLSDRQPEPERKLIIPKGVYRDIAPPVLEPLHLRHGQDQWNEGDLYDKETQQRPFFKKKLTSVRLKQFGPVHFECQMTPIGDPHMVVEWLHDGQPLQAANRFRIVCEFGYCSLDYEVAYPRDSGIITCRATNKFGCDQTSG-SLIVKDEKSLVEESQLPEGRRGFHRLQELEKGMAGTAVSKEDVPDAREK----------PYFVMYPEPCRVYDGETARYHCRVTGVPQPKVLWFLNGQRIHRSKRFRLRYDG-IHYLEIVDCKSYDTGEVKLVAENSEGSVECKAVLEILPKQDFRAVLRKS 675          
BLAST of Titin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002502.1 (pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-1 gene:ENSPMAG00000002253.1 transcript:ENSPMAT00000002502.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 1.550e-27
Identity = 114/423 (26.95%), Postives = 185/423 (43.74%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE--RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHI--------------DAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTED--VDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRT---DPAILLRNENPFRKLSTLK 2035
            P FV+      V  EG P  L+ +   AG+P   + W K+   +++    N   E   G + L I  T + DS  Y+  A N  G D T      VN++          + +          +  P+ + +H+                  + P F K +  +   Q G  VH E R+ PI D ++V+EW  + +PL+   RF +V + G+  LD       D+G   C A NK G  Q++   L+V  E+++V +SQLP+    +Q +Q ++ Q  E   V  S     E    +  P   + P    V EG  AR+  +V+GYP+P++ W+LN  L+  +   ++  DG I YL+   CK      + + A+N  G+A     + V    DFR  L++     P  L     PF ++  +K
Sbjct:  956 PHFVEKLRNVSV-KEGAPVQLSVKA--AGNPIPDIVWLKNSEIISSQKFPNMRIEGATGESALSIDTTTQHDSAWYTSTAINKAGRDTTR---CKVNVEAEAFEPEPERKMVISKGIYKLKEVTAPELEPLHLRYGQEQWEEGDLYDKEKEQKPLFKKKLTSVRLKQFG-PVHFECRLTPIGDPTMVVEWLHDSKPLDAANRFRMVNEFGYCSLDYEVAYPRDSGIITCRATNKYGADQTSAT-LIVKDEKSLVEESQLPEGRRGIQRIQEMERQALEGGIVSVST----EGTLEKVKPEIVLFPEPARVLEGETARYRCRVTGYPQPRVSWYLNGQLIHKSKRYRLRYDG-IYYLDIVDCKSYDSGEVKLLAENPEGKAEHTVKIEVQLREDFRTLLRKAPEPKPEGLAEPGKPFFEVVKVK 1365          

HSP 2 Score: 78.9518 bits (193), Expect = 3.664e-15
Identity = 61/232 (26.29%), Postives = 94/232 (40.52%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVK---PMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            + +P  F   P    V   GD AS     +  G P + V WYK+   + AG +F  +   G + LDIL T   DSG Y+C  +N+ G D  + + L V                                        + PP FVK   PM G +    G SV+ E +V    +  + + W+K  + L +G ++  +F    A+L++      D G Y C A N  G A+++
Sbjct: 6527 VKEPAKFFSKPSDLDV-KAGDSASFICSFV--GTPKIAVNWYKEDNQIVAGHKFQVTTVEGQSTLDILATEISDSGNYTCKIQNDSGQDNCT-ALLKV----------------------------------------LDPPYFVKSLEPMEGTF----GTSVYFECQVAGAPE--IRVTWYKGSQKL-SGAKYKTMFQHNTAVLEVKNFEKADVGTYSCEAENSLGSAKTS 6707          

HSP 3 Score: 75.0998 bits (183), Expect = 5.749e-14
Identity = 61/233 (26.18%), Postives = 96/233 (41.20%), Query Frame = 2
Query:  821 EITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            ++ +PP F K     +V+ EG  A+L A +I  G   +T+ W KD + +A     + S++   AIL I+   K  +GEY+C AKN  G  Q+  + L+V                                          P  FV  M  + N+  G+    E RV   +PIT     + W K+   L +  +F + F    A L ++     DTG+Y+C  +N  G +  N
Sbjct: 4524 KLKEPPKFTKKFINSEVS-EGSSATLNATLI--GSQPMTIAWSKDKLKIAEDENHSISYKDNHAILTIVKAEKSHAGEYTCDAKNEAGA-QSCSAVLSVK----------------------------------------EPATFVDKMESV-NVTVGEVAFFECRVAGSVPIT-----VRWRKDHELLKSSKKFKMTFTNNVASLKLMSTDKFDTGEYYCEVQNDGGSSICN 4706          

HSP 4 Score: 74.3294 bits (181), Expect = 9.636e-14
Identity = 67/222 (30.18%), Postives = 100/222 (45.05%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFV-KPMPGLYNLQGGQSV-HLETRVIPITDSSLVIEWFKNGRPLNNGC--RFNIVFDR--GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL 1525
            EG+   +  +V  AG P   + W+++   +   + F  +F+ G A L I   F EDSG ++C A N  G   TS S L V  +ES+ L               EAS        I        P FV KP P  + ++GG  V H + +  P       + W K+G PL  G   R+ + +++  G   L+I    S+D G+Y C  RNK G A ++  RL+
Sbjct:  390 EGESVRMECQV--AGFPTPAIMWFREEYRIERSADFQIAFQAGVASLTIREAFAEDSGRFTCTATNEAGTVSTS-SYLLVQGEESIFLEDS------------EASGTDTGGDGI-------APYFVQKPQPQ-HLVEGGSVVFHCQIKGSPKPH----VYWKKSGIPLTTGYRRRYKVHYNKETGECSLEISMTFSDDAGEYTCVVRNKQGDAAAS-ARLM 583          

HSP 5 Score: 71.2478 bits (173), Expect = 1.023e-12
Identity = 66/241 (27.39%), Postives = 98/241 (40.66%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            +  F S+ S +   + E  +PP F +  + +Q A EG  A+   RV   G P  +  WYK GV L++G  +  S E   A LDI       +GEY+C   N+  +D  S S                        A +EA       +D  +     PP F K  P    +  G+S  LE  +       + I W KN R + +   + + F    A L ++    ED+G Y C A N+ G
Sbjct: 5573 ENDFGSATSLASLSVSERKNPPYFTRKLKDWQ-AVEGTAATFDCRV--TGTPPFSFIWYKHGVELSSGEDYVISAEENVATLDIHNVKLTHAGEYTCRVFND--VDSASCS------------------------AKLEA-------KDKKV-----PPSFEKK-PDPVEVTAGESFELECLI--AGSRPIRISWLKNNREIRSVGNYKLFFYDNAARLTVLKAGKEDSGTYVCKAVNEVG 5769          

HSP 6 Score: 70.4774 bits (171), Expect = 1.643e-12
Identity = 58/224 (25.89%), Postives = 95/224 (42.41%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            +PP+F+K  E  ++   G    L  +V  AG P + V WYK    L +G +   +F+   A L++    K D+G+YSC A+N+FG    S ++L                          ASL+  + ++        PP F + +     ++G  +   + RV      S +  W+K+G  L++G  + I  +   A LDI  V     G+Y C   N    A
Sbjct: 5496 EPPNFIKGLEPTEIVV-GSTVHLECQV--AGTPQIRVSWYKGSQKLKSGDKCKMAFKNNLATLELRSLTKADTGDYSCKAENDFG----SATSL--------------------------ASLSVSERKN--------PPYFTRKLKDWQAVEGTAAT-FDCRVTGTPPFSFI--WYKHGVELSSGEDYVISAEENVATLDIHNVKLTHAGEYTCRVFNDVDSA 5675          

HSP 7 Score: 68.5514 bits (166), Expect = 5.895e-12
Identity = 73/289 (25.26%), Postives = 115/289 (39.79%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMD-----------QTSPS------TLNVNLDESVVLNSH----LPQEMT-------------------ESIA--------AIEASLNTPK----------TQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQ 1498
            + E  +PPSF +      V   G+PA L   V   G P   + W KD   +  G+ +  SF     +L IL T K DSG Y C A N  G D           + +P+      +LNV   E   L  H    +P ++T                   E+IA         +++ + T            + +I +     PP FV+ +     +    +  ++ RV   +PI     ++ W KNG  + +G ++  +F+   A L+I+ V   D G Y C A N AG+
Sbjct: 6146 VKERKNPPSFDQQLAPASV-TAGEPADLGCHV--TGSPPFKISWLKDNKEIRPGTNYKFSFVDNTPLLTILKTDKRDSGVYVCRAANEAGYDTSCAPVTIKERRVAPTFDQKLESLNVTTGERAELECHVTGSVPIKVTWAKDNREIRAAGNYRMIFMENIARLTILKVGKLDSGIYTCAASNDVGSDVTSTEITVKDQAVPPSFVRKLKKTDAILHS-TAQMDCRVAGTVPI-----LVAWSKNGVEIVDGDKYRCLFEENTASLEILKVDKSDDGSYTCTATNVAGR 6425          

HSP 8 Score: 68.5514 bits (166), Expect = 6.923e-12
Identity = 56/233 (24.03%), Postives = 93/233 (39.91%), Query Frame = 2
Query:  809 AHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQS 1507
            A+L    +  +F +  +  QV+N G+ A  +     +G P + V WYK    +    ++  +   G + L++L   K D G Y+C  +N  G D +  +TL                                        A + PP F+K +     +  G +VHLE +V       + + W+K  + L +G +  + F    A L++  +   DTGDY C A N  G A S
Sbjct: 5396 ANLTVKAERANFRRRVKDSQVSN-GETAVFSTSF--SGTPEIVVFWYKQNNLIEESDKYRVAISEGESTLEVLNVDKSDEGIYTCKIQNEAGED-SCLATL----------------------------------------ATLEPPNFIKGLEPT-EIVVGSTVHLECQVAGT--PQIRVSWYKGSQKLKSGDKCKMAFKNNLATLELRSLTKADTGDYSCKAENDFGSATS 5581          

HSP 9 Score: 67.0106 bits (162), Expect = 1.641e-11
Identity = 80/371 (21.56%), Postives = 131/371 (35.31%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSS-LVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI 1942
            PPSFV+  ++   A     A +  RV  AG   + V W K+GV +  G ++   FE   A L+IL   K D G Y+C A N  G D  S +TL++                                        I PP F+  M     L G ++    T    ++ +  L+++W+K  + L      +I F    A+L +  V     G+Y C   N AG+              T  + S   +E  ++                                 KP +L V+ G+ A F+    G P+  + W+  +  ++     +V +    S L+    +I          +N  G+    A L V+
Sbjct: 6344 PPSFVRKLKKTD-AILHSTAQMDCRV--AGTVPILVAWSKNGVEIVDGDKYRCLFEENTASLEILKVDKSDDGSYTCTATNVAGRDSCS-TTLSI----------------------------------------IEPPSFLMKMEPQEVLSGSRA----TFQCAVSGTEPLLVKWYKGNQELRTDISHSISFRDSVALLIVEKVKLAFAGEYSCQVSNSAGK--------------TSCSASLFVKEPAKFFS-------------------------------KPSDLDVKAGDSASFICSFVGTPKIAVNWYKEDNQIVAGHKFQVTTVEGQSTLDILATEISDSGNYTCKIQNDSGQDNCTALLKVL 6621          

HSP 10 Score: 66.2402 bits (160), Expect = 3.229e-11
Identity = 54/224 (24.11%), Postives = 92/224 (41.07%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            +TD PSF K  +  + A  G P  L   V    D  +TV W K G  +    + + +F+   A+L+IL +   D+G+Y C A +  G + T+ S++ V  D +              + A++  +   K   +H+D  ++    +K                             + WFKN   +    R  + F    A+L+I    +ED+ DY C A+N+ G
Sbjct: 4246 VTDKPSFSKALQPVKAAV-GTPLRLECEV--DDDKGVTVAWTKSGKEIRPSRKLSFTFKNKLAVLEILKSELADTGDYVCTASSEAGSESTA-SSVEVKADPA-------------GLRALQPEVKEAKGL-VHLDCSLKGSPVIK-----------------------------VTWFKNDNEVKADGRVQLSFVNNVAVLEIRDSETEDSADYTCEAQNEVG 4422          

