protein PAT1 homolog 1-like

Overview
Nameprotein PAT1 homolog 1-like
Smed IDSMED30008565
Length (bp)2663
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein PAT1 homolog 1-like (SMED30008565) t-SNE clustered cells

Violin plots show distribution of expression levels for protein PAT1 homolog 1-like (SMED30008565) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein PAT1 homolog 1-like (SMED30008565) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein PAT1 homolog 1-like (SMED30008565) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008565

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008565SMESG000080994.1 SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069022.1 SMESG000066578.1 SMESG000060322.1 SMESG000043653.1 SMESG000034864.1 SMESG000032108.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 SMESG000005359.1 Contig5571uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008565SMESG000080994.1 SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069022.1 SMESG000066578.1 SMESG000060322.1 SMESG000043653.1 SMESG000034864.1 SMESG000032108.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 SMESG000005359.1 Contig5571newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30008565SMESG000036897.1 SMESG000070229.1 dd_Smed_v4_5026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008565SMESG000007855.1 Contig3858GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008565SMESG000080994.1 SMESG000075755.1 SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069545.1 SMESG000060322.1 SMESG000053184.1 SMESG000052009.1 SMESG000045758.1 SMESG000043653.1 SMESG000037873.1 SMESG000034763.1 SMESG000032108.1 SMESG000026359.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 SMESG000005359.1 SMESG000003213.1 SMESG000000711.1 Contig55144uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008565SMESG000080994.1 SMESG000075755.1 SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069545.1 SMESG000060322.1 SMESG000053184.1 SMESG000052009.1 SMESG000045758.1 SMESG000043653.1 SMESG000037873.1 SMESG000034763.1 SMESG000032108.1 SMESG000026359.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 SMESG000005359.1 SMESG000003213.1 SMESG000000711.1 Contig55144newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008565SMESG000070229.1 Contig3858GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
ovarySMED30008565SMESG000070229.1 SMESG000008246.1 SMESG000006895.1 PL06021B2E08ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30008565SMESG000070229.1 SMESG000008246.1 SMESG000006895.1 PL06021B2E08ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
oocyteSMED30008565SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069022.1 SMESG000066578.1 SMESG000052009.1 SMESG000043653.1 SMESG000032108.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 Contig10650uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30008565SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069022.1 SMESG000066578.1 SMESG000052009.1 SMESG000043653.1 SMESG000032108.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 Contig10650uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30008565SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069022.1 SMESG000066578.1 SMESG000052009.1 SMESG000043653.1 SMESG000032108.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 Contig10650newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30008565SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069022.1 SMESG000066578.1 SMESG000052009.1 SMESG000043653.1 SMESG000032108.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 Contig10650newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008565SMESG000080994.1 SMESG000075755.1 SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069545.1 SMESG000060322.1 SMESG000053184.1 SMESG000052009.1 SMESG000045758.1 SMESG000043653.1 SMESG000037873.1 SMESG000034763.1 SMESG000032108.1 SMESG000026359.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 SMESG000005359.1 SMESG000003213.1 SMESG000000711.1 Contig55144uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008565SMESG000080994.1 SMESG000075755.1 SMESG000075754.1 SMESG000072110.1 SMESG000070229.1 SMESG000069545.1 SMESG000060322.1 SMESG000053184.1 SMESG000052009.1 SMESG000045758.1 SMESG000043653.1 SMESG000037873.1 SMESG000034763.1 SMESG000032108.1 SMESG000026359.1 SMESG000024585.1 SMESG000017900.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 SMESG000006793.1 SMESG000005359.1 SMESG000003213.1 SMESG000000711.1 Contig55144newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30008565SMESG000070229.1 SMESG000008246.1 SMESG000007138.1 SMESG000006895.1 dd_Smed_v4_5717_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein PAT1 homolog 1-like vs. Ensembl Human
Match: PATL1 (PAT1 homolog 1, processing body mRNA decay factor [Source:HGNC Symbol;Acc:HGNC:26721])

HSP 1 Score: 78.5666 bits (192), Expect = 2.996e-14
Identity = 62/238 (26.05%), Postives = 113/238 (47.48%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQM--KLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCM---------TNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFN 1923
            M + E+DW+ KIQ   L + +PY  D+YY     KL++++ A  ++I   G       L               I P    L    KP+ FE SLG L+ S++N PR++I   + +R+    +   K  ++    R+ L +IEK YS++L +++ ++   R L+   + R  L+  R + +  + D +          ++  FV ++ + KG R+V   +  +S++Q   I+ T   N
Sbjct:  405 MLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAA--EEIQGDGPKKERTKL---------------ITPQVAKLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSE---DDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYER---RYLLSLEEERPALMDDRKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADILMTTARN 619          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Zebrafish
Match: patl1 (PAT1 homolog 1, processing body mRNA decay factor [Source:NCBI gene;Acc:100009659])

HSP 1 Score: 81.6481 bits (200), Expect = 2.401e-15
Identity = 81/342 (23.68%), Postives = 151/342 (44.15%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLL-------MDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFG---LYVILTLLDSLLKSNP-----DDKAHVTQLLSIT 2220
            M++ E++W+ KIQ   L + +PY  DYYY     K      R +  +  HTT                    I P    L    +P+ F  SLG L+ S++N PR++I   + +R+    +  +K  K V N  R++L  +EKMYS++L + + +K    +   +H+   +L QH+ + L+L         D   ++ + + ++SV KG R++   +  +   Q   +V  +  N  ++ + +   ++   L   +   ++++ S  L+ L                 S G+  PL     ++FG   LY+IL+  + +  S+P     DD      + S+T
Sbjct:  414 MTQREKEWVAKIQMMQLQSTDPYLDDYYYQNYYEKMEKRQERDRDNRKEHTTKL------------------ITPQVAKLEHTYRPVQFAGSLGKLTVSSVNNPRKMIDAVVTSRS----DDEEKREKQVWNKRRQILYTVEKMYSLLLEVQDFEKKF--LQTPEHQRDVLLEQHKTHTLQLYNSLREKEWDDRVSDEQCLMIMSVRKGKRLISRLLPFLPQPQAAAVVMGIARNLPALAKKDKQDQVLCWLVEPVSVVIQSMSSTSLTDLLQELQG-----------SEGQL-PLV--LQNKFGVTLLYLILSEGERMQSSDPNCQLMDDNRWTELVFSVT 717          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Zebrafish
Match: patl1 (PAT1 homolog 1, processing body mRNA decay factor [Source:NCBI gene;Acc:100009659])

