Secretogranin 5

Overview
NameSecretogranin 5
Smed IDSMED30008560
Length (bp)1070
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Secretogranin 5 (SMED30008560) t-SNE clustered cells

Violin plots show distribution of expression levels for Secretogranin 5 (SMED30008560) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Secretogranin 5 (SMED30008560) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Secretogranin 5 (SMED30008560) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008560

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30008560SMESG000016510.1 SmedASXL_019094SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30008560SMESG000016510.1 Contig39102newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008560SMESG000016510.1 Contig39102uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30008560SMESG000016510.1 dd_Smed_v4_3862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008560SMESG000016510.1 dd_Smed_v4_3862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008560SMESG000016510.1 dd_Smed_v4_3862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008560SMESG000016510.1 dd_Smed_v4_3862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30008560SMESG000016510.1 dd_Smed_v4_3862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008560SMESG000016510.1 dd_Smed_v4_3862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008560SMESG000016510.1 dd_Smed_v4_3862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008560SMESG000016510.1 dd_Smed_v4_3862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30008560SMESG000016510.1 dd_Smed_v6_3862_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30008560SMESG000016510.1 OX_Smed_1.0.11495ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30008560SMESG000016510.1 dd_Smed_v6_3862_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30008560SMESG000016510.1 dd_Smed_v6_3862_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Secretogranin 5 vs. Ensembl Human
Match: SCG5 (secretogranin V [Source:HGNC Symbol;Acc:HGNC:10816])

HSP 1 Score: 48.521 bits (114), Expect = 3.848e-6
Identity = 45/141 (31.91%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  521 LWGEHKVSGGADEGDQWLD---NEPFPVHKLPKSKPNKLP-------AYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKVFNPFLQSKMI-NTVKKKTGPRIFD 910
            L G   + GGA EG Q L    N P  V +L     + +P        Y DPPNPCP+G   + A   C ++ PDT +F++++ L++ +      D EH          +P   K   NP+LQ + + N V KK+ P   D
Sbjct:   68 LVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTG---DNIPKDFSEDQGYPDPPNPCPVG---KTADDGCLENTPDTAEFSREFQLHQHL-----FDPEH---------DYPGLGKWSVNPYLQGQRLDNVVAKKSVPHFSD 188          
BLAST of Secretogranin 5 vs. Ensembl Human
Match: SCG5 (secretogranin V [Source:HGNC Symbol;Acc:HGNC:10816])

HSP 1 Score: 48.521 bits (114), Expect = 3.848e-6
Identity = 45/141 (31.91%), Postives = 66/141 (46.81%), Query Frame = 2
Query:  521 LWGEHKVSGGADEGDQWLD---NEPFPVHKLPKSKPNKLP-------AYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKVFNPFLQSKMI-NTVKKKTGPRIFD 910
            L G   + GGA EG Q L    N P  V +L     + +P        Y DPPNPCP+G   + A   C ++ PDT +F++++ L++ +      D EH          +P   K   NP+LQ + + N V KK+ P   D
Sbjct:   68 LVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTG---DNIPKDFSEDQGYPDPPNPCPVG---KTADDGCLENTPDTAEFSREFQLHQHL-----FDPEH---------DYPGLGKWSVNPYLQGQRLDNVVAKKSVPHFSD 188          
BLAST of Secretogranin 5 vs. Ensembl Human
Match: SCG5 (secretogranin V [Source:HGNC Symbol;Acc:HGNC:10816])

HSP 1 Score: 48.1358 bits (113), Expect = 6.138e-6
Identity = 45/141 (31.91%), Postives = 65/141 (46.10%), Query Frame = 2
Query:  521 LWGEHKVSGGADEGDQWLD---NEPFPVHKLPKSKPNKLP-------AYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKVFNPFLQSKMI-NTVKKKTGPRIFD 910
            L G   + GGA EG Q L    N P  V +L     + +P        Y DPPNPCP+G    K    C ++ PDT +F++++ L++ +      D EH          +P   K   NP+LQ + + N V KK+ P   D
Sbjct:   68 LVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTG---DNIPKDFSEDQGYPDPPNPCPVG----KTDDGCLENTPDTAEFSREFQLHQHL-----FDPEH---------DYPGLGKWSVNPYLQGQRLDNVVAKKSVPHFSD 187          
BLAST of Secretogranin 5 vs. Ensembl Human
Match: SCG5 (secretogranin V [Source:HGNC Symbol;Acc:HGNC:10816])