HSP 11 Score: 62.7734 bits (151), Expect = 3.477e-10
Identity = 61/235 (25.96%), Postives = 97/235 (41.28%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE 1540
            PSF+K P +  VA EG  A+  A +  +G P   V W++DG  +++      SF  G A L I       SG+YS  A N  G                                          T ++ + A   PP F + +  + ++  G+ V L+ RV  I  ++  +++F+ G  +++   F +V D     L I     +D+G Y   A N  G+A S+  +LLV  EE
Sbjct:    6 PSFIK-PLQSVVALEGSAATFEAEI--SGLPVPEVSWFRDGQAISSAPGVEISFSSGRATLTISAVSAAQSGKYSLRATNGSG--------------------------------------QATSTAELLVTAQTAPPNFTQRLQSI-SVSQGKEVRLDVRVTGIPAAT--VKFFREGAEIHSSQDFRLVQDGDLYSLIIAEAYPQDSGTYSVTASNNVGRATSS-AQLLVTGEE 195          

HSP 12 Score: 60.4622 bits (145), Expect = 1.902e-9
Identity = 55/236 (23.31%), Postives = 83/236 (35.17%), Query Frame = 2
Query:  788 SSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            S+ S ++  + E  +PP F +  +  Q   EG  A    R    G P   V W+K G  +  G ++  SFE     L+IL     D  EYSC   N+ G    + S L V   ++       P    + +A    +   P     H+     PP                                 I W K+ + +  G  +   F     +L I+     D+G Y C A N+AG
Sbjct: 6041 SATSVAMLTVTERKNPPVFTRKLKDVQ-GVEGGAAMFDCRA--TGTPPFAVAWFKHGKEITPGEKYRMSFEENVVFLEILNLATNDEEEYSCTVSNDVGKISCAAS-LEVKERKN-------PPSFDQQLAPASVTAGEPADLGCHVTGS--PP-------------------------------FKISWLKDNKEIRPGTNYKFSFVDNTPLLTILKTDKRDSGVYVCRAANEAG 6232          

HSP 13 Score: 60.077 bits (144), Expect = 2.390e-9
Identity = 59/212 (27.83%), Postives = 91/212 (42.92%), Query Frame = 2
Query:  881 GDPASLTARVIPAGDPNLTVQWYKDGVPLAA-GSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQS 1507
            G  A   +R++ A  P   V WYKD V +++    +  + + G+  L+I +    D G Y C A N  G + +  + LN++            Q   +S    E++L    T+         PP+F +P+ G      G  V  E +VI  P  D    I WF+N   L  G +F++       IL +  V   D G Y C A N +G AQ+
Sbjct: 2919 GAKAVFASRILAA--PAANVAWYKDDVKISSMDGHYLIANKSGYVSLEIKHVSLLDRGMYLCKAVNGAG-ESSCRAALNIS------------QRFADSGDRGESALEFLITE--------APPKFTQPL-GTKRCAPGCDVSFECQVIGEPAPD----IAWFRNDVELRGG-QFDVRSMGKKQILTVKNVSKCDEGSYKCTASNSSGTAQT 3101          

HSP 14 Score: 59.3066 bits (142), Expect = 3.586e-9
Identity = 91/414 (21.98%), Postives = 152/414 (36.71%), Query Frame = 2
Query:  833 PPSFVKHPERYQV-ANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMP---GLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQ-AQSNVVRLLVAT----EETVVTKSQLPQESVQYLQSL-------------DIQNTEDVDRSNFRYXXXXXXXSLPHFD--------IKPINLTVEEGNPARFLVKVS------------GYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            PPSF K P+  +V A E    S     + AG   + + W K+   + +   +   F    A L +L   KEDSG Y C A N  G D  S           V +  H                               PP FV+ +    G+ N      V LE ++   +PI+     + W+K+   L +  ++ +        L+I+ +   D G+Y C   N AG+ + S ++R+ +A      +T+  +  L  E V++ QS+             D +  +  D  +  +        L   D         +  N    E   A+  VKVS            G P  +  WF ++ L+     +K     +++ LE +  +       V  A+N +G A + A L+V
Sbjct: 5689 PPSFEKKPDPVEVTAGE----SFELECLIAGSRPIRISWLKNNREIRSVGNYKLFFYDNAARLTVLKAGKEDSGTYVCKAVNEVGSDTCSA---------QVTVKDHAV-----------------------------PPTFVRQLKETDGILN----APVSLECKISGTMPIS-----VSWYKDQEELFDSQKYKLTTSDHTVNLEILELGIADGGNYTCKVNNVAGKDSCSAILRVTIAEPPGFSKTLEYQEVLLGEYVRF-QSIVTGTEPLSVKWFADSKELKPTDNCSISFRGNRALLELSQVDSASAGEFTCQVANAAGIETCSAKLFVKVSEPGSVRLECEVAGTPVIKTSWFKDDVLITSGLNRKPVQKLNLAILELRNVQYSESGEYVCKAENDIGSATSVAMLTV 6050          

HSP 15 Score: 57.7658 bits (138), Expect = 1.113e-8
Identity = 55/237 (23.21%), Postives = 92/237 (38.82%), Query Frame = 2
Query: 1241 RPPQFVKPMPGLYNLQG-GQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
            + P F+KP+  +  L+G   +   E   +P+ +    + WF++G+ +++     I F  G A L I  V +  +G Y   A N +GQA S        T E +VT    P    Q LQS                                  ++V +G   R  V+V+G P   +++F     +  +   ++  DG +  L              V+A N +G A ++A L V  E
Sbjct:    4 KAPSFIKPLQSVVALEGSAATFEAEISGLPVPE----VSWFRDGQAISSAPGVEISFSSGRATLTISAVSAAQSGKYSLRATNGSGQATS--------TAELLVTAQTAPPNFTQRLQS----------------------------------ISVSQGKEVRLDVRVTGIPAATVKFFREGAEIHSSQDFRLVQDGDLYSLIIAEAYPQDSGTYSVTASNNVGRATSSAQLLVTGE 194          

HSP 16 Score: 57.3806 bits (137), Expect = 1.534e-8
Identity = 64/246 (26.02%), Postives = 88/246 (35.77%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQ 1561
            + + PSF K  E  +V    D   +T  V   G P   V+W K+   L    ++    E   A L I      D G+YSC  KNN G D+   S  N+ L E                                      PP+F K       +  G S  L   +I      + I W K+   +      +I +    AIL I+       G+Y C A+N+AG AQS    L V    T V K +
Sbjct: 4432 VKEIPSFKKPLESMEVRGNSD---VTLEVELDGSPPFDVKWVKNARELPKIDKYRAKLENTTATLRIGNFSAADVGQYSCKVKNNVGKDE---SHANIKLKE--------------------------------------PPKFTKKFIN-SEVSEGSSATLNATLI--GSQPMTIAWSKDKLKIAEDENHSISYKDNHAILTIVKAEKSHAGEYTCDAKNEAG-AQSCSAVLSVKEPATFVDKME 4629          

HSP 17 Score: 53.9138 bits (128), Expect = 1.649e-7
Identity = 54/221 (24.43%), Postives = 87/221 (39.37%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            PPSFVK  E  + +  G    L A V  +G   + + W KDG  ++ G  +    E    IL I        G Y+C A N FG D T  + L+V    S           ++++  ++A++ TP   +  +D                                  D  + + W K+G+ +    + +  F    A+L+I+     DTGDY C A ++AG
Sbjct: 4156 PPSFVKKLEPIK-SFSGKAVQLIAEV--SGTHPIAIVWSKDGDDISDGDSYAIRSEHNQCILAIGNVAVAHQGTYACKATNEFGSD-TCSAQLSVTDKPS----------FSKALQPVKAAVGTPLRLECEVD---------------------------------DDKGVTVAWTKSGKEIRPSRKLSFTFKNKLAVLEILKSELADTGDYVCTASSEAG 4329          

HSP 18 Score: 52.7582 bits (125), Expect = 3.805e-7
Identity = 83/390 (21.28%), Postives = 131/390 (33.59%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN-LTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            + S  S+++ +     E   PPSF +  +  Q    GD A   ARV   G P   V W+     L+   +   SFE   A L I      D+GEY+C   N  G    S       LD   V          + +  +EA +  P   + H+                            T  +PI      I W K+ + +  G    + F      L I  +   D+G+Y C A N  G   S        T ET + + ++                                   P F  KP+  L  EEG   +   +VSG     I W  ++  +     +++    +I+ +  +  K+      V  A+N+ G A    TL++
Sbjct: 6698 ENSLGSAKTSASLAGKERKHPPSFSRMLKNMQQVI-GDCAKFDARV--TGTPPFHVSWFLGDSELSYSDKHVISFEDNVASLSIFSLKVSDAGEYTCKVSNEDGSISCS-----AKLD---VTERKTKPTFDQKLEPVEAVVGDPAELECHL----------------------------TGSLPIK-----IFWMKDKKDIRPGPNCKMTFFDNTPHLTIYKLDKSDSGEYTCKAVNDIGSDNS-------CTCETAIAERKVA----------------------------------PMFTKKPLEILDEEEGKGVKLDSRVSGSQPIAITWTKDDKDLHAHPGRELSFKNNIALMSLKSTKVSDSGLYVCKAENEAGTATFKVTLNI 7002          

HSP 19 Score: 52.7582 bits (125), Expect = 4.003e-7
Identity = 58/226 (25.66%), Postives = 91/226 (40.27%), Query Frame = 2
Query:  818 DEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            +E  DPPS +K  E  +V  EGDPA    ++     P +  QW++  V +   +++  S E   + L+I+ T   ++GEY+C A N  G                           T  +  IE                +RPP FVK +  + +   G++V L   V       + I W K+G  +++G  + I  +    IL I  V     G Y C A N+ G
Sbjct: 4056 EEPIDPPSIIKRLEPQRV-REGDPALFECQIEEV--PLVNFQWFRGEVIIKTSNKYKISTENFISKLEIVDTQTAEAGEYTCKATNPAGF-----------------------VSCTADLKVIE----------------MRPPSFVKKLEPIKSF-SGKAVQLIAEVSGT--HPIAIVWSKDGDDISDGDSYAIRSEHNQCILAIGNVAVAHQGTYACKATNEFG 4236          

HSP 20 Score: 52.373 bits (124), Expect = 5.157e-7
Identity = 56/224 (25.00%), Postives = 92/224 (41.07%), Query Frame = 2
Query: 1292 GQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKI---------PGESFIVVSAKNKLGEAVANATL 1933
            G+SV +E +V      +++  WF+    +     F I F  G A L I    +ED+G + C A N+AG   ++   LLV  EE++            +L+  +   T+              +   P+F  KP    + EG    F  ++ G P+P + W     + + T  ++ Y    + Y  E   C +          GE   VV  +NK G+A A+A L
Sbjct:  391 GESVRMECQVAGFPTPAIM--WFREEYRIERSADFQIAFQAGVASLTIREAFAEDSGRFTCTATNEAGTVSTSSY-LLVQGEESI------------FLEDSEASGTD-----------TGGDGIAPYFVQKPQPQHLVEGGSVVFHCQIKGSPKPHVYW-KKSGIPLTTGYRRRY---KVHYNKETGECSLEISMTFSDDAGEYTCVV--RNKQGDAAASARL 582          

HSP 21 Score: 50.447 bits (119), Expect = 2.281e-6
Identity = 55/227 (24.23%), Postives = 87/227 (38.33%), Query Frame = 2
Query:  842 FVKHPERYQV------ANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV---IPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAG 1495
            FVK P +++        N GD AS        G P +TV+W++    L    +F        + L++L    +D   YSC   N  G D +  ++L+V  D    + +          AA EA  ++     I  +  + P    K  P    +  G     E  V   +PI      I W KN + + +G  + I F      L ++     + G Y C A N+ G
Sbjct: 4899 FVKEPAKFETKLQSTNVNLGDTASFNCTF--TGTPEITVRWFRKDEELQDSDKFKIVTTATSSSLEVLNITSDDVKPYSCRISNEAGED-SCINSLSVQADAGEYVCT----------AANEAGTSSCNANLIVKERKVAPTFDQKLQP--VEVTAGDPSEFECHVTGSLPIK-----ITWSKNNKEIRSGGNYRITFLDNTPRLIVMKTDRSEGGVYTCKATNETG 5105          
BLAST of Titin vs. Ensembl Sea Lamprey
Match: mylka (myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8207])