HSP 1 Score: 81.2629 bits (199), Expect = 3.210e-15
Identity = 81/342 (23.68%), Postives = 151/342 (44.15%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLL-------MDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFG---LYVILTLLDSLLKSNP-----DDKAHVTQLLSIT 2220
            M++ E++W+ KIQ   L + +PY  DYYY     K      R +  +  HTT                    I P    L    +P+ F  SLG L+ S++N PR++I   + +R+    +  +K  K V N  R++L  +EKMYS++L + + +K    +   +H+   +L QH+ + L+L         D   ++ + + ++SV KG R++   +  +   Q   +V  +  N  ++ + +   ++   L   +   ++++ S  L+ L                 S G+  PL     ++FG   LY+IL+  + +  S+P     DD      + S+T
Sbjct:  414 MTQREKEWVAKIQMMQLQSTDPYLDDYYYQNYYEKMEKRQERDRDNRKEHTTKL------------------ITPQVAKLEHTYRPVQFAGSLGKLTVSSVNNPRKMIDAVVTSRS----DDEEKREKQVWNKRRQILYTVEKMYSLLLEVQDFEKKF--LQTPEHQRDVLLEQHKTHTLQLYNSLREKEWDDRVSDEQCLMIMSVRKGKRLISRLLPFLPQPQAAAVVMGIARNLPALAKKDKQDQVLCWLVEPVSVVIQSMSSTSLTDLLQELQG-----------SEGQL-PLV--LQNKFGVTLLYLILSEGERMQSSDPNCQLMDDNRWTELVFSVT 717          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Zebrafish
Match: patl2 (PAT1 homolog 2 [Source:ZFIN;Acc:ZDB-GENE-121214-350])

HSP 1 Score: 52.373 bits (124), Expect = 2.772e-6
Identity = 58/230 (25.22%), Postives = 109/230 (47.39%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHR-ELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLL---MDC--MTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTL 1914
            MS+ E++W+I++Q   L + NP+  DYYY +   +  T+   ++ +  G  T  +P  L    ++       +             +H E SLG ++ S   +PR+ I     + ++         HK  R  R E+L  IEK+Y I+L ++E +K    +  ++ +SR  L+Q+    ++ L   + C  + +  +F+  L VSKG R+V   +  +S    + I+ T+
Sbjct:  359 MSDKEKEWIIRLQMIQLQSENPHLDDYYYQEYYQRMETKLAEEEYV--GDRTKKEPPKLTTPYVSKNVSYIPV-------------VHIEGSLGQVAVSTCFSPRRAIDAVHASTHD--------EHKDTRQQRLEVLSTIEKLYLILLEVEEAEKVKTTVSDKEEESR--LMQNMKRKVEQLYNELRCTNLDSGEEFLSCLLVSKGKRLVARLLPFLSHDSALHILSTV 563          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Zebrafish
Match: patl2 (PAT1 homolog 2 [Source:ZFIN;Acc:ZDB-GENE-121214-350])

HSP 1 Score: 51.9878 bits (123), Expect = 2.982e-6
Identity = 79/329 (24.01%), Postives = 149/329 (45.29%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHR-ELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLL---MDC--MTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESE-------YFREIEAELRSLICSR-VRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFG---LYVILTLLDSLLKSN 2178
            MS+ E++W+I++Q   L + NP+  DYYY +   +  T+   ++ +  G  T  +P  L    ++       +             +H E SLG ++ S   +PR+ I     + ++         HK  R  R E+L  IEK+Y I+L ++E +K    +  ++ +SR  L+Q+    ++ L   + C  + +  +F+  L VSKG R+V   +  +S    + I+ T+  +   +   +        +  + A +  L+ S+ +R LK           +  L P+SQ   ++      LA  C ++FG   LY +L+  + LL S+
Sbjct:  337 MSDKEKEWIIRLQMIQLQSENPHLDDYYYQEYYQRMETKLAEEEYV--GDRTKKEPPKLTTPYVSKNVSYIPV-------------VHIEGSLGQVAVSTCFSPRRAIDAVHASTHD--------EHKDTRQQRLEVLSTIEKLYLILLEVEEAEKVKTTVSDKEEESR--LMQNMKRKVEQLYNELRCTNLDSGEEFLSCLLVSKGKRLVARLLPFLSHDSALHILSTVTKHLPVLMSRDTDEALPILYPSLRAVINGLVFSQLIRILKE----------FTALLPDSQDTRLT------LA--CQNKFGLSLLYALLSQGERLLSSD 622          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Zebrafish
Match: patl2 (PAT1 homolog 2 [Source:ZFIN;Acc:ZDB-GENE-121214-350])

HSP 1 Score: 51.9878 bits (123), Expect = 3.026e-6
Identity = 58/230 (25.22%), Postives = 109/230 (47.39%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHR-ELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLL---MDC--MTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTL 1914
            MS+ E++W+I++Q   L + NP+  DYYY +   +  T+   ++ +  G  T  +P  L    ++       +             +H E SLG ++ S   +PR+ I     + ++         HK  R  R E+L  IEK+Y I+L ++E +K    +  ++ +SR  L+Q+    ++ L   + C  + +  +F+  L VSKG R+V   +  +S    + I+ T+
Sbjct:  333 MSDKEKEWIIRLQMIQLQSENPHLDDYYYQEYYQRMETKLAEEEYV--GDRTKKEPPKLTTPYVSKNVSYIPV-------------VHIEGSLGQVAVSTCFSPRRAIDAVHASTHD--------EHKDTRQQRLEVLSTIEKLYLILLEVEEAEKVKTTVSDKEEESR--LMQNMKRKVEQLYNELRCTNLDSGEEFLSCLLVSKGKRLVARLLPFLSHDSALHILSTV 537          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Xenopus
Match: stat6 (signal transducer and activator of transcription 6 [Source:Xenbase;Acc:XB-GENE-484108])

HSP 1 Score: 69.707 bits (169), Expect = 1.596e-11
Identity = 77/301 (25.58%), Postives = 131/301 (43.52%), Query Frame = 1
Query: 1018 PFYSNLMAMLATQNASMAIQSNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSR-CR--NFDLNE----GGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQM--KLKEMT--EARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNN--------SKFVDLLSVSKGARIVV 1860
            PF+   +   A QN      +++ PQ   M  Q  QNR             ++ R ++     R CR    +LN      G M + E++W+ +IQ   L + +PY  DYYY     KL +++  + R ++  K   T L                   I P    L    KP+ FE SLG L+ S++N PR++I     +R++    R     K VR+  R+ L  IEKM+S++L +++ ++     L  +   + V+ + R   L+ L D +            +FV ++ + KG R++ 
Sbjct:  298 PFFG--VPSYAVQNFFRPDTTHLHPQHRRMLYQRQQNR-------------NQHRGVNGTGGERNCRPAQMELNHRDPYAGLMLQREKEWVCRIQLLQLQSTDPYHDDYYYQNYFEKLGKLSVSQDRSREGPKKERTKL-------------------ITPQVAKLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVATSRSDEDETR----EKQVRDKKRQTLVTIEKMFSLLLDLEDFERRFT--LCCEEAEQEVMNEERKQKLQQLCDTLRGKEVGERVAEEQFVQIMCIRKGKRMIA 558          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Xenopus
Match: stat6 (signal transducer and activator of transcription 6 [Source:Xenbase;Acc:XB-GENE-484108])

HSP 1 Score: 68.9366 bits (167), Expect = 2.444e-11
Identity = 59/222 (26.58%), Postives = 103/222 (46.40%), Query Frame = 1
Query: 1234 GGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQM--KLKEMT--EARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNN--------SKFVDLLSVSKGARIVV 1860
             G M + E++W+ +IQ   L + +PY  DYYY     KL +++  + R ++  K   T L                   I P    L    KP+ FE SLG L+ S++N PR++I     +R++    R     K VR+  R+ L  IEKM+S++L +++ ++     L  +   + V+ + R   L+ L D +            +FV ++ + KG R++ 
Sbjct:  359 AGLMLQREKEWVCRIQLLQLQSTDPYHDDYYYQNYFEKLGKLSVSQDRSREGPKKERTKL-------------------ITPQVAKLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVATSRSDEDETR----EKQVRDKKRQTLVTIEKMFSLLLDLEDFERRFT--LCCEEAEQEVMNEERKQKLQQLCDTLRGKEVGERVAEEQFVQIMCIRKGKRMIA 555          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Xenopus
Match: stat6 (signal transducer and activator of transcription 6 [Source:Xenbase;Acc:XB-GENE-484108])