HSP 1 Score: 48.1358 bits (113), Expect = 6.138e-6
Identity = 45/141 (31.91%), Postives = 65/141 (46.10%), Query Frame = 2
Query:  521 LWGEHKVSGGADEGDQWLD---NEPFPVHKLPKSKPNKLP-------AYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKVFNPFLQSKMI-NTVKKKTGPRIFD 910
            L G   + GGA EG Q L    N P  V +L     + +P        Y DPPNPCP+G    K    C ++ PDT +F++++ L++ +      D EH          +P   K   NP+LQ + + N V KK+ P   D
Sbjct:   68 LVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTG---DNIPKDFSEDQGYPDPPNPCPVG----KTDDGCLENTPDTAEFSREFQLHQHL-----FDPEH---------DYPGLGKWSVNPYLQGQRLDNVVAKKSVPHFSD 187          
BLAST of Secretogranin 5 vs. Ensembl Celegans
Match: sbt-1 (Seven B Two (Mammalian 7BT prohormone convertase chaperone) homolog [Source:UniProtKB/TrEMBL;Acc:Q9XTY3])

HSP 1 Score: 68.9366 bits (167), Expect = 1.861e-13
Identity = 41/123 (33.33%), Postives = 66/123 (53.66%), Query Frame = 2
Query:  524 WGEHKVSGGADEGDQWLDNEPFPVHKLPKSKPNKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESK-FPRSIKKVFNPFLQSKMINTVKKK 889
            +G   +SGGA EG+Q L  E     +      N LPAYC+PPNPCP+G   +     C ++  ++ +F++ +  ++     C CD+EHM NC E E++    S++K+      +   NT+ KK
Sbjct:   52 FGVKHISGGAGEGEQKLLEEDNFQERQEVKVDNVLPAYCEPPNPCPVGFTKEHG---CLEEFENSAEFSRNYQADQ----HCICDQEHMFNCAEKEAQDVSESLQKILEE--NNMHANTIAKK 165          
BLAST of Secretogranin 5 vs. Ensembl Fly
Match: 7B2 (gene:FBgn0041707 transcript:FBtr0078789)

HSP 1 Score: 66.2402 bits (160), Expect = 4.621e-12
Identity = 45/146 (30.82%), Postives = 67/146 (45.89%), Query Frame = 2
Query:  491 RADEQPSTNYLWGEHKVSGGADEGDQWLDNEPFPVHKLPKSKPNKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKVFNPFLQSKM-----------INTVKKKTG 895
            R DE    + LWG   +SGG  EG       P     + K+    LPAYC+PPNPCP G D +     C  D  +T  F++++   +    +C+CD EHM +C E +S      K   N  ++  +           +N++ KK G
Sbjct:  103 RDDEFLQHSSLWGHQFISGGMGEG-------PNRYPTIVKNDAG-LPAYCNPPNPCPEGYDMETQGGSCIVDFENTAIFSREFQAAQ----DCTCDNEHMFDCSEQDSADVGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAG 236          
BLAST of Secretogranin 5 vs. Ensembl Fly
Match: 7B2 (gene:FBgn0041707 transcript:FBtr0301640)