HSP 1 Score: 78.5666 bits (192), Expect = 4.271e-15
Identity = 79/295 (26.78%), Postives = 119/295 (40.34%), Query Frame = 2
Query: 1355 WFKNGRPLNNGCRFNI-VFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVV-------RLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAPR--SKEASDAENLYANVQSRLRRSDKLSYA 2209
            WFKNG+PL  G  F +    RG   L+++G+  +D+G Y C ARN+AG  Q  V        R L   +E     S  P   V+   S+                     ES P F  KP    V EG   +F  K++G P+PQ+ W   +  +      KVY   S+ +LE    K         +  N  G+A A+A L +   N            +LL       K+ T KK   + E ++  +  K    +++     AP   SK+ S A  +    +  LR +D++  A
Sbjct:   12 WFKNGQPLAAGEHFRVERSSRGAFSLEVVGLGEDDSGKYLCEARNEAGTRQITVELKVEGDDRRLTRRDENTAACSGFPIPPVESRPSI-------------------WGESPPKFVNKPSRAVVREGQGGKFNCKITGRPQPQVTWRKGDTELHNDGHFKVYEKSSLHFLEVLDVKEEDSGVYTCTITNSAGKASASAELIIQISN-----------VVLL-------KVVTNKKERNTEEAESKKQTMKIVTQEVAERREAAPMEASKKPSAAMEMKMTNEQLLRSADRIKPA 269          

HSP 2 Score: 68.9366 bits (167), Expect = 3.920e-12
Identity = 77/286 (26.92%), Postives = 101/286 (35.31%), Query Frame = 2
Query:  920 GDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQ--GGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQW 1771
            G P  +V W KD  P+ +      S   G+  L +     +D G Y+C+A+N+ G    S +        +V           E   A++ S                PP FVK   GL +LQ   G  VHL  +V  I  + +V  W  NG  +     F +        L I  V  EDTG Y C A N+AGQAQS    LL   E         PQ+ VQ                             P F  KP       G  A     V+G P P + W
Sbjct:  464 GKPEPSVTWLKDDKPVNSAV---MSCRDGYCTLYVGAAGLDDGGVYTCIAENHLGKAYCSATV-------TVREPRRRTSRRNEEKPAVKQS----------------PPVFVK---GLCDLQVMDGSEVHLTVKVAAIPPAEIV--WLHNGNEIKESEDFVLESKDDEHTLHIQEVFPEDTGCYTCEAWNEAGQAQSQA--LLTVQE---------PQDGVQ-----------------------------PWFISKPRPAEAAPGQSALLSCAVAGDPFPSVSW 678          

HSP 3 Score: 67.3958 bits (163), Expect = 1.223e-11
Identity = 73/257 (28.40%), Postives = 106/257 (41.25%), Query Frame = 2
Query:  920 GDPNLTVQWYKDGVPLAAGSRFNTS-FERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVN--------LDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFV-KPMPGLYNL-QGGQ-SVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQ---------SNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDR 1627
            G+P   V W+K+G PLAAG  F      RG   L+++   ++DSG+Y C A+N  G  Q +   L V          DE+    S  P    ES  +I                   PP+FV KP   +    QGG+ +  +  R  P       + W K    L+N   F +        L+++ V  ED+G Y C   N AG+A          SNVV L V T +    K +  +E+    Q++ I   E  +R
Sbjct:    4 GNPEPQVLWFKNGQPLAAGEHFRVERSSRGAFSLEVVGLGEDDSGKYLCEARNEAGTRQITVE-LKVEGDDRRLTRRDENTAACSGFPIPPVESRPSIWGE---------------SPPKFVNKPSRAVVREGQGGKFNCKITGRPQP------QVTWRKGDTELHNDGHFKVYEKSSLHFLEVLDVKEEDSGVYTCTITNSAGKASASAELIIQISNVVLLKVVTNK----KERNTEEAESKKQTMKIVTQEVAER 234          

HSP 4 Score: 56.9954 bits (136), Expect = 1.913e-8
Identity = 54/220 (24.55%), Postives = 88/220 (40.00%), Query Frame = 2
Query:  851 HPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNG---CRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            HP + +   +G   + + RV  +G P   V+W KDGV +    R++    +G   L I    K D G ++C AKN+ G   T+  TL V             + +T++  A                     P F  P+     ++  Q   LE  ++   + S  + W K+ +P+N+    CR       G+  L +     +D G Y C A N  G+A
Sbjct:  343 HPPQSREVTQGHEVAFSCRV--SGIPKPAVEWSKDGVVIKTSERWSVEENQGGHQLIIFDVQKYDGGAFACAAKNSDGKATTATFTLIV-------------KGVTDADQA---------------------PGFSAPLVAC-TVEEQQEFTLECHLLGKPEPS--VTWLKDDKPVNSAVMSCR------DGYCTLYVGAAGLDDGGVYTCIAENHLGKA 517          
BLAST of Titin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002463.1 (pep scaffold:Pmarinus_7.0:GL476400:5068:120393:-1 gene:ENSPMAG00000002229.1 transcript:ENSPMAT00000002463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 1.103e-13
Identity = 89/363 (24.52%), Postives = 138/363 (38.02%), Query Frame = 2
Query:  869 VANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQG--GQSVHLETRVIPITDSSLVIEWFKNG---RPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIV-VSAKNKLGEAVANATLSV 1939
             A EG+ AS T + I   D +  V WY     L +  ++  ++E G A+L I   +K D G Y C   N++G D +         D  V       Q        I+  ++T +  +       RPP+F  P   LYN     G +V     +    +    + W++ G   +P  +  ++ +  D+G   L +  V  +D G+Y   ARNK G+  S   +L V                           TED   +  R          P F     N    EG   RF  +VSG PRP++ W  +   +  +   +V  +G   Y    R   P +S +  V+A N  G A   + L V
Sbjct: 17442 CAEEGNRASFTCK-IENYDHSTQVTWYHGVRQLESNEKYEITYEEGVAVLRIKDLYKADDGTYRCKVVNDYGEDSSY-------ADLFVKGARDYKQHYLSRTKKIKRRVDTTRLLE-------RPPEFTLP---LYNRNAYIGDTVRFGVTITVHPEPR--VTWYRAGQKIKPDIDDKKYTLETDKGLYQLIVHNVTMDDAGEYGVGARNKFGE-DSCKAKLTVTPRPV----------------------TED---NTLR----------PMFKRLLANAECMEGETVRFDCRVSGVPRPELHWEKDGQPLSTSHHIEVVHEGLDYYTLIIRETFPEDSGVYRVTATNSAGSASCQSYLKV 17748          

HSP 2 Score: 55.4546 bits (132), Expect = 6.035e-8
Identity = 40/126 (31.75%), Postives = 59/126 (46.83%), Query Frame = 2
Query:  731 KNQTAPPRFSEPNMQQSFRSS-----RSGSVAHLDEIT---DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFG 1084
            KN   P R+ +P   +S         R+  +A  + I+   + P+FV  P + Q  NEGD   LT  +  AG+P   V W KD VP+   +    +  R    L+I+     DSG+Y+  AKN  G
Sbjct: 18547 KNGKQPERYDDPMTTRSLSRGCLSRRRASPLAMQEPISSKKNTPTFVFQP-KSQNVNEGDNVILTCEI--AGEPTPEVYWMKDYVPVDVSTHIKVTRSRSVYTLEIINAKISDSGKYTVTAKNTNG 18669          
BLAST of Titin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010530.1 (pep scaffold:Pmarinus_7.0:GL477073:104451:224074:1 gene:ENSPMAG00000009530.1 transcript:ENSPMAT00000010530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 1.861e-13
Identity = 95/377 (25.20%), Postives = 148/377 (39.26%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFE-RGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI--RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNG---RPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            D P FV  P+   VA  G    L+  V  AG+P+  V W KD  P+   +R   S E RG   L +     +D+G+Y+C A+N+ G +  + +TL+V  DES                                 AP   R P FV   P    +  G       R++     +  + W ++G     L +  RF   F  G   L +    + D G Y C ARN+AG+A        VA+    V+ +  P +S+    ++ +    +  +S    E        P    +     V EG  AR    V+G P+P+I W  ++ ++ P     +Y D    Y L+   CK         +A N +G+  +   L V
Sbjct:    8 DAPRFVSRPKSASVA-AGRDVILSCWV--AGEPSPDVAWEKDRRPVRPDARRKLSAEERGAHSLTVYEARGDDAGQYTCRARNSAG-EAVASATLDV--DES---------------------------------APCVAREPSFVV-RPSAQKVSRGADATFSCRILGRPPPA--VAWQRDGVDVDTLPDSHRFAAEFRDGVHSLTVSAARTTDAGTYSCHARNRAGEA--------VASTVLSVSLAAPPSDSLHLYSAIPLLARINRGKSTASPETTPPAPPPPPASTR----KVREGKHARLSCYVTGKPKPEIVWKKDDEVISPGRRHMIYEDDEGYYILKVLFCKQSDRGLYTCTATNVVGKTYSPVQLIV 330          

HSP 2 Score: 57.7658 bits (138), Expect = 1.186e-8
Identity = 71/265 (26.79%), Postives = 106/265 (40.00%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGV---PLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNL----DESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFD-RGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQ 1606
            PSFV  P   +V+   D A+ + R++  G P   V W +DGV    L    RF   F  G   L +      D+G YSC A+N  G +  + + L+V+L     +S+ L S +P     +     AS  T         A  R             ++ G+   L   V       +V  W K+   ++ G R  I  D  G+ IL ++     D G Y C A N  G+  S V  ++   E  V  K +L    V   Q+  +Q
Sbjct:  111 PSFVVRPSAQKVSRGAD-ATFSCRIL--GRPPPAVAWQRDGVDVDTLPDSHRFAAEFRDGVHSLTVSAARTTDAGTYSCHARNRAG-EAVASTVLSVSLAAPPSDSLHLYSAIPLLARINRGKSTASPETTPPAPPPPPASTR------------KVREGKHARLSCYVTGKPKPEIV--WKKDDEVISPGRRHMIYEDDEGYYILKVLFCKQSDRGLYTCTATNVVGKTYSPVQLIVNGAEPLVPFKERLRDVEVMERQTATLQ 357          

HSP 3 Score: 50.8322 bits (120), Expect = 1.668e-6
Identity = 29/85 (34.12%), Postives = 45/85 (52.94%), Query Frame = 2
Query:  848 KHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFER-GFAILDILYTFKEDSGEYSCVAKNNFGMDQTS 1099
            + P   ++  +G P +L  R  P G+P+  V+W+KD   L + SR   +  R G  IL ++   K+D+G Y C A N+ G   TS
Sbjct: 1632 EQPSEDELIVDGQPMTLYCR--PVGNPSPDVKWFKDKKLLGSESRAKVTVSREGQHILSVVKAGKKDTGVYECSATNHLGSAATS 1714          
BLAST of Titin vs. Ensembl Nematostella
Match: EDO49558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM2])

HSP 1 Score: 110.153 bits (274), Expect = 3.383e-25
Identity = 92/368 (25.00%), Postives = 145/368 (39.40%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            P F++  E  +V  EG    L   V  +G P   V+W KDG  +   S      E     L I+ T  +D GEY+C+AKN  G                                  E S     T ++ ++  +RPPQF+   P    +  G+    E RV  +      +EW ++GRP+  G RF I F++  ++L II     D G+Y C A +KAG+   +V        E +V ++ +P                                  P F  K  N+ + EG  ARF V+++G P P++ W+ +E  +      ++YSD     L  + C +         A N+ G+A     L++
Sbjct:  264 PKFLQRLELKEVV-EGSRTDLEVEV--SGKPKPVVEWLKDGELVKPSSLMTLETEGQVHTLTIMNTTLDDEGEYTCIAKNKVG----------------------------------EVSC----TAELLVEEGMRPPQFIV-KPSSLQIMEGKMAKFEARVSGLPGPE--VEWLRDGRPIKPGRRFQIEFEKDRSVLTIIDAKLNDEGEYTCVATSKAGKDSCSV--------ELLVDEAVVP----------------------------------PEFVRKISNIELTEGEIARFDVRITGTPAPEVTWYKDEVPIEDGGRFEIYSDDDKHSLVIRDCALSDTGSYSCKATNEAGQASCYGELTI 545          

HSP 2 Score: 93.2041 bits (230), Expect = 1.096e-19
Identity = 69/229 (30.13%), Postives = 98/229 (42.79%), Query Frame = 2
Query:  815 LDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQA 1501
            ++E   PP F+  P   Q+  EG  A   ARV  +G P   V+W +DG P+  G RF   FE+  ++L I+     D GEY+CVA +  G D  S   L   +DE+VV                                   PP+FV+ +  +  L  G+    + R+         + W+K+  P+ +G RF I  D     L I      DTG Y C A N+AGQA
Sbjct:  353 VEEGMRPPQFIVKPSSLQIM-EGKMAKFEARV--SGLPGPEVEWLRDGRPIKPGRRFQIEFEKDRSVLTIIDAKLNDEGEYTCVATSKAGKDSCSVELL---VDEAVV-----------------------------------PPEFVRKISNI-ELTEGEIARFDVRITGTPAPE--VTWYKDEVPIEDGGRFEIYSDDDKHSLVIRDCALSDTGSYSCKATNEAGQA 537          