HSP 1 Score: 68.9366 bits (167), Expect = 2.667e-11
Identity = 59/222 (26.58%), Postives = 103/222 (46.40%), Query Frame = 1
Query: 1234 GGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQM--KLKEMT--EARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNN--------SKFVDLLSVSKGARIVV 1860
             G M + E++W+ +IQ   L + +PY  DYYY     KL +++  + R ++  K   T L                   I P    L    KP+ FE SLG L+ S++N PR++I     +R++    R     K VR+  R+ L  IEKM+S++L +++ ++     L  +   + V+ + R   L+ L D +            +FV ++ + KG R++ 
Sbjct:  370 AGLMLQREKEWVCRIQLLQLQSTDPYHDDYYYQNYFEKLGKLSVSQDRSREGPKKERTKL-------------------ITPQVAKLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVATSRSDEDETR----EKQVRDKKRQTLVTIEKMFSLLLDLEDFERRFT--LCCEEAEQEVMNEERKQKLQQLCDTLRGKEVGERVAEEQFVQIMCIRKGKRMIA 566          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Xenopus
Match: stat6 (signal transducer and activator of transcription 6 [Source:Xenbase;Acc:XB-GENE-484108])

HSP 1 Score: 68.5514 bits (166), Expect = 3.230e-11
Identity = 59/222 (26.58%), Postives = 103/222 (46.40%), Query Frame = 1
Query: 1234 GGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQM--KLKEMT--EARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNN--------SKFVDLLSVSKGARIVV 1860
             G M + E++W+ +IQ   L + +PY  DYYY     KL +++  + R ++  K   T L                   I P    L    KP+ FE SLG L+ S++N PR++I     +R++    R     K VR+  R+ L  IEKM+S++L +++ ++     L  +   + V+ + R   L+ L D +            +FV ++ + KG R++ 
Sbjct:  374 AGLMLQREKEWVCRIQLLQLQSTDPYHDDYYYQNYFEKLGKLSVSQDRSREGPKKERTKL-------------------ITPQVAKLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVATSRSDEDETR----EKQVRDKKRQTLVTIEKMFSLLLDLEDFERRFT--LCCEEAEQEVMNEERKQKLQQLCDTLRGKEVGERVAEEQFVQIMCIRKGKRMIA 570          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Mouse
Match: Patl1 (protein associated with topoisomerase II homolog 1 (yeast) [Source:MGI Symbol;Acc:MGI:2147679])