HSP 1 Score: 66.2402 bits (160), Expect = 5.337e-12
Identity = 45/148 (30.41%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  491 RADEQPSTNYLWGEHKVSGGADEGDQWLDNEPFPVHKLPKSKPN--KLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKVFNPFLQSKM-----------INTVKKKTG 895
            R DE    + LWG   +SGG  EG           ++ P    N   LPAYC+PPNPCP G D +     C  D  +T  F++++   +    +C+CD EHM +C E +S      K   N  ++  +           +N++ KK G
Sbjct:  108 RDDEFLQHSSLWGHQFISGGMGEGP----------NRYPTIVKNDAGLPAYCNPPNPCPEGYDMETQGGSCIVDFENTAIFSREFQAAQ----DCTCDNEHMFDCSEQDSADVGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAG 241          
BLAST of Secretogranin 5 vs. TrEMBL
Match: A0A0A7M294 (Secretogranin 5 (Fragment) OS=Schmidtea polychroa OX=50054 GN=sec5 PE=2 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 2.115e-120
Identity = 184/188 (97.87%), Postives = 186/188 (98.94%), Query Frame = 2
Query:  344 ILGDDYNKFQMEYHNGHPLFNNQDDSGISXXXXXXXXXXXXKIRSTKQHRADEQPSTNYLWGEHKVSGGADEGDQWLDNEPFPVHKLPKSKPNKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKVFNPFLQSKMINTVKKKTGPRIF 907
            ILGDDYNKFQMEYHNGHPLFNNQD +GISDDLWQGLLDDLDKIRSTK HRADEQPSTNYLWGEHKVSGGADEGDQWLDNEPFPVHKLPKSKPNKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKK+FNPFLQSKMINTVKKKTGPRIF
Sbjct:    1 ILGDDYNKFQMEYHNGHPLFNNQDVNGISDDLWQGLLDDLDKIRSTKHHRADEQPSTNYLWGEHKVSGGADEGDQWLDNEPFPVHKLPKSKPNKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKIFNPFLQSKMINTVKKKTGPRIF 188          
BLAST of Secretogranin 5 vs. TrEMBL
Match: A0A0X3PKC8 (Neuroendocrine protein 7B2 OS=Schistocephalus solidus OX=70667 GN=7B2 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 7.545e-30
Identity = 67/188 (35.64%), Postives = 97/188 (51.60%), Query Frame = 2
Query:  491 RADEQPSTNYLWGEHKVSGGADEGDQWLD-----------------------------------NEPFPVHKLPKSKP----------NKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRS---IKKVF-------NPFLQSKMINTVKKK 889
            R+ E P  N+LWGEH+VSGG+ E  +W+D                                   + PFP +    ++P          ++LPAYCDPPNPCPIG DP+  ++PCD++IP+TK+FN+ WI+ KM NGEC CD EHM+ C   +  FP +   +K V        NP+L+ +   ++  K
Sbjct:  122 RSAELPVQNHLWGEHRVSGGSSEVGKWVDYAVLGAHAQDDDEEEEEEEGEGVLSGDAADAAHLPDTPFPTYASILTRPAAQTPSGVKLDQLPAYCDPPNPCPIGYDPESLATPCDRNIPNTKEFNRAWIMRKMQNGECPCDEEHMEACPAEKPAFPSASGFLKSVLLHNMDEDNPYLRGRRRASLVAK 309          
BLAST of Secretogranin 5 vs. TrEMBL
Match: A0A183T7J2 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS12440 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 8.927e-30
Identity = 68/194 (35.05%), Postives = 98/194 (50.52%), Query Frame = 2