HSP 3 Score: 73.9442 bits (180), Expect = 1.101e-13
Identity = 96/411 (23.36%), Postives = 163/411 (39.66%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAA--GSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLV-------------------------------ATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLT-VEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRP 1963
            PP F K   R    NEG+  ++T R+   G P   V W+KDG P++     RF          L I      D+G+Y C A N+ G      S+ NV++                                +H+ AP  PP+F + +  +  +  G S   + +V    +  +   W+ NG+ +      +IV D   + L ++    + +G Y C A N   + +++ VRL V                               +T   V+  ++L  E++   ++++     D+       E    +E+ P F ++ + L  V EG+     V+VSG P+P ++W  +  LV P+S+  + ++G +  L      +  E      AKNK+GE    A L V  E   RP
Sbjct:    2 PPEF-KSALRDIEVNEGN--TVTLRIHVTGSPKPEVDWFKDGKPVSGLPHRRFEVGCVGEVYTLVIKEARGSDTGKYLCKAYNSAG---EVTSSCNVDV--------------------------------LHV-APKEPPKFERNLKDI-TIAEGCSTRFDVQVTGSPEPKVF--WYHNGKLVQPRDHVDIVHDDEHSSLILMHCPLDLSGKYTCVAEN---EVENDAVRLEVEVTGEPKPVVLWFCEGKPIEENRRVYTMRDGSTSVLVIENAELDDEAMYTCKAIN-----DLGEVECSSEMLPTDEAGPKF-LQRLELKEVVEGSRTDLEVEVSGKPKPVVEWLKDGELVKPSSLMTLETEGQVHTLTIMNTTLDDEGEYTCIAKNKVGEVSCTAELLV--EEGMRP 359          

HSP 4 Score: 56.6102 bits (135), Expect = 2.999e-8
Identity = 63/238 (26.47%), Postives = 102/238 (42.86%), Query Frame = 2
Query: 1349 IEWFKNGRPLNN--GCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQS--NVVRLLVATEETVVTKSQLPQESVQYLQS--LDIQNTEDVDRSNFRYXXXXXXXSLPHFDI-------------KPINLTVE---------EGNPARFLVKVSGYPRPQIQWFLNECLVIPTSI-QKVYS--DGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPEL 1969
            ++WFK+G+P++     RF +        L I      DTG Y C A N AG+  S  NV  L VA +E    +  L   ++    S   D+Q T   +   F Y   +  +   H DI              P++L+ +         E +  R  V+V+G P+P + WF   C   P    ++VY+  DGS S L  +  ++  E+     A N LGE   ++ +  +P ++  P+ 
Sbjct:   34 VDWFKDGKPVSGLPHRRFEVGCVGEVYTLVIKEARGSDTGKYLCKAYNSAGEVTSSCNVDVLHVAPKEPPKFERNLKDITIAEGCSTRFDVQVTGSPEPKVFWYHNGKLVQPRDHVDIVHDDEHSSLILMHCPLDLSGKYTCVAENEVENDAVRLEVEVTGEPKPVVLWF---CEGKPIEENRRVYTMRDGSTSVLVIENAELDDEAMYTCKAINDLGEVECSSEM--LPTDEAGPKF 266          
BLAST of Titin vs. Ensembl Nematostella
Match: EDO49553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL7])

HSP 1 Score: 93.5893 bits (231), Expect = 7.695e-20
Identity = 108/406 (26.60%), Postives = 161/406 (39.66%), Query Frame = 2
Query:  803 SVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-RPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLL-VATEETVVTKSQLPQESV---------------QYLQSLDIQN--------TEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSIS--YLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            S+  L +  D P+F+   E  ++  EGD   L+  V   G P   VQW++D V +    RF  S++   + L +     +D G Y CV  NNFG   +  S  +V      VL  HL  E                       API    QF++P+          S H+  R  P       + W+KNG+ L +G    I     +  L I+    ED G Y C ARN  G A+    RL  V  EE  VT  +   E V                 LQ + I++        +  + ++    E        P F  K   L V EG+   ++ KV+G PRP ++W+ +   +   +  K+  DG +   +L    CK  G    V++  N  G A ++A L V
Sbjct:    5 SLLALQKKGDTPTFMSKLEPIEIT-EGDDFQLSCNV--TGRPQPEVQWFRDEVLIKPSRRFKASYDGNVSALTVKEAELDDDGVYKCVVTNNFG---SVSSKADVT-----VLKKHLRPERDY--------------------APIFEEKQFLEPLEIQVRQPVEVSYHVRGRPKP------TVTWWKNGKELRDGKHVEIRSGGTYHTLYILRSEEEDAGSYKCLARNDVGSAE----RLFEVQVEEPSVTWYRNKNEIVPDGRSRTTFDGETYKLILQDIKIKDAGQYECIASNPIGKAFCTAEMTVNKREAPVFVSKLRPLFVTEGDNVSWMCKVAGMPRPTVEWYRDNQPLRADTRWKMDFDGRVCSLFLSEADCKDKGVYNCVIT--NSAGSAFSSAELQV 367          

HSP 2 Score: 52.7582 bits (125), Expect = 4.841e-7
Identity = 28/99 (28.28%), Postives = 51/99 (51.52%), Query Frame = 2
Query: 1682 IKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVI-----PENDFRP 1963
            ++PI +T  EG+  +    V+G P+P++QWF +E L+ P+   K   DG++S L  +  ++  +        N  G   + A ++V+     PE D+ P
Sbjct:   22 LEPIEIT--EGDDFQLSCNVTGRPQPEVQWFRDEVLIKPSRRFKASYDGNVSALTVKEAELDDDGVYKCVVTNNFGSVSSKADVTVLKKHLRPERDYAP 118          
BLAST of Titin vs. Ensembl Nematostella
Match: EDO49556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM0])

HSP 1 Score: 76.2554 bits (186), Expect = 2.501e-14
Identity = 104/448 (23.21%), Postives = 156/448 (34.82%), Query Frame = 2
Query:  797 SGSVAHLDEITDPPSFVKHPERYQV-ANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNL-------------------DESVVLNSHL-----------------PQEMTESIAAIEASLNTPKTQ---DIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ--ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPEL---KRTDPAILLRNE 2005
            +GSV    E+   P F K PE+     N GD  SL   V   G P   V+W+KD  P+    R     +     L I     +DSG+Y+ VA++  G D     T  VN+                   DE V                        + +   +   +A+ +T K     +I I+  +  P+F +       L     + LE  V         + W K+ +PL    R  I       I+DI+ V   D+G Y C A+NKAG          V T   +V   + P+  ES+Q ++ L                                     EGNP     K +G P P  +WF     +  T   +   +G    L  +      +      A N++G+      L V  E  F PE+   +RT+  +LL  E
Sbjct:  150 AGSVDVKTELIIAPEFQKEPEKSTFDVNTGDDVSLDLTV--TGKPTPKVEWFKDDKPVKGTRRLEVKAKDDEHSLKIKGGKPDDSGKYTVVAESPAGRDT---RTYEVNIKGEKPEFKQKMQPLQVLEGDEKVAEEGRFLIVDDEEGDLFSLIIGNAKPLDSGVYICQATNDTGKATAEAEIQIEELLVAPEFAEEEATQLTLIEDDDMTLELHVTGKPKPE--VHWTKDNKPLTEDDRIIIDHKGDSCIVDIMAVTPNDSGTYKCEAKNKAG----------VNTRTFIVNVEEAPEITESLQEMEEL-------------------------------------EGNPVTLTCKFTGTPAPVAEWFKASTPLTDTDRYEFIEEGDSYTLIIKTTVRDDDDTYKCVASNQVGKVTCRGDLKVT-EKMFPPEITRPERTEKIVLLEKE 542          

HSP 2 Score: 54.6842 bits (130), Expect = 1.283e-7
Identity = 33/100 (33.00%), Postives = 49/100 (49.00%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESV 1135
            P  +  PER +     +   L   V   G+P   V+W+KDG P+   SR N         L+I  T  ED+G Y+C A+N  G   TS +T++V ++  V
Sbjct:  524 PPEITRPERTEKIVLLEKEELVINVTILGNPRPDVKWFKDGKPIRQSSRLNIRPRGDTYTLNIHTTEPEDAGSYTCEAQNKMG---TSSTTIDVQIEGEV 620          
BLAST of Titin vs. Ensembl Nematostella
Match: EDO49550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL4])

HSP 1 Score: 69.707 bits (169), Expect = 7.501e-13
Identity = 84/358 (23.46%), Postives = 146/358 (40.78%), Query Frame = 2
Query:  860 RYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFN-TSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQ--EMTESIAAIEASLN-TPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRV--IPITDSSLVIEWFKNGRPLNNGCRFNI--VFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLG 1909
            R+++  EG P       +PA      V ++++   +  G R++    E G  +L I  T  ED+GEY C+A N  G + TS   L+V  + ++      PQ  +M      +   L  T  +  ++I    R P+F + +  +   +G ++   E RV   P  +    +EW+     + +  RF I  V + G+  L +  V+ ED G Y C A NKAG++                 ++ L     Q+    + +    + R                  ++P++    EG   +   +VSG P P I W  +  + +  +  K Y DG +  L  +  K+  E     +AKN  G
Sbjct:   19 RFEIQVEGTP-------VPA------VTFHRESEQIYDGGRYSIVEEENGLFVLTIRNTRPEDAGEYQCIAVNGAG-EVTSKGYLHVEEELTI------PQFIDMGTYKCQVRNDLGRTSTSAHLNIIVATR-PEFKEKLTKVEVTEGDRA-KFEVRVKGYPYPE----VEWYHGSNRILDEDRFEIESVKETGYYSLTVGEVVQEDAGMYKCIAVNKAGKS---------------TCRADLEVNERQFAPEFETEEPTILQR------------------LQPVDTI--EGEAIKMECRVSGKPEPTITWLKDGLVFLTDNRIKTYFDGDVCTLTIRDVKLGDEGIYRCNAKNSSG 315          

HSP 2 Score: 67.781 bits (164), Expect = 3.166e-12
Identity = 64/249 (25.70%), Postives = 109/249 (43.78%), Query Frame = 2
Query: 1274 LYNLQG--GQSVHLETRV--IPITDSSLVIEWFKNGRPLNNGCRFNIVFDR-GFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGE--SFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLR 1999
            + N++G  G+ V  E +V   P+      + + +    + +G R++IV +  G  +L I     ED G+Y C A N AG+  S   +  +  EE +     +PQ     + +   Q   D+ R++          + P F  K   + V EG+ A+F V+V GYP P+++W+     ++     ++ S     Y      ++  E        A NK G++   A L V  E  F PE +  +P IL R
Sbjct:    7 MKNVEGRIGEDVRFEIQVEGTPVP----AVTFHRESEQIYDGGRYSIVEEENGLFVLTIRNTRPEDAGEYQCIAVNGAGEVTS---KGYLHVEEELT----IPQ--FIDMGTYKCQVRNDLGRTSTSAHLNIIVATRPEFKEKLTKVEVTEGDRAKFEVRVKGYPYPEVEWYHGSNRILDEDRFEIESVKETGYYSLTVGEVVQEDAGMYKCIAVNKAGKSTCRADLEV-NERQFAPEFETEEPTILQR 241          
BLAST of Titin vs. Ensembl Nematostella
Match: EDO49552 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL6])

HSP 1 Score: 69.707 bits (169), Expect = 1.664e-12
Identity = 89/377 (23.61%), Postives = 144/377 (38.20%), Query Frame = 2
Query:  917 AGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPI-----RP------PQFVKPMPGLYNLQGGQS---VHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEET---VVTK------------------SQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFL-VKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
             G P   + WYKDG PL    R +         L IL    ED+G Y+C A N  G    S     V++  ++    H+        A    +L       +HI  P      +P      P F   +  L  L+G ++   V++    IP       +EWFK+  P+ +  RF   FD    +L       +D G Y C  RN  G   S+   L+V+ +     VV K                  + +P+ +V++     + + +  D   +R E+ +   +L        NL +E+  P + +     G     ++WF N+  V    + + Y DG +  L  +R  +        +  N LG A + A LSV
Sbjct:   68 TGSPTPHITWYKDGEPLDDTRRIDIRSRGNVYYLGILNLKPEDAGTYTCEAGNRIGAAYRS---FEVDVTATLKRAEHVLLLSGRGSAMFMTTL-------LHIPLPFLSTVPKPKDKWSLPAFSSKLRPLETLEGEETKFVVNVSGEPIP------TVEWFKDDTPIKHEDRFRTYFDGRVCMLVFRKTGLDDQGIYKCVLRNDVGTVSSS-ANLIVSKKSASPQVVPKIKFVDSFECSEARLEAHVAGVPRPTVEWF----LGSAKLCDGERYRLEQTDNLYTLV-----ISNLHMEDTGPYKIIATNEHGSTGSVVEWFKNDKPVKHDHLVRSYFDGKVIRLIVRRTTLEDAGLYRCTILNDLGTASSMADLSV 418          