HSP 1 Score: 76.6406 bits (187), Expect = 7.903e-14
Identity = 59/232 (25.43%), Postives = 111/232 (47.84%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQM--KLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCM---------TNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIV 1905
            M + E+DW+ KIQ   L + +PY  D+YY     KL++++ A  ++I   G       L               I P    L    +P+ FE SLG L+ S++N PR++I   + +R+    +   K  ++    R+ L +IEK YS++L +++ ++   R L+   + R  L+  R + +  + D +          ++  FV ++ + KG R+V   +  +S++Q   I+
Sbjct:  405 MLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAA--EEIQGDGPKKERTKL---------------ITPQVAKLEHAYQPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSE---DDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYER---RYLLSLEEERPALMDERKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADIL 613          
BLAST of protein PAT1 homolog 1-like vs. UniProt/SwissProt
Match: sp|A2RRV3|PATL1_DANRE (Protein PAT1 homolog 1 OS=Danio rerio OX=7955 GN=patl1 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.403e-14
Identity = 81/342 (23.68%), Postives = 151/342 (44.15%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLL-------MDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFG---LYVILTLLDSLLKSNP-----DDKAHVTQLLSIT 2220
            M++ E++W+ KIQ   L + +PY  DYYY     K      R +  +  HTT                    I P    L    +P+ F  SLG L+ S++N PR++I   + +R+    +  +K  K V N  R++L  +EKMYS++L + + +K    +   +H+   +L QH+ + L+L         D   ++ + + ++SV KG R++   +  +   Q   +V  +  N  ++ + +   ++   L   +   ++++ S  L+ L                 S G+  PL     ++FG   LY+IL+  + +  S+P     DD      + S+T
Sbjct:  414 MTQREKEWVAKIQMMQLQSTDPYLDDYYYQNYYEKMEKRQERDRDNRKEHTTKL------------------ITPQVAKLEHTYRPVQFAGSLGKLTVSSVNNPRKMIDAVVTSRS----DDEEKREKQVWNKRRQILYTVEKMYSLLLEVQDFEKKF--LQTPEHQRDVLLEQHKTHTLQLYNSLREKEWDDRVSDEQCLMIMSVRKGKRLISRLLPFLPQPQAAAVVMGIARNLPALAKKDKQDQVLCWLVEPVSVVIQSMSSTSLTDLLQELQG-----------SEGQL-PLV--LQNKFGVTLLYLILSEGERMQSSDPNCQLMDDNRWTELVFSVT 717          
BLAST of protein PAT1 homolog 1-like vs. UniProt/SwissProt
Match: sp|Q86TB9|PATL1_HUMAN (Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 1.439e-13
Identity = 62/238 (26.05%), Postives = 113/238 (47.48%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQM--KLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCM---------TNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFN 1923
            M + E+DW+ KIQ   L + +PY  D+YY     KL++++ A  ++I   G       L               I P    L    KP+ FE SLG L+ S++N PR++I   + +R+    +   K  ++    R+ L +IEK YS++L +++ ++   R L+   + R  L+  R + +  + D +          ++  FV ++ + KG R+V   +  +S++Q   I+ T   N
Sbjct:  405 MLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAA--EEIQGDGPKKERTKL---------------ITPQVAKLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSE---DDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYER---RYLLSLEEERPALMDDRKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADILMTTARN 619          
BLAST of protein PAT1 homolog 1-like vs. UniProt/SwissProt
Match: sp|Q5R8Q4|PATL1_PONAB (Protein PAT1 homolog 1 OS=Pongo abelii OX=9601 GN=PATL1 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.451e-13
Identity = 62/238 (26.05%), Postives = 113/238 (47.48%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQM--KLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCM---------TNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFN 1923
            M + E+DW+ KIQ   L + +PY  D+YY     KL++++ A  ++I   G       L               I P    L    KP+ FE SLG L+ S++N PR++I   + +R+    +   K  ++    R+ L +IEK YS++L +++ ++   R L+   + R  L+  R + +  + D +          ++  FV ++ + KG R+V   +  +S++Q   I+ T   N
Sbjct:  405 MLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAA--EEIQGDGPKKERTKL---------------ITPQVAKLEHTYKPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSE---DDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYER---RYLLSLEEERPALMDERKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADILMTTARN 619          
BLAST of protein PAT1 homolog 1-like vs. UniProt/SwissProt
Match: sp|Q3TC46|PATL1_MOUSE (Protein PAT1 homolog 1 OS=Mus musculus OX=10090 GN=Patl1 PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 5.528e-13
Identity = 59/232 (25.43%), Postives = 111/232 (47.84%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQM--KLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCM---------TNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIV 1905
            M + E+DW+ KIQ   L + +PY  D+YY     KL++++ A  ++I   G       L               I P    L    +P+ FE SLG L+ S++N PR++I   + +R+    +   K  ++    R+ L +IEK YS++L +++ ++   R L+   + R  L+  R + +  + D +          ++  FV ++ + KG R+V   +  +S++Q   I+
Sbjct:  405 MLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAA--EEIQGDGPKKERTKL---------------ITPQVAKLEHAYQPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSE---DDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYER---RYLLSLEEERPALMDERKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADIL 613          
BLAST of protein PAT1 homolog 1-like vs. UniProt/SwissProt
Match: sp|B5DF93|PATL1_RAT (Protein PAT1 homolog 1 OS=Rattus norvegicus OX=10116 GN=Patl1 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.206e-12
Identity = 60/232 (25.86%), Postives = 108/232 (46.55%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQM--KLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCM---------TNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIV 1905
            M + E+DW+ KIQ   L + +PY  D+YY     KL++ + A   Q    G     +   L             I P    L    KP+ FE SLG L+ S++N PR++I   + +R+    +   K  ++    R+ L +IEK YS++L +++ ++   R L+   + R  L   R + +  + D +          ++  FV ++ + KG R+V   +  +S++Q   I+
Sbjct:  405 MLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKSSAAEEMQ----GDGPKKERTKL-------------ITPQVARLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSE---DDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYER---RYLLSLEEERPALTDERKHKIWSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADIL 613          
BLAST of protein PAT1 homolog 1-like vs. TrEMBL
Match: R7T9B8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225516 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.519e-16
Identity = 87/337 (25.82%), Postives = 156/337 (46.29%), Query Frame = 1
Query: 1189 HSDYQSRCRNFDLNE-------GGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRN----YLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQL-GDISNGRF--QPLAGFCSSEFGLYVILTLL 2157
            H DY    RN D  E          M+E E+DW+IKIQ R L T+NPY  DYYYT M++K+    RR + +                 +   Q+ A +D  KD      KP+ FE SLG L+ S+++ PR+II +      N      +   + VR  ++LL  IE  Y  +L +DE++K   R L    ++R  + + R+    ++ +   + + +   +  LL+V KG +++   + ++     + +  +L  +   + + E+ +++      ++C        E ++ L     C+L    +L G +S  +    P+AG   ++FG  V+  L+
Sbjct:  473 HDDY---YRNEDYREERNGDPYANLMTEREKDWVIKIQLRQLQTDNPYLDDYYYTSMQMKKEAAKRRGRQIDA--------------KLVIPQIAAKMD--KD-----YKPLTFEGSLGRLTTSSVHNPRRIIDVS----GNSTHEIDEAKGREVRRFKKLLLDIEASYDTLLDVDELEK---RALALPEEARTAVYEERSHKILHMYQAFHELIMDEEAYCRLLAVRKGVKVIARLLPLLPKDNGVLLASSLLAHLSLISKKEWQKDV----LPVVC--------ENMAVLIQC--CDLDGLVKLSGALSEDKTSDSPIAGALQNQFGSSVVWCLV 764          
BLAST of protein PAT1 homolog 1-like vs. TrEMBL
Match: C3YG12 (PAT1 domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_119484 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.236e-15
Identity = 89/322 (27.64%), Postives = 146/322 (45.34%), Query Frame = 1
Query: 1237 GWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMT-EARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGL-------KPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNH--RELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVL-----VQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFGLYVILTLL 2157
            G M++ E++W++KIQ   L ++NP   DYYY     K+M  EA R     T                +GE  G G  P K  + P L       KP HFE +LG +S S++N PR++I     A  +      D    + ++H  RELL LIEK YS++L +++++K +  M V + + R +L     + H+ Y    L    +N+ +F+  + + KG  +V   + I+       +V  +  N   +   +   E+   L S +   +RN     L  LTS     +  N    D +N     L     ++FG+ V+ +LL
Sbjct:  476 GLMTQREKEWVVKIQMLQLQSSNPMMEDYYYQAYMSKKMAQEAERPPSQGT----------------SGEGDGPGSSPPKL-ITPQLKQEHKTYKPAHFEHTLGRVSVSSVNNPRKLIDFAAHAEED-----HDMKSGIGKDHRRRELLLLIEKTYSVMLELEDIEKKV--MSVSEEERRSLLEARIGMVHQIYNNFGLTADGSNDDQFLHWMCIRKGKSLVGRVLPILPRDNAATVVTCVLRNLAILIRKDTQDEMLPHLSSSVSHVIRN---SHLDHLTSFLQAIIQGN----DGAN-----LTAAVQNKFGMSVLCSLL 761          
BLAST of protein PAT1 homolog 1-like vs. TrEMBL
Match: A0A0F8BQ01 (Protein PAT1 OS=Larimichthys crocea OX=215358 GN=EH28_02728 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.870e-15
Identity = 100/398 (25.13%), Postives = 173/398 (43.47%), Query Frame = 1
Query: 1078 SNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLK-EMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLAR-------MLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFG---LYVILTLLDSLLKSNP-----DDKAHVTQLLSIT 2220
            +++ PQ   M  Q +QNR   R  +        DR+    Y +            M++ E++W+ KIQ   L + +PY  DYYY     K E  + R Q   K  HTT                    I P    +    +P+ F  SLG L+ S++N PR++I   + +R     +  +K  K V N  R++L  +EKMYS++L + + +K   +        L+EQHK+    VQ  N L +   D   ++ + V ++SV KG R++   + ++ S Q   +V  +  N  ++ + +   ++   L   + + +++L S  L+ L      N            G+   LA    ++FG   LY+IL+  + +  S+P     DD      + S+T
Sbjct:  471 THLHPQHRRMLTQRMQNRGGDRGRTA------GDRRSRDPYSN-----------LMTQKEKEWVTKIQMMQLQSTDPYLDDYYYQNYYEKMEKRQEREQDSSKKEHTTKL------------------ITPQVAKVEHTYRPVQFAGSLGKLTVSSVNNPRKMIDAVVTSR----TDDEEKREKQVWNKRRQILYTVEKMYSLLLEVQDFEKRFVQAPEEDREALLEQHKTN--TVQLCNSLREKEWDDRVSDEQCVMIMSVRKGKRLISRLLPLLPSPQAAAVVMAIARNLPALAKKDKQDQVLCWLVEPVSAVIQSLSSSALTDLLQELQGN-----------EGQ---LATVLHNKFGVTLLYLILSEGERMQSSDPNCQLMDDNRWTELVFSVT 813          
BLAST of protein PAT1 homolog 1-like vs. TrEMBL
Match: A0A2U9BRQ9 (PAT1 domain-containing protein OS=Scophthalmus maximus OX=52904 GN=SMAX5B_001743 PE=4 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 8.591e-15
Identity = 90/343 (26.24%), Postives = 154/343 (44.90%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLK-EMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLAR-------MLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFG---LYVILTLLDSLLKSNP-----DDKAHVTQLLSIT 2220
            M++ E++W+ KIQ   L + +PY  DYYY     K E  + R +   K  HTT                    I P    +    +P+ F  SLG L+ S++N PR++I   +  R     +  +K  K V N  R++L  +EKMYS++L + + +K   +        L+EQHK+    VQ  N L     D   ++ + V ++SV KG R++   + I+ S Q   IV  +  N  ++ + +   ++   L   + + +++L S  L+ L             L ++     Q LA    ++FG   LY+IL+  + +  S+P     DD      + S+T
Sbjct:  365 MTQKEKEWVTKIQMMQLQSTDPYLDDYYYQNYYEKMEKRQERERDSSKKEHTTKL------------------ITPQVAKVEHTYRPVQFAGSLGKLTVSSVNNPRKMIDAVVTTR----TDDEEKREKQVWNKRRQILYTVEKMYSLLLEVQDFEKRFVQAPEEDREALLEQHKTN--TVQLCNSLRDKEWDDRVSDEQCVMIMSVRKGKRLISRLLPILPSPQATAIVMAIARNLPALAKKDKQDQVLCWLVEPLSAVIQSLSSSALTDL-------------LQELQGSEGQ-LATVLHNKFGVTLLYLILSEGERMQSSDPNCQLMDDNRWTELVFSVT 669          
BLAST of protein PAT1 homolog 1-like vs. TrEMBL
Match: A0A4Z2IRP8 (Protein PAT1 1 OS=Liparis tanakae OX=230148 GN=patl1 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.703e-14
Identity = 90/343 (26.24%), Postives = 154/343 (44.90%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLK-EMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLAR-------MLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFG---LYVILTLLDSLLKSNP-----DDKAHVTQLLSIT 2220
            M++ E++W+ KIQ   L + +PY  DYYY     K E  + R +   K  HTT                    I P    +    +P+ F  SLG L+ S++N PR++I   +  R     +  +K  K V N  R++L  +EKMYS++L + + +K   +        L+EQHKS    +Q  N L +   D   ++ + V ++SV KG R++   +A + S Q   IV  +  N  ++ + +   ++   L   + + +++L S  L+ L                 S G+   LA    ++FG   LY+IL+  + +  S+P     DD      + S+T
Sbjct:  445 MTQKEKEWVTKIQMMQLQSTDPYLDDYYYQNYYEKMERRQERERDSSKKEHTTKL------------------ITPQVAKVEHTYRPVQFAGSLGKLTVSSVNNPRKMIDAVVTTR----TDDEEKREKQVWNKRRQILYTVEKMYSMLLEVQDFEKRFIQAPEEDREALLEQHKSN--TMQLCNTLREKEWDDRVSDEQCVMIMSVRKGKRLISRLLAFLPSPQATAIVMAISRNLPALAKKDKQDQVLCWLVEPVSAVIQSLSSSALTDLLQELQG-----------SEGQ---LATVLHNKFGVTLLYLILSEGERMQSSDPNCQLMDDNRWTELVFSVT 749          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Cavefish
Match: patl1 (protein PAT1 homolog 1 [Source:NCBI gene;Acc:103031255])