Query:  491 RADEQPSTNYLWGEHKVSGGADEGDQWLD-------------------------------------NEPFPVHKLPKSKP----------NKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRS---IKKVF-------NPFLQSKMINTVKKKTGPR 901
            R+ E P  N+LWGEH+VSGG+ E  +W+D                                     + PFP +    ++P          ++LPAYCDPPNPCPIG DP+  ++PCD++IP+TK+FN+ WI+ KM NGEC CD EHM+ C   +  FP +   +K V        NP+L+ +   ++  K   R
Sbjct:  126 RSAELPVQNHLWGEHRVSGGSSEVGKWVDYAVLGAHAQDDDEEEEEEEEEGEGVLSGDAADAAHLPDTPFPTYASILTRPAAQTPSGVKLDQLPAYCDPPNPCPIGYDPESLATPCDRNIPNTKEFNRAWIMRKMQNGECPCDEEHMEACPAEKPAFPSASGFLKSVLLHNMDEDNPYLRGRRRASLVAKKFSR 319          
BLAST of Secretogranin 5 vs. TrEMBL
Match: A0A0X3P7P8 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR118654 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 9.693e-30
Identity = 67/188 (35.64%), Postives = 97/188 (51.60%), Query Frame = 2
Query:  491 RADEQPSTNYLWGEHKVSGGADEGDQWLD-----------------------------------NEPFPVHKLPKSKP----------NKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRS---IKKVF-------NPFLQSKMINTVKKK 889
            R+ E P  N+LWGEH+VSGG+ E  +W+D                                   + PFP +    ++P          ++LPAYCDPPNPCPIG DP+  ++PCD++IP+TK+FN+ WI+ KM NGEC CD EHM+ C   +  FP +   +K V        NP+L+ +   ++  K
Sbjct:  120 RSAELPVQNHLWGEHRVSGGSSEVGKWVDYAVLGAHAQDDDEEEEEEEGEGVLSGDAADAAHLPDTPFPTYASILTRPAAQTPSGVKLDQLPAYCDPPNPCPIGYDPESLATPCDRNIPNTKEFNRAWIMRKMQNGECPCDEEHMEACPAEKPAFPSASGFLKSVLLHNMDEDNPYLRGRRRASLVAK 307          
BLAST of Secretogranin 5 vs. TrEMBL
Match: A0A0R3WR11 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS3187 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.250e-27
Identity = 74/260 (28.46%), Postives = 114/260 (43.85%), Query Frame = 2
Query:  218 RMILLIFLVFLINEGFCSNYDTYIHSIQKRNAQLHNSLMQD---------------------PIL--------------GDDYNKFQMEYHNGHPLFNNQDD--------SGISXXXXXXXXXXXXKIRSTKQHRADEQPSTNYLWGEHKVSGGADEGDQWLDNEPFPVHKL------------------PKS--KPNKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEI 808
            R +L++ +  L++    SNYD Y+  +  RN ++H++  +                      PIL               DD+++          + +N D         S +S+       D   +      +   E    + +WG H+VSGG+ E  +W+D   F                       PKS  K ++LPAYCDPPNPCPIG DP   ++PCD+ + +T +FN+ WIL KM NGEC CD EHM++C  +
Sbjct:    2 RKLLVLCVFALVSSARGSNYDAYLADLYHRNREVHDAFRRSYPNGAYVLDSVITSPDFYQVHPILREYESGEDYGDADSNDDWDRLLGSLAFAQDIASNPDTEFAEKRFHSWLSEQQSARTNDTPVRALVYPAYAGSEFAPQDSMWGTHRVSGGSSEVGRWMDYAVFGAQAQEDDDDNENGEELTAMEPGPKSEVKLDQLPAYCDPPNPCPIGYDPATLATPCDEGVVNTAEFNRNWILRKMRNGECLCDEEHMESCPRV 261          
BLAST of Secretogranin 5 vs. Planmine SMEST
Match: SMESG000016510.1 (SMESG000016510.1)