HSP 2 Score: 62.3882 bits (150), Expect = 3.162e-10
Identity = 61/234 (26.07%), Postives = 93/234 (39.74%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQ-EMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLET--------------------RVIPITD---SSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQS 1507
            EG+       V  +G+P  TV+W+KD  P+    RF T F+    +L    T  +D G Y CV +N+ G   T  S+ N+ + +       +P+ +  +S    EA L      + H+    RP   V+   G   L  G+   LE                     ++I   +   +  V+EWFKN +P+ +       FD     L +     ED G Y C   N  G A S
Sbjct:  192 EGEETKFVVNV--SGEPIPTVEWFKDDTPIKHEDRFRTYFDGRVCMLVFRKTGLDDQGIYKCVLRNDVG---TVSSSANLIVSKKSASPQVVPKIKFVDSFECSEARL------EAHVAGVPRPT--VEWFLGSAKLCDGERYRLEQTDNLYTLVISNLHMEDTGPYKIIATNEHGSTGSVVEWFKNDKPVKHDHLVRSYFDGKVIRLIVRRTTLEDAGLYRCTILNDLGTASS 412          
BLAST of Titin vs. Ensembl Medaka
Match: ENSORLT00000027090.1 (pep primary_assembly:ASM223467v1:21:27247530:27253950:1 gene:ENSORLG00000024593.1 transcript:ENSORLT00000027090.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 2.385e-23
Identity = 69/225 (30.67%), Postives = 109/225 (48.44%), Query Frame = 2
Query: 1304 HLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRT 1978
            H E R+ PI D ++V+EW  + +PL    R  +V + G+  LD     + D+G   C A NK G  Q++   L+V  E+ +V ++QLP+      +  +I+             +EE  ++ P   + P    V EG+ ARF  +V+GYP P++ W+LN  L+  +   ++  DG I YLE    K      + V A N LG +     L +    DFR  L+R 
Sbjct:    8 HFECRLTPIGDPTMVVEWLHDSKPLAAANRLRMVNEFGYCSLDYEVAYARDSGVITCRASNKFGVDQTSAT-LIVKDEKGLVEETQLPEGRKGAYRVDEIERMVHEGGPAGVSADEESEKTKPEIVLLPEPARVLEGDIARFRCRVTGYPAPKVNWYLNGQLIRKSKRYRLNYDG-IYYLEIVDTKSYDSGEVRVVADNPLGTSEHTVKLEIQQREDFRSVLRRA 230          

HSP 2 Score: 87.4261 bits (215), Expect = 1.465e-18
Identity = 61/214 (28.50%), Postives = 96/214 (44.86%), Query Frame = 2
Query:  887 PASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQ--EMTESIAAIEASLNTPKTQDIHID---APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNV 1513
            PA    R+ P GDP + V+W  D  PLAA +R     E G+  LD    +  DSG  +C A N FG+DQTS +TL V  ++ +V  + LP+  +    +  IE  ++      +  D      +P   + P P    +  G       RV         + W+ NG+ +    R+ + +D G   L+I+   S D+G+    A N  G ++  V
Sbjct:    6 PAHFECRLTPIGDPTMVVEWLHDSKPLAAANRLRMVNEFGYCSLDYEVAYARDSGVITCRASNKFGVDQTS-ATLIVKDEKGLVEETQLPEGRKGAYRVDEIERMVHEGGPAGVSADEESEKTKPEIVLLPEPA--RVLEGDIARFRCRVTGYPAPK--VNWYLNGQLIRKSKRYRLNYD-GIYYLEIVDTKSYDSGEVRVVADNPLGTSEHTV 213          
BLAST of Titin vs. Ensembl Medaka
Match: ENSORLT00000046443.1 (pep primary_assembly:ASM223467v1:21:968974:990901:1 gene:ENSORLG00000030355.1 transcript:ENSORLT00000046443.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 1.835e-20
Identity = 71/214 (33.18%), Postives = 111/214 (51.87%), Query Frame = 2
Query: 1304 HLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL-PHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIV-VSAKNKLGEAVANATLSV 1939
            H E R+ PI D ++V+EW  +G+PL    R  +V + G+  LD     + D+G   C A NK G  Q++   L+V  E+ +V ++QLP E  +    +D       +   +    EE+ E L P   + P  + V EG+ ARF  +V+GYP P++ W+LN  L     I+K  ++ ++  LE      P ++ I   SAKN  GEA ++A L V
Sbjct:   39 HFECRLTPIGDPTMVVEWLHDGKPLAAANRLRMVNEFGYCSLDYEVAYARDSGVITCRATNKFGVDQTSAT-LIVKDEKGLVVETQLP-EGRKGAHRIDEMERLAHEGGPYGVTAEEQTEKLKPEIVLLPEPVRVVEGDTARFRCRVTGYPAPKVNWYLNGQL-----IRK--NEHTLMLLEV----FPEDAAIYSCSAKNDYGEATSSAPLIV 239          

HSP 2 Score: 83.1889 bits (204), Expect = 3.493e-17
Identity = 60/213 (28.17%), Postives = 95/213 (44.60%), Query Frame = 2
Query:  887 PASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQ--EMTESIAAIEASLNTPKTQDIHID---APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN 1510
            PA    R+ P GDP + V+W  DG PLAA +R     E G+  LD    +  DSG  +C A N FG+DQTS +TL V  ++ +V+ + LP+  +    I  +E   +      +  +     ++P   + P P    +  G +     RV         + W+ NG+          +  +    L ++ V  ED   Y C A+N  G+A S+
Sbjct:   37 PAHFECRLTPIGDPTMVVEWLHDGKPLAAANRLRMVNEFGYCSLDYEVAYARDSGVITCRATNKFGVDQTS-ATLIVKDEKGLVVETQLPEGRKGAHRIDEMERLAHEGGPYGVTAEEQTEKLKPEIVLLPEP--VRVVEGDTARFRCRVTGYPAPK--VNWYLNGQ----------LIRKNEHTLMLLEVFPEDAAIYSCSAKNDYGEATSS 234          
BLAST of Titin vs. Ensembl Medaka
Match: ENSORLT00000036245.1 (pep primary_assembly:ASM223467v1:17:27817163:27827046:1 gene:ENSORLG00000022942.1 transcript:ENSORLT00000036245.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 5.559e-20
Identity = 107/405 (26.42%), Postives = 158/405 (39.01%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQF-VKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE---TVVTK-----SQLPQESVQYLQSLDI---------------QNTEDVDRS-NFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISY-LEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELK 1972
            P F+  P+ + V   G  A+L+  ++  G P   V W KD + L +G RF T  +     L I     EDSG+Y C AKN+ G               +V L   LP EM++                       R P F VKP      L G    H      P  +     EW K+GR L    R  IV D   + L I  V S D G Y C A+N AG++Q+    L V T++   T V K     S L +   +  + + I                N  DV  S N  ++      +     +     TV EG  A+    V+G+P+P I W  +   +       +Y D + ++ L+   CK         +A N  G+  +   ++V P+  FR +L+
Sbjct:   10 PRFLTRPKAFSVC-VGKDAALSCTIV--GSPTPVVSWEKDKLKLTSGGRFKTVEDGDVYRLTIYDLTLEDSGQYMCRAKNSVGEAYA-----------AVTLKVALPAEMSQ-----------------------RAPAFMVKPSSTRVGLGGDVVFHCRVAAHPEAN----FEWEKDGRYLGETNRIKIVSDGDSSTLKIQSVRSLDGGTYTCRAQNSAGRSQAAAT-LGVDTQDARHTSVDKNTSLLSHLQKRKEEMKKDISIYHSEEKSSSVSSSSTTNVADVLSSLNLEHQLRASALAKLPKGVFTRTCTVTEGKHAKLSCLVTGHPKPHIIWRKDGTNISEGRRHVIYEDQAENFILKILYCKQSDNGLYTCNATNMAGQTYSAVLVTVKPKVPFRRKLQ 372          
BLAST of Titin vs. Ensembl Medaka
Match: ENSORLT00000044036.1 (pep primary_assembly:ASM223467v1:21:968974:997146:1 gene:ENSORLG00000030355.1 transcript:ENSORLT00000044036.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 4.024e-18
Identity = 65/213 (30.52%), Postives = 104/213 (48.83%), Query Frame = 2
Query: 1304 HLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSL-PHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSV 1939
            H E R+ PI D ++V+EW  +G+PL    R  +V + G+  LD     + D+G   C A NK G  Q++   L+V  E+ +V ++QLP E  +    +D       +   +    EE+ E L P   + P  + V EG+ ARF  +V+GYP P++ W+LN  L+   +   V +     +         GE F  VS  N  G++  ++ L V
Sbjct:   39 HFECRLTPIGDPTMVVEWLHDGKPLAAANRLRMVNEFGYCSLDYEVAYARDSGVITCRATNKFGVDQTSAT-LIVKDEKGLVVETQLP-EGRKGAHRIDEMERLAHEGGPYGVTAEEQTEKLKPEIVLLPEPVRVVEGDTARFRCRVTGYPAPKVNWYLNGQLIRKKNYSLVINKTQTEH--------EGEYFCSVS--NPFGQSTCSSHLLV 239          

HSP 2 Score: 82.0333 bits (201), Expect = 2.666e-16
Identity = 62/223 (27.80%), Postives = 101/223 (45.29%), Query Frame = 2
Query:  887 PASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQ--EMTESIAAIEASLNTPKTQDIHID---APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEE 1540
            PA    R+ P GDP + V+W  DG PLAA +R     E G+  LD    +  DSG  +C A N FG+DQTS +TL V  ++ +V+ + LP+  +    I  +E   +      +  +     ++P   + P P    +  G +     RV         + W+ NG+ +     +++V ++           +E  G+YFC   N  GQ+  +   LLV  +E
Sbjct:   37 PAHFECRLTPIGDPTMVVEWLHDGKPLAAANRLRMVNEFGYCSLDYEVAYARDSGVITCRATNKFGVDQTS-ATLIVKDEKGLVVETQLPEGRKGAHRIDEMERLAHEGGPYGVTAEEQTEKLKPEIVLLPEP--VRVVEGDTARFRCRVTGYPAPK--VNWYLNGQLIRKK-NYSLVINK---------TQTEHEGEYFCSVSNPFGQSTCS-SHLLVQLKE 243          
BLAST of Titin vs. Ensembl Medaka
Match: ENSORLT00000038377.1 (pep primary_assembly:ASM223467v1:21:27290473:27302032:1 gene:ENSORLG00000027660.1 transcript:ENSORLT00000038377.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 2.700e-14
Identity = 65/252 (25.79%), Postives = 104/252 (41.27%), Query Frame = 2
Query:  824 ITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESV 1579
            I +PP F++  E  +V   GD   L  +V  AG P + V W+K    + +       + +G A L +    K D GEY+C A+N  G   ++ ST  +N                             KT          PP F K +  +   +G Q +  E RV     S + + W K+G+PL +G  F++++D   A+L+I       +G+Y C A N  G A     R  +     ++ +   PQE +
Sbjct:  306 ILEPPYFLEKMEPMEV-TAGDAVCLKCQV--AGTPEIKVSWFKADGKVRSSPTCKLEYSKGVACLKLSKATKADVGEYTCKAENKIG---SASSTCRLN----------------------------AKT----------PPSFPKKITSVQETEG-QPIRFECRVA--GSSPIEVSWQKDGKPLTHGADFSMLYDDNTAVLEISRGEMRHSGEYTCVATNGVGSAS---CRAKLTLYPPIIDRKLSPQEVI 507          

HSP 2 Score: 68.1662 bits (165), Expect = 2.472e-11
Identity = 64/224 (28.57%), Postives = 86/224 (38.39%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNT-PKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSS-LVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQ 1498
            PPSF K     Q   EG P     RV  AG   + V W KDG PL  G+ F+  ++   A+L+I       SGEY+CVA N  G                               A+  A L   P      ID  + P + +           G S+ LE     IT S+ + + W K+ + +  G  + I F      L I+     DTG YFC A N  G+
Sbjct:  402 PPSFPKKITSVQ-ETEGQPIRFECRV--AGSSPIEVSWQKDGKPLTHGADFSMLYDDNTAVLEISRGEMRHSGEYTCVATNGVGS------------------------------ASCRAKLTLYPPI----IDRKLSPQEVIV----------GDSIELECH---ITGSAPMKVTWSKDHKDIRTGGNYKISFVENTPHLTILKADKGDTGKYFCHASNDMGK 575          