HSP 1 Score: 82.0333 bits (201), Expect = 1.645e-15
Identity = 83/343 (24.20%), Postives = 152/343 (44.31%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLK-EMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLL-------MDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFG---LYVILTLLDSLLKSNP-----DDKAHVTQLLSIT 2220
            M++ E+DW+ +IQ   L + +PY  DYYY     K E  + R +   +  HTT                    I P    L    +P+ F  SLG L+ S++N PR++I   +  R     +  +K  K V N  R++L  +EKMYS++L + + +K   +   EQ ++  +L QH+ + L+L         D   ++ + + ++SV KG R+V   + ++   Q   +V  +  N  ++ + +   ++   L   +   ++++ S  L+ L                 S G+F        ++FG   LY+IL+  + +  S+P     DD      + S+T
Sbjct:  385 MTQKEKDWVARIQMMQLQSTDPYLDDYYYQNYYEKMEKRQERDRDSSRKEHTTKL------------------ITPQVAKLEHTYRPVQFAGSLGKLTVSSVNNPRKMIDAVVTTR----TDDEEKREKQVWNKRRQILYTVEKMYSLLLEVQDFEKKFLQTPEEQRET--MLEQHKTHTLQLYNSLREKEWDDRVSDEQCLMIMSVRKGKRLVSRLMPLLPPPQAAAVVMAVARNLPALAKKDKQDQVLCWLVEPVAVVIQSMSSSALTDLLQELQG-----------SEGQF---PRVLQNKFGVTLLYLILSEGERMQSSDPNCQLMDDNRWTELVFSVT 689          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Cavefish
Match: patl1 (protein PAT1 homolog 1 [Source:NCBI gene;Acc:103031255])

HSP 1 Score: 81.6481 bits (200), Expect = 1.876e-15
Identity = 83/343 (24.20%), Postives = 152/343 (44.31%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLK-EMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLL-------MDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFG---LYVILTLLDSLLKSNP-----DDKAHVTQLLSIT 2220
            M++ E+DW+ +IQ   L + +PY  DYYY     K E  + R +   +  HTT                    I P    L    +P+ F  SLG L+ S++N PR++I   +  R     +  +K  K V N  R++L  +EKMYS++L + + +K   +   EQ ++  +L QH+ + L+L         D   ++ + + ++SV KG R+V   + ++   Q   +V  +  N  ++ + +   ++   L   +   ++++ S  L+ L                 S G+F        ++FG   LY+IL+  + +  S+P     DD      + S+T
Sbjct:  419 MTQKEKDWVARIQMMQLQSTDPYLDDYYYQNYYEKMEKRQERDRDSSRKEHTTKL------------------ITPQVAKLEHTYRPVQFAGSLGKLTVSSVNNPRKMIDAVVTTR----TDDEEKREKQVWNKRRQILYTVEKMYSLLLEVQDFEKKFLQTPEEQRET--MLEQHKTHTLQLYNSLREKEWDDRVSDEQCLMIMSVRKGKRLVSRLMPLLPPPQAAAVVMAVARNLPALAKKDKQDQVLCWLVEPVAVVIQSMSSSALTDLLQELQG-----------SEGQF---PRVLQNKFGVTLLYLILSEGERMQSSDPNCQLMDDNRWTELVFSVT 723          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Cavefish
Match: ENSAMXT00000057157.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001105.1:603:6385:-1 gene:ENSAMXG00000029990.1 transcript:ENSAMXT00000057157.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 1.425e-6
Identity = 42/145 (28.97%), Postives = 66/145 (45.52%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLK-EMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRN-HRELLGLIEKM 1671
            M++ E+DW+ +IQ   L + +PY  DYYY     K E  + R +   +  HTT                    I P    L    +P+ F  SLG L+ S++N PR++I   +  R     +  +K  K V N  R++L  +EK+
Sbjct:  385 MTQKEKDWVARIQMMQLQSTDPYLDDYYYQNYYEKMEKRQERDRDSSRKEHTTKL------------------ITPQVAKLEHTYRPVQFAGSLGKLTVSSVNNPRKMIDAVVTTR----TDDEEKREKQVWNKRRQILYTVEKV 507          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Nematostella
Match: EDO38274 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDA7])