HSP 1 Score: 376.326 bits (965), Expect = 1.987e-132
Identity = 195/195 (100.00%), Postives = 195/195 (100.00%), Query Frame = 2
Query:  332 MQDPILGDDYNKFQMEYHNGHPLFNNQDDSGISXXXXXXXXXXXXKIRSTKQHRADEQPSTNYLWGEHKVSGGADEGDQWLDNEPFPVHKLPKSKPNKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKVFNPFLQSKMINTVKKKTGPRIFDME 916
            MQDPILGDDYNKFQMEYHNGHPLFNNQDDSGISDDLWQGLLDDLDKIRSTKQHRADEQPSTNYLWGEHKVSGGADEGDQWLDNEPFPVHKLPKSKPNKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKVFNPFLQSKMINTVKKKTGPRIFDME
Sbjct:    1 MQDPILGDDYNKFQMEYHNGHPLFNNQDDSGISDDLWQGLLDDLDKIRSTKQHRADEQPSTNYLWGEHKVSGGADEGDQWLDNEPFPVHKLPKSKPNKLPAYCDPPNPCPIGMDPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKFPRSIKKVFNPFLQSKMINTVKKKTGPRIFDME 195          
The following BLAST results are available for this feature:
BLAST of Secretogranin 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SCG53.848e-631.91secretogranin V [Source:HGNC Symbol;Acc:HGNC:10816... [more]
SCG53.848e-631.91secretogranin V [Source:HGNC Symbol;Acc:HGNC:10816... [more]
SCG56.138e-631.91secretogranin V [Source:HGNC Symbol;Acc:HGNC:10816... [more]
SCG56.138e-631.91secretogranin V [Source:HGNC Symbol;Acc:HGNC:10816... [more]
back to top
BLAST of Secretogranin 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sbt-11.861e-1333.33Seven B Two (Mammalian 7BT prohormone convertase c... [more]
back to top
BLAST of Secretogranin 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
7B24.621e-1230.82gene:FBgn0041707 transcript:FBtr0078789[more]
7B25.337e-1230.41gene:FBgn0041707 transcript:FBtr0301640[more]
back to top
BLAST of Secretogranin 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretogranin 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretogranin 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretogranin 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretogranin 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A7M2942.115e-12097.87Secretogranin 5 (Fragment) OS=Schmidtea polychroa ... [more]
A0A0X3PKC87.545e-3035.64Neuroendocrine protein 7B2 OS=Schistocephalus soli... [more]
A0A183T7J28.927e-3035.05Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0X3P7P89.693e-3035.64Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0R3WR113.250e-2728.46Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
back to top
BLAST of Secretogranin 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretogranin 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretogranin 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretogranin 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretogranin 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretogranin 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000016510.11.987e-132100.00SMESG000016510.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008560 ID=SMED30008560|Name=Secretogranin 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1070bp
AAATTTAAGAAATGATGTAGGCAAATATTTATTTTATTGTTACGTATAAC
TCGATTATGATTGGTCCAATTTGAGCAGAACAAAAGAGAGCAATAACTGA
TGTCAGTATCAAATAAGAAATTTAATTATTTCTCTTTCCAGCAACAAAAT
TTTCACATACATTTATTGATTTTATTTAAACCAAATTTATCAATAAATTT
TCATTTTTCTCTAACAAAGAATGATACTACTGATTTTTCTTGTTTTCCTT
ATTAATGAAGGCTTTTGTTCAAACTACGATACGTACATTCATTCTATCCA
AAAGCGAAATGCCCAACTTCATAATTCATTAATGCAAGATCCCATCTTAG
GAGATGACTACAATAAGTTTCAAATGGAATATCACAATGGTCATCCCCTT
TTCAATAATCAAGATGATAGTGGCATATCCGATGATCTATGGCAAGGACT
TCTGGACGATCTTGATAAGATAAGAAGTACTAAACAACACAGAGCTGATG
AACAACCTTCAACAAACTACCTATGGGGAGAACACAAGGTTTCTGGAGGC
GCGGATGAAGGTGATCAATGGCTTGATAATGAACCCTTTCCAGTTCATAA
ATTACCTAAATCTAAACCTAACAAATTGCCAGCTTACTGTGATCCACCAA
ATCCTTGCCCGATTGGAATGGATCCACAAAAAGCTTCTTCACCTTGCGAC
AAAGATATTCCGGATACTAAAGATTTTAACCAAAAATGGATATTGAATAA
AATGATAAATGGTGAATGCTCCTGTGACAGAGAACATATGAAGAATTGTG
ATGAAATTGAAAGTAAATTTCCAAGATCAATAAAAAAAGTATTCAATCCT
TTTCTTCAATCTAAAATGATAAATACAGTTAAGAAGAAAACCGGTCCGAG
AATTTTTGACATGGAATAATAAATAATGATTAAAACAAATTAACTTTTGA
GAAAATATATATTTAGCATCATTATTTTCCGAACTAATATTGATATTTTT
CTTGTCTTTTACTGTCAGATGTTTTGCTTTCTCTGTCGATTTGCCTAGAA
TATTTGTGAAATCGTTCGTG
back to top

protein sequence of SMED30008560-orf-1

>SMED30008560-orf-1 ID=SMED30008560-orf-1|Name=SMED30008560-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=233bp
MILLIFLVFLINEGFCSNYDTYIHSIQKRNAQLHNSLMQDPILGDDYNKF
QMEYHNGHPLFNNQDDSGISDDLWQGLLDDLDKIRSTKQHRADEQPSTNY
LWGEHKVSGGADEGDQWLDNEPFPVHKLPKSKPNKLPAYCDPPNPCPIGM
DPQKASSPCDKDIPDTKDFNQKWILNKMINGECSCDREHMKNCDEIESKF
PRSIKKVFNPFLQSKMINTVKKKTGPRIFDME*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR007945Secretogranin_V
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0030141secretory granule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007945Neuroendocrine 7B2 precursorPFAMPF05281Secretogranin_Vcoord: 85..198
e-value: 3.0E-17
score: 63.0
IPR007945Neuroendocrine 7B2 precursorPANTHERPTHR12738NEUROENDOCRINE PROTEIN 7B2coord: 76..227
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.786