HSP 3 Score: 54.6842 bits (130), Expect = 3.790e-7
Identity = 65/243 (26.75%), Postives = 94/243 (38.68%), Query Frame = 2
Query:  806 VAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNG--CRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLV 1528
            V  L  +  PPSFVK      V   G+  +L  +V  +G P  T+ WY DG  + +G     SF      L I      DSG Y C A N  G  +T+ +TL V    S V+                                  PPQ V+ MPG           +    I    S L +  F+  + L +G  C F++  ++   +L+++ V     G+Y C   N AG+ +S  V L V
Sbjct:   22 VLLLGALFKPPSFVKKLTNITVI-LGEEVTLMCKV--SGSPPFTISWYHDGTEVQSGPNHEVSFSDNSCTLSIPTLKLSDSGVYKCKAVNKAGSCETT-ATLVVKEPPSFVV----------------------------------PPQPVEAMPG---------SKVTFSAIVKGSSPLKLRCFRGTKELLSGKDCEFSLKDNQ--VVLELLNVDRSHAGEYTCQIINDAGK-ESCAVNLSV 214          
BLAST of Titin vs. Planmine SMEST
Match: SMESG000029197.1 (SMESG000029197.1)

HSP 1 Score: 1312.75 bits (3396), Expect = 0.000e+0
Identity = 711/712 (99.86%), Postives = 711/712 (99.86%), Query Frame = 2
Query:  230 MSSVASINLSSSKSPQIIHVGGQNSPKGQVFHVSGHDSDQVFSGNNIQQMNMQGPKLAYPASNYPSVAXXXXXXXXXXXXXXXXXXXXXXXXXXFEAQTDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAPRSKEASDAENLYANVQSRLRRSDKLSYAGAPSGGQMPPQTQSYVDEHFTGPTVQTSQVTMQIGNANYNTPNPQTEMTLRL 2365
            MSSVASINLSSSKSPQIIHVGGQNSPKGQVFHVSGHDSDQVFSGNNIQQMNMQGPKLAYPASNYPSVAQQQQYQQQYQMQPQYQPQQQPIQPQYFEAQTDVYQRQPQYYQAQYQPQEQYQQQYQAPPQPQYNSIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK QDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYEEEEENESLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAPRSKEASDAENLYANVQSRLRRSDKLSYAGAPSGGQMPPQTQSYVDEHFTGPTVQTSQVTMQIGNANYNTPNPQTEMTLRL
Sbjct:    1 MSSVASINLSSSKSPQIIHVGGQNSPKGQVFHVSGHDSDQVFSGNNIQQMNMQGPKLAYPASNYPSVAQQQQYQQQYQMQPQYQPQQQPIQPQYFEAQTDVYQRQPQYYQAQYQPQEQYQQQYQAPPQPQYNSIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKRQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYEEEEENESLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAPRSKEASDAENLYANVQSRLRRSDKLSYAGAPSGGQMPPQTQSYVDEHFTGPTVQTSQVTMQIGNANYNTPNPQTEMTLRL 712          
BLAST of Titin vs. Planmine SMEST
Match: SMESG000029197.1 (SMESG000029197.1)

HSP 1 Score: 1295.03 bits (3350), Expect = 0.000e+0
Identity = 705/712 (99.02%), Postives = 705/712 (99.02%), Query Frame = 2
Query:  230 MSSVASINLSSSKSPQIIHVGGQNSPKGQVFHVSGHDSDQVFSGNNIQQMNMQGPKLAYPASNYPSVAXXXXXXXXXXXXXXXXXXXXXXXXXXFEAQTDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAPRSKEASDAENLYANVQSRLRRSDKLSYAGAPSGGQMPPQTQSYVDEHFTGPTVQTSQVTMQIGNANYNTPNPQTEMTLRL 2365
            MSSVASINLSSSKSPQIIHVGGQNSPKGQVFHVSGHDSDQVFSGNNIQQMNMQGPKLAYPASNYPSVAQQQQYQQQYQMQPQYQPQQQPIQPQYFEAQTDVYQRQPQYYQAQYQPQEQYQQQYQAPPQPQYNSIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPK QDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYEEEEENESLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDP      ENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAPRSKEASDAENLYANVQSRLRRSDKLSYAGAPSGGQMPPQTQSYVDEHFTGPTVQTSQVTMQIGNANYNTPNPQTEMTLRL
Sbjct:    1 MSSVASINLSSSKSPQIIHVGGQNSPKGQVFHVSGHDSDQVFSGNNIQQMNMQGPKLAYPASNYPSVAQQQQYQQQYQMQPQYQPQQQPIQPQYFEAQTDVYQRQPQYYQAQYQPQEQYQQQYQAPPQPQYNSIQFDTAHPQMSIQSKDFSKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKRQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYEEEEENESLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDP------ENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAPRSKEASDAENLYANVQSRLRRSDKLSYAGAPSGGQMPPQTQSYVDEHFTGPTVQTSQVTMQIGNANYNTPNPQTEMTLRL 706          
BLAST of Titin vs. Planmine SMEST
Match: SMESG000041478.1 (SMESG000041478.1)

HSP 1 Score: 320.087 bits (819), Expect = 1.817e-96
Identity = 186/485 (38.35%), Postives = 278/485 (57.32%), Query Frame = 2
Query:  833 PPSFVKHPERYQVA-NEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQ-EMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSN---FRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAP------RSKEASDAENLYANVQSRLR-----------RSDKLSYAGAPS 2221
            PPSF++  +  +++ +EG PA     + P     L+  WY +G  +   SR     E   + L+ILYT   D+G Y CV  +  G  ++ P TLNV  ++S++L+   PQ +   +I A+EA LN PK +    +     P F+K +  +  L  G SV L  +V P  D+SL +EW+KN   + NG R  I +DRG A L+I+  ISED+GDY+  A NK GQ QS  + +     E +VT S L  +S  Y +  D++  ED+   N   F+  E+ + E LP+FD+KP+N+T  EG PA+FLVKVSG+P P ++W +++ LV+P S+ K Y+DGSI+YLE  RC   G+  + V+A N LG A   ATL+VIP  DFRP+L+   P      ENPF+K++ LKKV  + EL +AF+K+KP+A ++   E G+       +S +  + E LY  V + LR           RS + +++G+PS
Sbjct:  334 PPSFIEPIDPREISVSEGAPAYFKVTIDPGNGQKLSNDWYHNGEIVKTCSRLTGKLEMNISALNILYTLPSDTGSYICVLFSEHGRVESEPVTLNVQTEKSIILD---PQSKGISAIHALEAELNAPKAEMKEDEIITDLPSFIKQLEPIDQLNEGDSVTLTVKVEPANDNSLYVEWYKNENHIINGSRMQISYDRGTATLNIVSAISEDSGDYWLIATNKNGQTQSEKINISCFEGEKIVTASSLLADSAGYQRLKDLE--EDLASGNISTFQNTEDVQEECLPNFDVKPMNITAGEGGPAKFLVKVSGFPTPTLEWRIDDVLVVPDSVCKTYNDGSINYLEINRCSELGDIKVHVAATNPLGVAKEEATLTVIPMVDFRPDLRHITP------ENPFKKMAGLKKVECTSELNDAFKKSKPTAERIVKIEMGSETKSKFYKSPDVIETEKLYDQVAAGLRKNIGPGSNNGARSPRNNHSGSPS 807          

HSP 2 Score: 217.624 bits (553), Expect = 1.841e-59
Identity = 124/328 (37.80%), Postives = 187/328 (57.01%), Query Frame = 2
Query:  773 QQSFRSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHID--APIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPIN---LTVEEGNPARFLVKV 1741
            ++S  S R GS    D + D P+F +  E   V +EG+P  L  RV PA D +L + W+KDG  L+AGSRF+T F+RGF +LDILYT ++D+G+Y CVAK++ G  Q++ + + +N +  V   + LP+EM + I  ++ +  T     +  D  A    P+F+  +P    L  GQ +H+E  +   +DSSLV EWFK+G  L  G R ++++DRG+  LDI     ED GDY C ARN  G+A++    +    EE+++TKS L + S+  L+SL     E+      RY +       P F I+PI+   ++V EG PA F V +
Sbjct:   43 KRSLASPRRGS----DHLYDSPTFRQDLESELVVDEGEPLRLMTRVGPADDGSLEINWFKDGKLLSAGSRFSTIFDRGFIVLDILYTIEDDNGDYVCVAKSHSGTAQSNIAHVRINPESGVDYLTQLPEEMMQEINNLDKNYETGTYHGMEEDKHAAKTIPKFLSQLPNSLTLIQGQPLHIEIFLEHHSDSSLVTEWFKDGMSLKLGSRIDVIYDRGYCALDIAFCYPEDNGDYSCVARNSLGKAETQSCNVTCHPEESIITKSNLTESSISQLKSL-----ENPGEEYARYNDTSVIPMPPSF-IEPIDPREISVSEGAPAYFKVTI 360          
BLAST of Titin vs. Planmine SMEST
Match: SMESG000076529.1 (SMESG000076529.1)

HSP 1 Score: 310.842 bits (795), Expect = 4.033e-96
Identity = 180/486 (37.04%), Postives = 279/486 (57.41%), Query Frame = 2
Query:  830 DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVN----LDESV--VLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLSTLKKVAVSPELQNAFRKTKPSAVQLSNYERGAP------RSKEASDAENLYANVQSRLRRSDKLSYAG---APSGG-QMPP 2239
            + P F+ + E     NE DP  L+++V PAGD +L+V+W KDG PL  G+RF+T FERG+ +LDILY+ +EDSG Y CVAK+  G +Q++P+T+ V     +D +V  + N H+ Q+  E           P+  D H  +  + P F K +     +  G +VHLET V P  D +L ++W KNG+ ++ G RFN VFDRG+  LDI+    ED G Y C A+N  G+A+S+  ++    +E +V+KS L + S+  L+  +    E+++ + FR  E++E++  P FD    ++T++EGN A+F++ +  +PR  I W +N   VI  S+ K Y DG+I+YLE  RC   G+  I V A N LG+  ++  L+V   N++  +LK   P      ENP++K+++LKKV V+PEL  A  K KP+A ++   ER A       ++ +  +AE LY  V + L+    +S       P G  +MPP
Sbjct:   43 EAPRFLSNLENEITVNEEDPIRLSSQVAPAGDNSLSVEWLKDGKPLLTGTRFSTVFERGYVVLDILYSIEEDSGVYVCVAKSKSGQNQSNPATVRVTPEAKVDNNVNFIENQHVQQDENE-----------PQYPDKHESS--QSPYFSKDLESNITVNQGGAVHLETIVDPRNDVTLKVDWHKNGQSMSLGSRFNAVFDRGYCALDILYTYPEDDGVYTCVAKNNCGEAESSHSQITCIPDEKIVSKSNLNESSISQLKKFENNIQEEINDA-FRNTEDQEDDQAPSFDKGLQDVTIDEGNAAKFIINIHSHPRASIVWSINNEEVISDSVNKFYGDGTINYLELTRCTEVGQHNIRVVATNPLGQMASDCILTVNSINNYAQDLKHIAP------ENPYKKMASLKKVDVTPELTTALHKPKPTAEKIVKIERNAEVKARHTKTPDVLEAEQLYDKVAANLKSKGNISTGKRQTIPQGKPKMPP 508          