HSP 1 Score: 73.9442 bits (180), Expect = 1.772e-13
Identity = 60/253 (23.72%), Postives = 118/253 (46.64%), Query Frame = 1
Query: 1234 GGWMSESERDWLIKIQTRNLTTNNPYCHDYYY-TQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARM-------LVEQHKSRG--VLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREI 1962
             G M+  E++W+IKIQ   LT++ P   D+Y+ T ++ K+  E  +Q   + G  T    L                 P  +      KP+ F+ +LG +S S+++ PRQ++ I   ++ +    ++  S K ++  R++L  IEK Y  +L++D++++ +  +       L+E  +S G  +    +  +    +    +   FV L+SV KG  ++   +  +   Q   ++  L  N ISV + +   E+
Sbjct:  463 AGLMTRREKEWIIKIQLLQLTSSTPDLDDFYFQTYIRRKQAKERAKQGERRDGENTTQMAL-----------------PQFEREERNYKPLDFQGTLGKVSASSVSHPRQMVAIDHISKASEQDKQSSSSTKDIKRRRQILSAIEKAYEYLLQLDDLERKITHVHPEERNSLLEAQQSTGLKLFNLLKLNIRSESIGGKCDEEYFVQLMSVRKGKVLLSRVLPALKQPQAEAVLLALTRNVISVIKKDSQDEV 698          
BLAST of protein PAT1 homolog 1-like vs. Ensembl Medaka
Match: patl1 (PAT1 homolog 1, processing body mRNA decay factor [Source:NCBI gene;Acc:100009659])

HSP 1 Score: 51.6026 bits (122), Expect = 3.080e-6
Identity = 30/117 (25.64%), Postives = 56/117 (47.86%), Query Frame = 1
Query: 1243 MSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNN 1593
            MS+ E++W+ KIQ   L + +PY  DYYY + + ++ + +R++   K                         I P    +    +P+ F  SLG L+ S++N PR++I   + +R++
Sbjct:  301 MSQKEKEWVTKIQMMQLQSTDPYLDDYYYQRQEKEQDSSSRKEHATKL------------------------ITPQVAKVEHTYRPVQFAGSLGKLTVSSVNNPRKMIDAVVTSRSD 393          
BLAST of protein PAT1 homolog 1-like vs. Planmine SMEST
Match: SMESG000070229.1 (SMESG000070229.1)

HSP 1 Score: 1371.68 bits (3549), Expect = 0.000e+0
Identity = 702/704 (99.72%), Postives = 703/704 (99.86%), Query Frame = 1
Query:  190 MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKXXXXXXXXXXXXINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHXXXXXXXXXXXXXSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYANCPVQLNLEITKIIQHFTQQSQPQQLELCMTHPFYSNLMAMLATQNASMAIQSNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFGLYVILTLLDSLLKSNPDDKAHVTQLLSITIKSTDSQGFLQAYMKDFKNLFPSSERR 2301
            MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKSSDDLLGLTGSLINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHLNQLNKKLQLLNLSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYANCPVQLNLEITKIIQHFTQQSQPQQLELCMTHPFYSNLMAMLATQNASMAIQSNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTLSDPLSLLPSPITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDI+NGRFQPLAGFCSSEFGLYVILTLLDSLLKSNPDDKAHVTQLLSITIKSTDSQ FLQAYMKDFKNLFPSSERR
Sbjct:    1 MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKSSDDLLGLTGSLINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHLNQLNKKLQLLNLSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYANCPVQLNLEITKIIQHFTQQSQPQQLELCMTHPFYSNLMAMLATQNASMAIQSNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTLSDPLSLLPSPITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDITNGRFQPLAGFCSSEFGLYVILTLLDSLLKSNPDDKAHVTQLLSITIKSTDSQSFLQAYMKDFKNLFPSSERR 704          
BLAST of protein PAT1 homolog 1-like vs. Planmine SMEST
Match: SMESG000070229.1 (SMESG000070229.1)

HSP 1 Score: 1305.43 bits (3377), Expect = 0.000e+0
Identity = 669/670 (99.85%), Postives = 670/670 (100.00%), Query Frame = 1
Query:  190 MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKXXXXXXXXXXXXINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHXXXXXXXXXXXXXSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYANCPVQLNLEITKIIQHFTQQSQPQQLELCMTHPFYSNLMAMLATQNASMAIQSNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFGLYVILTLLDSLLKSNPDDKAHV 2199
            MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKSSDDLLGLTGSLINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHLNQLNKKLQLLNLSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYANCPVQLNLEITKIIQHFTQQSQPQQLELCMTHPFYSNLMAMLATQNASMAIQSNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTLSDPLSLLPSPITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDI+NGRFQPLAGFCSSEFGLYVILTLLDSLLKSNPDDKAHV
Sbjct:    1 MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKSSDDLLGLTGSLINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHLNQLNKKLQLLNLSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYANCPVQLNLEITKIIQHFTQQSQPQQLELCMTHPFYSNLMAMLATQNASMAIQSNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTLSDPLSLLPSPITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDITNGRFQPLAGFCSSEFGLYVILTLLDSLLKSNPDDKAHV 670          
BLAST of protein PAT1 homolog 1-like vs. Planmine SMEST
Match: SMESG000070229.1 (SMESG000070229.1)

HSP 1 Score: 1303.5 bits (3372), Expect = 0.000e+0
Identity = 669/670 (99.85%), Postives = 670/670 (100.00%), Query Frame = 1
Query:  190 MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKXXXXXXXXXXXXINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHXXXXXXXXXXXXXSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYANCPVQLNLEITKIIQHFTQQSQPQQLELCMTHPFYSNLMAMLATQNASMAIQSNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTXXXXXXXXXXXITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFGLYVILTLLDSLLKSNPDDKAHV 2199
            MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKSSDDLLGLTGSLINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHLNQLNKKLQLLNLSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYANCPVQLNLEITKIIQHFTQQSQPQQLELCMTHPFYSNLMAMLATQNASMAIQSNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTLSDPLSLLPSPITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDI+NGRFQPLAGFCSSEFGLYVILTLLDSLLKSNPDDKAHV
Sbjct:    1 MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKSSDDLLGLTGSLINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHLNQLNKKLQLLNLSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYANCPVQLNLEITKIIQHFTQQSQPQQLELCMTHPFYSNLMAMLATQNASMAIQSNIAPQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGGWMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTGHTTLSDPLSLLPSPITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPSNLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLRIDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVSKGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLICSRVRNLKSEELSTLTSTFYCNLTPNSQLGDITNGRFQPLAGFCSSEFGLYVILTLLDSLLKSNPDDKAHV 670          
BLAST of protein PAT1 homolog 1-like vs. Planmine SMEST
Match: SMESG000032108.1 (SMESG000032108.1)