HSP 2 Score: 94.3597 bits (233), Expect = 9.010e-20
Identity = 49/126 (38.89%), Postives = 68/126 (53.97%), Query Frame = 2
Query:  821 EITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASL 1198
            E +  P F K  E     N+G    L   V P  D  L V W+K+G  ++ GSRFN  F+RG+  LDILYT+ ED G Y+CVAKNN G  ++S S +    DE +V  S+L +     +   E ++
Sbjct:  170 ESSQSPYFSKDLESNITVNQGGAVHLETIVDPRNDVTLKVDWHKNGQSMSLGSRFNAVFDRGYCALDILYTYPEDDGVYTCVAKNNCGEAESSHSQITCIPDEKIVSKSNLNESSISQLKKFENNI 295          
BLAST of Titin vs. Planmine SMEST
Match: SMESG000005752.1 (SMESG000005752.1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.197e-17
Identity = 100/387 (25.84%), Postives = 161/387 (41.60%), Query Frame = 2
Query:  815 LDEI--TDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVI--PITDSSLVIEWFKNGRPLNNGCRFNIVF-DRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQ-ESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDF 1957
            LDE   T PP FV+  E+     EGD   L A V   G P   V+WYK+G+ +     +    +     L I  TF +D+GEY+ +A+N FG               SV  ++HL   +T      E++ N P+++   I   I+ P+ VK       L   +    E +VI  P+ + S    W+ N   +      +I++ +  +  L I  V   D G Y   A N  G+AQ        +T  TV   ++ P+ E+ ++++SL+                       P       ++T +EG P + LV V G P P+++W+ N  LV      +++ DG++  L  +          +V A N  G       L V   ND+
Sbjct: 5039 LDETKSTYPPKFVRELEKSIQVKEGDSVKLLAEV--DGYPTPVVEWYKNGIVIEKNPDYKLFRDGNVVSLYIHETFTDDTGEYNLIARNPFG---------------SVKSSAHLTVTITP-----ESADNVPQSK--QIPRIIQEPKSVK-------LNLNKKAVFEAKVIGSPVPEVS----WYHNDIFIEESENVSIIYSNNEYTKLIINSVKETDAGTYTVKAVNIVGEAQ-------FSTSLTVEAPTKFPKTEAPKFIRSLE-----------------------P-------SMTAKEGEPCKLLVDVMGNPNPKLEWYKNGVLVDNMPDYQLFRDGNVHTLYIKELFQDDSGKYIVIANNPNGTVQCETNLVVT--NDY 5351          

HSP 2 Score: 69.3218 bits (168), Expect = 1.256e-11
Identity = 63/246 (25.61%), Postives = 98/246 (39.84%), Query Frame = 2
Query: 1217 DIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPT-SIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPEN 1951
            D+ +  PI PP FVKP   +   +G Q+V LE   +  T+S  +I+W+KNG  +N    F + +      L I  V  +D+G Y C  +N AG                                          D  N+     +     P F     +  + EG   +  VKV G+P P+I+W+ +  ++  + +   V  D +I  L     +   +    VSAKNK GEA     L ++ EN
Sbjct: 4010 DLTVSLPI-PPSFVKPFQNIMCNEGCQAV-LEG--VLQTNSEPIIKWYKNGAEINKSPEFTLSYKENRVSLTIPEVTPKDSGTYKCLVKNVAG------------------------------------------DTENYATVTVKTIFMAPKFIFGLQSQQILEGTNIKLSVKVEGFPTPEIKWYKDGQVITSSPNFNLVVEDDNIFSLIIPNVRPMDQGKYCVSAKNKAGEAFTMGEL-IVAEN 4208          

HSP 3 Score: 68.5514 bits (166), Expect = 2.289e-11
Identity = 92/400 (23.00%), Postives = 167/400 (41.75%), Query Frame = 2
Query:  785 RSSRSGSVAHLDEITDPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKP--MPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRP--LNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQ--AQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNEC-LVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFRP 1963
            +SS+  S     E   PP FVK  E  ++  EG  A  +      G+P   V W ++G+ L  G  +  + + GF+ L I   FK+D+G+++C  +N  G  + S + L+V +D++           TE +A I  +    K  ++ ++ P +    +KP   P +   Q  + + ++ +   +  +       K G    + + CR+                  E+TG Y   A+N  G+  A S +    V  ++TV+++ +   E  +         + DV++     E   +   +P       N+   E N  R   KV GYP P++ W  +   L   + I+ V ++  +  L F   ++         A+NKLG    + T+SV+P     P
Sbjct: 4239 QSSKMFSPTKKKEKIQPPEFVKILEPLKIK-EGKKAFFSVEY--KGNPEPVVVWLREGLQLENGPDYQITTKPGFSQLTIAEVFKDDAGKFTCRLENKAGRIE-SITKLSVGIDKT----------KTELMAPIFETF-PEKYVNVFVNQPSKLSCIIKPNSKPEIKIYQNEKEIKIDNKNYYLNRNE------KTGETCFIISSCRW------------------ENTGTYKIMAQNPTGKTFATSQIFVKNVDEKKTVISEMESMFERKRSSIRS--SVSSDVEKDIVVKESPAKFVQIPLS-----NVETTEKNIVRLDFKVDGYPYPKLNWLKDGYPLAYDSHIKSVINENGLHSLVFCPLELEDNGQYQCVAQNKLGTDSFSTTISVVPVQKITP 4592          

HSP 4 Score: 66.2402 bits (160), Expect = 1.085e-10
Identity = 92/396 (23.23%), Postives = 148/396 (37.37%), Query Frame = 2
Query:  833 PPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSF-ERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSN------VVRLLVATEETVVTKSQLPQESVQYLQSLDI-QNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFL------------NECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPENDFR 1960
            P  FV+ P       E +   L  +V   G P   + W KDG PLA  S   +   E G   L       ED+G+Y CVA+N  G D  S +T++V     V +    P    + ++A+   + TP T    ++  + P  F+                                W K+G+ ++   +  I  +     L I    + D+G Y C A N AG    N       V++  A       K+   Q+    L S++I +N E                + P F   P     E G    F+ ++SGYP P++ WFL             +CL+   ++           L  + C++   + I V A+N  G   A+ +L V+ + + R
Sbjct: 4492 PAKFVQIPLSNVETTEKNIVRLDFKV--DGYPYPKLNWLKDGYPLAYDSHIKSVINENGLHSLVFCPLELEDNGQYQCVAQNKLGTDSFS-TTISV-----VPVQKITPLRFLKRLSAVCVQVGTPVTFLCVVEGSL-PVAFI--------------------------------WQKDGKTIDENEKVIIDSEDYSTTLAIENTENSDSGWYQCVASNPAGSITCNARLSFKAVKIESAMNPPEWMKAIPKQKKPANLLSVNIPENAE---------------GTAPCFTKCPTACKTEPGGTVTFIAELSGYPEPEVTWFLAGKQLSKEHPFYEKCLIESHNLHH--------SLTIRNCQLYDSTRIDVIAQNCNGTDRADTSLIVVAKPERR 4823          

HSP 5 Score: 61.6178 bits (148), Expect = 2.672e-9
Identity = 69/257 (26.85%), Postives = 110/257 (42.80%), Query Frame = 2
Query:  836 PSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFK-EDSGEYSCVAKNNFGM-----------DQTSPSTL-------NVNLDESVVLNSH-LPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVH-LETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEET 1543
            P F+   +  Q+  EG    L+ +V   G P   ++WYKDG  + +   FN   E       I+   +  D G+Y   AKN  G            ++ S  T+       NV +D  V  N + LPQ          + + +P  +       I+PP+FVK +  L   +G ++   +E +  P      V+ W + G  L NG  + I    GF+ L I  V  +D G + C   NKAG+ +S + +L V  ++T
Sbjct: 4115 PKFIFGLQSQQIL-EGTNIKLSVKV--EGFPTPEIKWYKDGQVITSSPNFNLVVEDDNIFSLIIPNVRPMDQGKYCVSAKNKAGEAFTMGELIVAENKISEQTIVEQRKKTNVQVDIIVPQNDNRLPQS---------SKMFSPTKKK----EKIQPPEFVKILEPLKIKEGKKAFFSVEYKGNP----EPVVVWLREGLQLENGPDYQITTKPGFSQLTIAEVFKDDAGKFTCRLENKAGRIES-ITKLSVGIDKT 4350          

HSP 6 Score: 58.5362 bits (140), Expect = 2.729e-8
Identity = 51/209 (24.40%), Postives = 82/209 (39.23%), Query Frame = 2
Query:  878 EGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDESVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFARNKAGQAQ 1504
            EG+ A L  ++I  G+P   + W K+ +PL   +  ++  E    +L     F EDSGEY CVA N +G  +                        T++I  +         +D      + PP F+KP+    +   G ++ L+  V      +  + W+KNG  L N     I  +     L I  + S   G Y   A N  G ++
Sbjct: 1424 EGEKAKLQCKII--GNPTPQITWLKNNIPLKLNNAISSKSEGNKHMLIFKDLFLEDSGEYKCVANNPYGFAE------------------------TKAIMHVTPYYKNSAKED------MEPPVFIKPLDKETHEYVGNTLVLDCFV--KGKPTPHVTWYKNGNRLQNKLTCEINKNDNIHSLIIPNINSNTAGYYSVVAVNTVGTSE 1598          

HSP 7 Score: 57.7658 bits (138), Expect = 4.646e-8
Identity = 55/236 (23.31%), Postives = 101/236 (42.80%), Query Frame = 2
Query: 1253 FVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAILDIIGVISEDTGDYFCFA--RNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYS--DGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIPE 1948
            FVK +  +  L  G+S+ LE  + P  D  +V+EWFKN  P+ +     I +D G  IL I  V  ED+G Y C A  R ++    SNV    V  + + + +S+   E++     +D  N +  D  N  +      + L      P  +++ E         +   P  ++ W+L+  L+  + I ++ +  DG    + ++      E +     +N+         + +IP+
Sbjct: 9446 FVKELTDMV-LPVGKSLLLECEITPAVD--VVVEWFKNLTPVISNEHIAITYDLGKCILMIAEVEEEDSGHYICKASSRERSISTSSNVT---VKNDSSEMRESE--DETIDASFEIDDDNKQSTDNVNSEFALRSVIKEL-----LPNEMSIPESGKLLLQCVIVQSPENRVTWYLDGDLLENSGIYEINNKPDGVCQLIVYEAFP-EDEGYYCCKIENQFSTIQTGTNVHIIPD 9667          

HSP 8 Score: 52.373 bits (124), Expect = 2.204e-6
Identity = 82/348 (23.56%), Postives = 134/348 (38.51%), Query Frame = 2
Query:  944 WYKDGVPLAAGSRFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLD-ESVVLNSHL-PQEMTESIA-----AIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLYNLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFA-------ILDIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESVQYLQSLDIQNTEDVDRSNFRYXXXXXXXSLPHFDIKPINLTVEEGNPARFLVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESFIVVSAKNKLGEAVANATLSVIP 1945
            W KDG  +    +     E     L I  T   DSG Y CVA N  G       T N  L  ++V + S + P E  ++I      A   S+N P+  +       + P   K  PG     G  +   E    P  +    + WF  G+ L+    F   +++           L I      D+      A+N  G  +++   ++VA  E  +++           QS  +  +E VD           +   P F     ++ VEE  PA F V+ +G P+P+I+W+ ++  ++ +   K+ +   I+ LE             V A N LG A+    L+V+P
Sbjct: 4626 WQKDGKTIDENEKVIIDSEDYSTTLAIENTENSDSGWYQCVASNPAG-----SITCNARLSFKAVKIESAMNPPEWMKAIPKQKKPANLLSVNIPENAEGTAPCFTKCPTACKTEPG-----GTVTFIAELSGYPEPE----VTWFLAGKQLSKEHPF---YEKCLIESHNLHHSLTIRNCQLYDSTRIDVIAQNCNGTDRADTSLIVVAKPERRLSQ-----------QSTSMSRSESVDSKQ-----SSIDGKPPLFKAILQSVKVEEDKPALFRVEFTGNPKPEIKWYKDDQEIVSSPDMKIATSNFITSLEIPHTLEKDNGVFSVRATNFLGTAITKGRLTVLP 4940          
The following BLAST results are available for this feature:
BLAST of Titin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTN4.902e-2628.07titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN2.206e-2526.18titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN2.583e-2526.18titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN2.683e-2526.18titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN2.683e-2526.18titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
back to top
BLAST of Titin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ketn-12.036e-5334.48KETtiN (Drosophila actin-binding) homolog; Kettin ... [more]
ketn-12.146e-5334.48KETtiN (Drosophila actin-binding) homolog; Kettin ... [more]
ketn-12.423e-5334.48KETtiN (Drosophila actin-binding) homolog; Kettin ... [more]
ketn-12.441e-5334.48KETtiN (Drosophila actin-binding) homolog; Kettin ... [more]
ketn-12.512e-5334.48KETtiN (Drosophila actin-binding) homolog; Kettin ... [more]
back to top
BLAST of Titin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sls1.027e-5232.18gene:FBgn0086906 transcript:FBtr0072848[more]
sls1.075e-5232.18gene:FBgn0086906 transcript:FBtr0309042[more]
sls2.084e-5232.18gene:FBgn0086906 transcript:FBtr0332683[more]
sls3.108e-5232.18gene:FBgn0086906 transcript:FBtr0332679[more]
sls3.336e-5230.49gene:FBgn0086906 transcript:FBtr0332681[more]
back to top
BLAST of Titin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttn.21.489e-2526.50titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ttn.21.744e-2526.50titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ttn.11.218e-2226.95titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
ttn.11.132e-1622.85titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
obscnb8.734e-1524.87obscurin, cytoskeletal calmodulin and titin-intera... [more]
back to top
BLAST of Titin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chmp33.113e-1325.66charged multivesicular body protein 3 [Source:Xenb... [more]
MYPN2.008e-1227.20myopalladin [Source:NCBI gene;Acc:100495211][more]
PALLD3.833e-1225.31palladin, cytoskeletal associated protein [Source:... [more]
PALLD4.318e-1225.31palladin, cytoskeletal associated protein [Source:... [more]
PALLD4.859e-1225.31palladin, cytoskeletal associated protein [Source:... [more]
back to top
BLAST of Titin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttn2.957e-2728.07titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn2.123e-2626.18titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn2.517e-2626.18titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn2.538e-2626.18titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn2.595e-2626.18titin [Source:MGI Symbol;Acc:MGI:98864][more]
back to top
BLAST of Titin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9I7U4|TITIN_DROME4.610e-5132.18Titin OS=Drosophila melanogaster OX=7227 GN=sls PE... [more]
sp|A2ASS6|TITIN_MOUSE2.144e-2526.18Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1[more]
sp|Q8WZ42|TITIN_HUMAN1.289e-2426.18Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4[more]
sp|O01761|UNC89_CAEEL3.999e-1728.83Muscle M-line assembly protein unc-89 OS=Caenorhab... [more]
sp|G4SLH0|TTN1_CAEEL5.180e-1325.61Titin homolog OS=Caenorhabditis elegans OX=6239 GN... [more]
back to top
BLAST of Titin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RJF13.228e-12844.55Titin OS=Fasciola hepatica OX=6192 GN=D915_002543 ... [more]
A0A504Y5205.616e-12744.36Titin OS=Fasciola gigantica OX=46835 GN=FGIG_04181... [more]
A0A3R7CUY54.969e-12146.97Titin OS=Clonorchis sinensis OX=79923 GN=sls PE=4 ... [more]
H2KSJ15.696e-12146.97Titin OS=Clonorchis sinensis OX=79923 GN=CLF_10948... [more]
A0A183A5N17.911e-12044.65Uncharacterized protein OS=Echinostoma caproni OX=... [more]
back to top
BLAST of Titin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044348.13.547e-2329.84pep primary_assembly:Astyanax_mexicanus-2.0:19:232... [more]
OBSCN1.401e-1825.31obscurin, cytoskeletal calmodulin and titin-intera... [more]
OBSCN1.020e-1725.74obscurin, cytoskeletal calmodulin and titin-intera... [more]
ENSAMXT00000046570.11.235e-1421.75pep primary_assembly:Astyanax_mexicanus-2.0:19:235... [more]
ENSAMXT00000050397.16.860e-1323.73pep primary_assembly:Astyanax_mexicanus-2.0:19:235... [more]
back to top
BLAST of Titin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000826.19.327e-2826.09pep scaffold:Pmarinus_7.0:GL476876:251045:270583:1... [more]
ENSPMAT00000002502.11.550e-2726.95pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-... [more]
mylka4.271e-1526.78myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000002463.11.103e-1324.52pep scaffold:Pmarinus_7.0:GL476400:5068:120393:-1 ... [more]
ENSPMAT00000010530.11.861e-1325.20pep scaffold:Pmarinus_7.0:GL477073:104451:224074:1... [more]
back to top
BLAST of Titin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Titin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495583.383e-2525.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495537.695e-2026.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495562.501e-1423.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495507.501e-1323.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495521.664e-1223.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Titin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027090.12.385e-2330.67pep primary_assembly:ASM223467v1:21:27247530:27253... [more]
ENSORLT00000046443.11.835e-2033.18pep primary_assembly:ASM223467v1:21:968974:990901:... [more]
ENSORLT00000036245.15.559e-2026.42pep primary_assembly:ASM223467v1:17:27817163:27827... [more]
ENSORLT00000044036.14.024e-1830.52pep primary_assembly:ASM223467v1:21:968974:997146:... [more]
ENSORLT00000038377.12.700e-1425.79pep primary_assembly:ASM223467v1:21:27290473:27302... [more]
back to top
BLAST of Titin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029197.10.000e+099.86SMESG000029197.1[more]
SMESG000029197.10.000e+099.02SMESG000029197.1[more]
SMESG000041478.11.817e-9638.35SMESG000041478.1[more]
SMESG000076529.14.033e-9637.04SMESG000076529.1[more]
SMESG000005752.13.197e-1725.84SMESG000005752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008578 ID=SMED30008578|Name=Titin|organism=Schmidtea mediterranea sexual|type=transcript|length=2486bp
CTTCCGATCTTTGATCTATTCAGGTAAACAACACTTGCCTGCGAGCTAAA
TTGCGGCACACATCCCGATGCACAAACACAAGCCATCCTATTAAAATCAA
GATCGCGATCCATTCTGTATTCTCTACTGGCACGTATCGATTGGAAATAT
TTCTCAGGAATAATAAATTTCGGTTTCAAATTTAGAAAATAATCGTTCGT
CAAAAAAAACCACCTTTGAAACCTTCAATATGTCAAGTGTTGCGTCAATT
AATTTATCGAGTTCTAAGTCACCCCAAATCATTCATGTTGGAGGTCAGAA
TAGCCCGAAAGGTCAGGTTTTTCATGTTTCTGGTCATGATTCAGATCAGG
TCTTTTCAGGCAACAACATTCAACAAATGAATATGCAAGGTCCAAAGTTG
GCATACCCAGCTTCGAATTATCCTTCCGTGGCACAACAACAACAATACCA
GCAACAATACCAAATGCAACCGCAATACCAGCCTCAGCAACAACCGATTC
AGCCACAATATTTTGAAGCTCAAACAGATGTATATCAACGTCAACCGCAA
TACTATCAGGCCCAATACCAACCACAAGAACAATATCAACAGCAATATCA
AGCACCACCGCAGCCGCAATATAACTCAATCCAATTCGATACAGCACATC
CACAAATGTCAATACAATCCAAAGATTTTTCCAAACCACCGGTTTTTGAA
GCTCCAATAGAGAAAATGCAAATAGTTAAAAAAAATCAGACTGCTCCACC
ACGGTTTTCAGAACCAAATATGCAGCAATCATTTCGTTCTTCAAGAAGTG
GATCCGTTGCTCATTTAGATGAAATTACTGATCCGCCAAGTTTTGTTAAA
CATCCGGAACGATATCAAGTTGCAAATGAAGGAGATCCCGCTAGCTTAAC
AGCTCGAGTGATTCCCGCCGGTGATCCTAATTTAACCGTTCAATGGTATA
AAGATGGTGTGCCATTAGCAGCAGGGTCCAGATTTAACACTTCTTTTGAA
AGAGGATTCGCAATACTCGATATTCTTTATACGTTTAAGGAGGATTCAGG
AGAGTATTCCTGTGTTGCAAAAAACAATTTTGGAATGGATCAAACTTCTC
CATCAACACTTAATGTTAACCTGGACGAAAGTGTTGTTCTAAATTCTCAT
TTGCCCCAAGAAATGACCGAAAGTATTGCTGCTATTGAAGCCAGTTTAAA
TACTCCTAAGACACAAGATATCCATATTGATGCTCCTATCAGACCACCAC
AATTCGTCAAACCGATGCCAGGATTATATAACCTACAAGGTGGTCAATCA
GTTCATTTGGAAACAAGAGTTATTCCTATTACTGATTCGTCATTAGTAAT
TGAATGGTTTAAAAATGGAAGACCTTTAAATAATGGTTGCAGATTCAATA
TTGTTTTCGATAGAGGTTTTGCCATTCTTGATATCATCGGTGTAATATCG
GAAGATACGGGTGACTACTTCTGTTTCGCTCGAAACAAGGCTGGACAAGC
TCAAAGCAATGTTGTTCGACTATTAGTCGCTACTGAAGAGACAGTGGTTA
CCAAATCTCAGTTACCACAAGAGTCGGTTCAGTATTTGCAATCATTGGAT
ATACAAAATACAGAGGATGTTGACAGATCAAATTTTCGATATGAAGAGGA
AGAAGAAAACGAATCTCTTCCACATTTTGATATTAAACCGATTAATTTAA
CTGTTGAAGAAGGAAATCCCGCAAGATTTTTAGTTAAAGTTAGCGGGTAT
CCTCGACCTCAAATTCAATGGTTTTTAAATGAATGTTTAGTTATTCCAAC
ATCTATTCAAAAAGTTTACAGTGATGGATCTATAAGTTATTTAGAATTTC
AAAGGTGCAAAATCCCCGGTGAAAGTTTTATTGTTGTCTCGGCTAAGAAT
AAATTAGGTGAAGCTGTTGCAAATGCTACTCTGTCTGTCATACCTGAAAA
TGACTTTCGGCCGGAGCTCAAACGGACAGATCCAGCAATTTTACTGAGAA
ATGAAAATCCATTCAGAAAACTTTCAACACTTAAAAAAGTGGCAGTTAGT
CCTGAATTGCAAAACGCTTTTCGTAAAACCAAACCATCAGCTGTACAATT
AAGTAACTATGAAAGAGGAGCACCGAGATCTAAAGAAGCTTCAGACGCGG
AAAATCTCTATGCAAACGTTCAATCTAGATTAAGAAGATCCGATAAATTA
AGTTATGCTGGTGCTCCTAGTGGAGGACAAATGCCACCACAAACTCAAAG
CTACGTCGATGAACACTTCACGGGACCAACCGTGCAAACTAGTCAAGTAA
CTATGCAGATAGGAAACGCGAACTATAATACTCCAAATCCTCAAACCGAA
ATGACCCTCCGACTTTAAATTTAGTCCCAAATTATTGCATGTTATAGATG
GAGATCCAGATAATGATGAAGACAATTTATTCACTTTTAATACCAATTAG
TTAAATTCAAATATATAATTAGATTTTGAAAAAAAA
back to top

protein sequence of SMED30008578-orf-1

>SMED30008578-orf-1 ID=SMED30008578-orf-1|Name=SMED30008578-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=713bp
MSSVASINLSSSKSPQIIHVGGQNSPKGQVFHVSGHDSDQVFSGNNIQQM
NMQGPKLAYPASNYPSVAQQQQYQQQYQMQPQYQPQQQPIQPQYFEAQTD
VYQRQPQYYQAQYQPQEQYQQQYQAPPQPQYNSIQFDTAHPQMSIQSKDF
SKPPVFEAPIEKMQIVKKNQTAPPRFSEPNMQQSFRSSRSGSVAHLDEIT
DPPSFVKHPERYQVANEGDPASLTARVIPAGDPNLTVQWYKDGVPLAAGS
RFNTSFERGFAILDILYTFKEDSGEYSCVAKNNFGMDQTSPSTLNVNLDE
SVVLNSHLPQEMTESIAAIEASLNTPKTQDIHIDAPIRPPQFVKPMPGLY
NLQGGQSVHLETRVIPITDSSLVIEWFKNGRPLNNGCRFNIVFDRGFAIL
DIIGVISEDTGDYFCFARNKAGQAQSNVVRLLVATEETVVTKSQLPQESV
QYLQSLDIQNTEDVDRSNFRYEEEEENESLPHFDIKPINLTVEEGNPARF
LVKVSGYPRPQIQWFLNECLVIPTSIQKVYSDGSISYLEFQRCKIPGESF
IVVSAKNKLGEAVANATLSVIPENDFRPELKRTDPAILLRNENPFRKLST
LKKVAVSPELQNAFRKTKPSAVQLSNYERGAPRSKEASDAENLYANVQSR
LRRSDKLSYAGAPSGGQMPPQTQSYVDEHFTGPTVQTSQVTMQIGNANYN
TPNPQTEMTLRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003598Ig_sub2
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008307structural constituent of muscle
GO:0003779actin binding
Vocabulary: cellular component
TermDefinition
GO:0005863striated muscle myosin thick filament
GO:0005875microtubule associated complex
GO:0030017sarcomere
GO:0030018Z disc
GO:0031674I band
GO:0000794condensed nuclear chromosome
GO:0005634nucleus
GO:0005694chromosome
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0007062sister chromatid cohesion
GO:0007067mitotic nuclear division
GO:0007076mitotic chromosome condensation
GO:0007275multicellular organism development
GO:0007498mesoderm development
GO:0007517muscle organ development
GO:0007519skeletal muscle tissue development
GO:0007520myoblast fusion
GO:0007522visceral muscle development
GO:0007525somatic muscle development
GO:0016203muscle attachment
GO:0019233sensory perception of pain
GO:0035206regulation of hemocyte proliferation
GO:0040011locomotion
GO:0045214sarcomere organization
GO:0051301cell division
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01