HSP 1 Score: 337.035 bits (863), Expect = 7.360e-110
Identity = 200/245 (81.63%), Postives = 215/245 (87.76%), Query Frame = 1
Query:  190 MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKXXXXXXXXXXXXINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHXXXXXXXXXXXXXSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYAN 924
            MTEQL+NY+DLEY N+LDKLEEEA+KLNEL FNSEIP EYDEVDIDNDNCFKSFELENSFP GNTANKDFKTDY+VEKSSDDLLGL GSLINF                  DDEF+TAFNKLNFVNKSPVIDEKDIQL+ LVNEQTE+ML+TSLSYTNM +ESPFVELT FSELLHQQFQQY+KSDASIHVLNQI STHLNQLNKKLQLLNLSIEVLPQLRYFCILMSFVAID+KLTE + ++ N
Sbjct:    1 MTEQLNNYRDLEYANELDKLEEEANKLNELIFNSEIPCEYDEVDIDNDNCFKSFELENSFPHGNTANKDFKTDYRVEKSSDDLLGLNGSLINF------------------DDEFKTAFNKLNFVNKSPVIDEKDIQLSPLVNEQTEKMLETSLSYTNMVLESPFVELTNFSELLHQQFQQYRKSDASIHVLNQIASTHLNQLNKKLQLLNLSIEVLPQLRYFCILMSFVAIDDKLTENKMEFTN 227          
BLAST of protein PAT1 homolog 1-like vs. Planmine SMEST
Match: SMESG000008246.1 (SMESG000008246.1)

HSP 1 Score: 315.079 bits (806), Expect = 3.247e-101
Identity = 192/230 (83.48%), Postives = 199/230 (86.52%), Query Frame = 1
Query:  214 KDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNCFKSFELENSFPDGNTANKDFKTDYQVEKXXXXXXXXXXXXINFGIFKSNTNRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEMLDTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHXXXXXXXXXXXXXSIEVLPQLRYFCILMSFVAIDNKLTE 903
            K  EYTN+LDKLEEEADKLNELTFNSEIPWEYDEVDIDN NCFKSFELENSFPDGNTA+KDFK DY+VEKS DDLLGLTGS+INF                  D EFETAFNKLNFVNKSPVIDE DIQL+ LVNEQTEEML+TSLSYTNMAMESPFVELTKFSELLHQ+FQQYQKSDASIHVLNQI STHLNQLNKKLQLLNLSIEVLPQLRYFCILMSFV    KLTE
Sbjct:   15 KSHEYTNELDKLEEEADKLNELTFNSEIPWEYDEVDIDNGNCFKSFELENSFPDGNTASKDFKIDYRVEKSLDDLLGLTGSIINF------------------DYEFETAFNKLNFVNKSPVIDENDIQLSPLVNEQTEEMLETSLSYTNMAMESPFVELTKFSELLHQRFQQYQKSDASIHVLNQIASTHLNQLNKKLQLLNLSIEVLPQLRYFCILMSFVF---KLTE 223          
The following BLAST results are available for this feature:
BLAST of protein PAT1 homolog 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PATL12.996e-1426.05PAT1 homolog 1, processing body mRNA decay factor ... [more]
back to top
BLAST of protein PAT1 homolog 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PAT1 homolog 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PAT1 homolog 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
patl12.401e-1523.68PAT1 homolog 1, processing body mRNA decay factor ... [more]
patl13.210e-1523.68PAT1 homolog 1, processing body mRNA decay factor ... [more]
patl22.772e-625.22PAT1 homolog 2 [Source:ZFIN;Acc:ZDB-GENE-121214-35... [more]
patl22.982e-624.01PAT1 homolog 2 [Source:ZFIN;Acc:ZDB-GENE-121214-35... [more]
patl23.026e-625.22PAT1 homolog 2 [Source:ZFIN;Acc:ZDB-GENE-121214-35... [more]
back to top
BLAST of protein PAT1 homolog 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
stat61.596e-1125.58signal transducer and activator of transcription 6... [more]
stat62.444e-1126.58signal transducer and activator of transcription 6... [more]
stat62.667e-1126.58signal transducer and activator of transcription 6... [more]
stat63.230e-1126.58signal transducer and activator of transcription 6... [more]
back to top
BLAST of protein PAT1 homolog 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Patl17.903e-1425.43protein associated with topoisomerase II homolog 1... [more]
back to top
BLAST of protein PAT1 homolog 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2RRV3|PATL1_DANRE2.403e-1423.68Protein PAT1 homolog 1 OS=Danio rerio OX=7955 GN=p... [more]
sp|Q86TB9|PATL1_HUMAN1.439e-1326.05Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q5R8Q4|PATL1_PONAB1.451e-1326.05Protein PAT1 homolog 1 OS=Pongo abelii OX=9601 GN=... [more]
sp|Q3TC46|PATL1_MOUSE5.528e-1325.43Protein PAT1 homolog 1 OS=Mus musculus OX=10090 GN... [more]
sp|B5DF93|PATL1_RAT1.206e-1225.86Protein PAT1 homolog 1 OS=Rattus norvegicus OX=101... [more]
back to top
BLAST of protein PAT1 homolog 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7T9B84.519e-1625.82Uncharacterized protein OS=Capitella teleta OX=283... [more]
C3YG122.236e-1527.64PAT1 domain-containing protein OS=Branchiostoma fl... [more]
A0A0F8BQ013.870e-1525.13Protein PAT1 OS=Larimichthys crocea OX=215358 GN=E... [more]
A0A2U9BRQ98.591e-1526.24PAT1 domain-containing protein OS=Scophthalmus max... [more]
A0A4Z2IRP81.703e-1426.24Protein PAT1 1 OS=Liparis tanakae OX=230148 GN=pat... [more]
back to top
BLAST of protein PAT1 homolog 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
patl11.645e-1524.20protein PAT1 homolog 1 [Source:NCBI gene;Acc:10303... [more]
patl11.876e-1524.20protein PAT1 homolog 1 [Source:NCBI gene;Acc:10303... [more]
ENSAMXT00000057157.11.425e-628.97pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of protein PAT1 homolog 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PAT1 homolog 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PAT1 homolog 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO382741.772e-1323.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein PAT1 homolog 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
patl13.080e-625.64PAT1 homolog 1, processing body mRNA decay factor ... [more]
back to top
BLAST of protein PAT1 homolog 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070229.10.000e+099.72SMESG000070229.1[more]
SMESG000070229.10.000e+099.85SMESG000070229.1[more]
SMESG000070229.10.000e+099.85SMESG000070229.1[more]
SMESG000032108.17.360e-11081.63SMESG000032108.1[more]
SMESG000008246.13.247e-10183.48SMESG000008246.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008565 ID=SMED30008565|Name=protein PAT1 homolog 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2663bp
GAGTTTTTTTAATGGAAAGATGTAAAAAAAAACAAACTCTTTGAGACTTG
TAATTTTTGTAGTTTTAAATAAGCTCAGAAAACAAAAGTTTTTGAAAAAT
TAAGAATTGTAATTTAATATGAAAATTAAGTTTTTGTAATTTAATTTGAA
ATAAATGACCTTTAGCTCTTTATACTGTTTATAATTTTTATGACTGAACA
ACTACATAATTATAAAGATTTAGAGTATACAAATAAATTGGATAAATTAG
AGGAAGAAGCAGATAAATTAAATGAGTTAACATTTAATTCCGAAATTCCA
TGGGAGTATGATGAAGTGGATATTGATAACGACAATTGCTTTAAATCTTT
CGAACTTGAAAATTCATTTCCTGATGGAAACACAGCTAACAAAGATTTTA
AAACCGATTATCAAGTTGAAAAATCTTCAGATGACCTTCTTGGATTAACT
GGATCATTAATTAATTTCGGTATTTTTAAATCAAATACAAATCGAGAAAG
TGATGGAAATAATTTTTTTAAAGATGATGAATTTGAAACAGCTTTTAACA
AATTAAACTTTGTTAATAAATCACCGGTTATAGATGAAAAGGATATTCAA
CTAAATTCATTGGTAAATGAGCAAACAGAAGAGATGTTGGACACTTCACT
ATCCTACACAAATATGGCTATGGAGTCGCCATTTGTAGAATTGACGAAAT
TTTCCGAACTGCTCCATCAACAATTTCAACAATATCAAAAATCTGACGCA
AGTATTCATGTTCTCAATCAAATAGTATCAACCCATCTAAATCAATTGAA
TAAAAAATTACAATTGTTAAATCTATCAATCGAAGTTCTTCCACAACTAC
GATATTTTTGCATTCTCATGAGCTTTGTAGCAATTGATAATAAATTAACT
GAAATTCAAACTAAATACGCAAACTGTCCAGTGCAATTGAACTTAGAAAT
CACGAAAATCATTCAACATTTCACCCAGCAATCTCAACCCCAGCAGTTGG
AATTATGCATGACCCATCCGTTCTATTCGAATCTAATGGCAATGCTCGCT
ACTCAAAACGCTTCAATGGCAATTCAATCGAATATTGCACCACAAAAACC
TTACATGAATAATCAAGTTATCCAAAATCGATTGGAATCTCGCGAATCCT
CGTTTCCTGAATGGGCATCCGATGAAGACCGAAAAATACATTCAGACTAT
CAAAGTCGCTGCCGGAATTTCGATTTGAATGAAGGCGGTTGGATGAGCGA
ATCTGAGCGAGATTGGTTGATAAAGATCCAAACTCGAAACCTGACAACGA
ACAATCCCTATTGTCACGATTATTACTATACACAAATGAAATTGAAAGAA
ATGACCGAAGCCCGTCGACAACAAATCCTGAAAACCGGCCACACAACTCT
ATCGGATCCGCTCAGTCTGTTGCCGTCTCCAATCACTGGGGAACAATTGG
GCGCTGGAATCGATCCCAACAAAGACGGACTCAATCCGGGCTTGAAACCG
ATTCATTTCGAGAAATCTCTCGGCATGTTGAGTCCATCCAATCTCAATAC
GCCTCGACAAATCATACAAATCGGCATGCCAGCCCGAAACAATCCGCCGG
TCAATCGGGCGGATAAATCCCACAAACTCGTTAGAAATCACCGGGAATTG
CTTGGATTAATTGAGAAAATGTACTCGATTGTGTTGCGGATCGACGAGGT
TGACAAATCGCTGGCCAGGATGCTTGTTGAGCAACACAAAAGTCGAGGAG
TTCTCGTGCAGCATCGGAACTATCTATTGAAACTGCTGATGGATTGCATG
ACAAACAACTCCAAATTCGTCGATTTGCTCTCGGTGTCGAAAGGAGCGAG
AATTGTAGTATCGACAATCGCAATCGTTTCTTCGCAACAGTTCATTCAGA
TCGTTCGCACTCTCTTTTTCAACTGCATCTCGGTTTGGGAGTCGGAATAT
TTCCGGGAGATTGAGGCCGAGCTCCGCTCACTGATCTGTTCTCGGGTTCG
CAATCTCAAATCCGAGGAGTTATCGACGCTGACTTCGACATTCTATTGCA
ATTTGACGCCGAATTCTCAGCTAGGTGACATCAGTAATGGCCGATTCCAG
CCGTTGGCGGGCTTCTGTAGCAGTGAGTTCGGACTCTATGTCATTCTCAC
GCTGCTCGACTCGCTGCTCAAATCCAATCCGGACGACAAGGCTCACGTAA
CTCAATTGTTATCTATAACTATCAAGTCCACTGATTCCCAGGGCTTTCTT
CAAGCTTATATGAAGGACTTTAAAAATCTTTTCCCATCCAGTGAAAGACG
TTAAAAATTCGCAAAAATTACTTTAGAAGAGGCAGATTTTATTCGTTAAC
ACTTCTCCGAGAGAATATATTTTGTTTAATGAAATATTTTTGGAAAATAA
CTGTAAAATTGAAATGAATCTCTAGTAGTGGATTCGTTGAAAATTTAAGT
TGTTCTACTTTTTAATTCTTACTATTCAGTTTATTATTGGTTTTGGTGAA
TTTTTTCAGAGAAATCAATTGTATTAATAGTTGGGTTGATGTATTTTATT
ATCATTATAAAAGCCTTCAATTTATTTGTGTAACATTTATCGTTAGTTCA
TATTTTGATATCTGGATAATTGTGAGAGAATATTTTTTTGCATTGCCGAA
ATTCTGGGACTAC
back to top

protein sequence of SMED30008565-orf-1

>SMED30008565-orf-1 ID=SMED30008565-orf-1|Name=SMED30008565-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=705bp
MTEQLHNYKDLEYTNKLDKLEEEADKLNELTFNSEIPWEYDEVDIDNDNC
FKSFELENSFPDGNTANKDFKTDYQVEKSSDDLLGLTGSLINFGIFKSNT
NRESDGNNFFKDDEFETAFNKLNFVNKSPVIDEKDIQLNSLVNEQTEEML
DTSLSYTNMAMESPFVELTKFSELLHQQFQQYQKSDASIHVLNQIVSTHL
NQLNKKLQLLNLSIEVLPQLRYFCILMSFVAIDNKLTEIQTKYANCPVQL
NLEITKIIQHFTQQSQPQQLELCMTHPFYSNLMAMLATQNASMAIQSNIA
PQKPYMNNQVIQNRLESRESSFPEWASDEDRKIHSDYQSRCRNFDLNEGG
WMSESERDWLIKIQTRNLTTNNPYCHDYYYTQMKLKEMTEARRQQILKTG
HTTLSDPLSLLPSPITGEQLGAGIDPNKDGLNPGLKPIHFEKSLGMLSPS
NLNTPRQIIQIGMPARNNPPVNRADKSHKLVRNHRELLGLIEKMYSIVLR
IDEVDKSLARMLVEQHKSRGVLVQHRNYLLKLLMDCMTNNSKFVDLLSVS
KGARIVVSTIAIVSSQQFIQIVRTLFFNCISVWESEYFREIEAELRSLIC
SRVRNLKSEELSTLTSTFYCNLTPNSQLGDISNGRFQPLAGFCSSEFGLY
VILTLLDSLLKSNPDDKAHVTQLLSITIKSTDSQGFLQAYMKDFKNLFPS
SERR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000290deadenylation-dependent decapping of nuclear-transcribed mRNA
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR039900Pat1-like
Vocabulary: molecular function
TermDefinition
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 10..30
NoneNo IPR availablePANTHERPTHR21551:SF0PROTEIN ASSOCIATED WITH TOPO II RELATED-1, ISOFORM Acoord: 263..669
IPR039900Pat1-likePANTHERPTHR21551TOPOISOMERASE II-ASSOCIATED PROTEIN PAT1coord: 263..669