WD repeat-containing protein 27-like

Overview
NameWD repeat-containing protein 27-like
Smed IDSMED30008555
Length (bp)2547
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 27-like (SMED30008555) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 27-like (SMED30008555) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 27-like (SMED30008555) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 27-like (SMED30008555) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008555

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008555SMESG000064082.1 SmedASXL_008413SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008555SMESG000064082.1 dd_Smed_v6_33360_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30008555SMESG000064082.1 Contig44995newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008555SMESG000064082.1 Contig44995uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 27-like vs. Ensembl Human
Match: WDR27 (WD repeat domain 27 [Source:HGNC Symbol;Acc:HGNC:21248])

HSP 1 Score: 150.214 bits (378), Expect = 1.359e-36
Identity = 152/675 (22.52%), Postives = 287/675 (42.52%), Query Frame = 1
Query:  550 VIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMN-IAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLA--------VSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLP-LKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNK-TSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQI-LCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNA-GNIESHLL 2508
            +I+   D  F V  H    +++ SSVLS  P+  L  D    +L+ G   G+L  FS+      R + R+ L +              +         P E +    + + + E+ +              LR    DL  + N     L+        + +  GLF  N  + E+   L +  ++SL +     C + N T + K+  L  +L      ++ +  +N   ++     P + +  S+  +  +LP+S L   L +   KS+    ++    +    D  L F +KV+SSGYA   P    F P TN  S  +       +  ++ YP +     K   +         +  ++ S  G  LAC L+N    + D+       V    D  +  V WS + ++L+   +  ++ ++S       L+     D  S  +   +FY +D F   + G +F+L+ Y +D  +++I+RYK  SK K +   S++    +T+  ++N FYS+ I++ +G  +  + + DLN           H+R + +I  N+GS ++   P ++N + +++   G++LWD+R   C + + +   +  Y   I F+PCG+   C   D   + Y++ S+ F   +  +T+T T    +P    + S + A   ++ H L
Sbjct:  210 LISASEDRGFKVWDHCTGSLIYSSSVLSAYPLLSLFIDAESRQLVTGCADGQLWIFSLMDGHHYRRVARVDLRK-------KTETFSTRRVKSGLCSQPEESQLPSTSALGKGEQVEV---------TFPVLRLAPCDLSLIPNSACGCLSSENTRCVWIGSSVGLFVFNLANLEVEAALYYKDFQSLSILLAGSCALRNRTADQKVLCLLASLF---GGKIAVLEINPAALVRAQQCPSMGQSLSVPASSCVLPTSPLY--LGIAKEKSTKAASEQRRAARNVMKDQRLVFHSKVRSSGYAS-APHVTMFSPKTNIKSEGKGSSRSRSSCAREAYPVECAVPTKPGPQVAAAPTCTRVCCIQYSGDGQWLACGLANHLLLVFDASLTGTPAVFSGHDGAVNAVCWSQDRRWLLSAARDGTLRMWSA--RGAELALLLGKDMFSKPIQSAQFYYIDAFILLSSGPEFQLLRYHIDTCKDEIKRYKQKSKSKLICRLSTTGAVDMTSLSAVNDFYSH-IVLAAG-RNRTVEVFDLNAGCSAAVIAEAHSRPVHQICQNKGSSFTTQQPQAYNLFLTTAIGDGMRLWDLRTLRCERHF-EGHPTRGYPCGIAFSPCGRFAACGAEDRHAYVYEMGSSTFSHRLAGHTDTVTGVAFNPSAPQMESRSVAHAGVQWHDL 857          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Human
Match: WDR27 (WD repeat domain 27 [Source:HGNC Symbol;Acc:HGNC:21248])

HSP 1 Score: 145.206 bits (365), Expect = 3.675e-35
Identity = 119/511 (23.29%), Postives = 233/511 (45.60%), Query Frame = 1
Query: 1000 VSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLP-LKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNK-TSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQI-LCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIE 2496
            + +  GLF  N  + E+   L +  ++SL +     C + N T + K+  L  +L      ++ +  +N   ++     P + +  S+  +  +LP+S L   L +   KS+    ++    +    D  L F +KV+SSGYA   P    F P TN  S  +       +  ++ YP +     K   +         +  ++ S  G  LAC L+N    + D+       V    D  +  V WS + ++L+   +  ++ ++S       L+     D  S  +   +FY +D F   + G +F+L+ Y +D  +++I+RYK  SK K +   S++    +T+  ++N FYS+ I++ +G  +  + + DLN           H+R + +I  N+GS ++   P ++N + +++   G++LWD+R   C + + +   +  Y   I F+PCG+   C   D   + Y++ S+ F   +  +T+T T    +P    + ++T  G ++
Sbjct:  226 IGSSVGLFVFNLANLEVEAALYYKDFQSLSILLAGSCALRNRTADQKVLCLLASLF---GGKIAVLEINPAALVRAQQCPSMGQSLSVPASSCVLPTSPLY--LGIAKEKSTKAASEQRRAARNVMKDQRLVFHSKVRSSGYAS-APHVTMFSPKTNIKSEGKGSSRSRSSCAREAYPVECAVPTKPGPQVAAAPTCTRVCCIQYSGDGQWLACGLANHLLLVFDASLTGTPAVFSGHDGAVNAVCWSQDRRWLLSAARDGTLRMWSA--RGAELALLLGKDMFSKPIQSAQFYYIDAFILLSSGPEFQLLRYHIDTCKDEIKRYKQKSKSKLICRLSTTGAVDMTSLSAVNDFYSH-IVLAAG-RNRTVEVFDLNAGCSAAVIAEAHSRPVHQICQNKGSSFTTQQPQAYNLFLTTAIGDGMRLWDLRTLRCERHF-EGHPTRGYPCGIAFSPCGRFAACGAEDRHAYVYEMGSSTFSHRLAGHTDTVTGVAFNPSAPQLATATLDGKLQ 725          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Zebrafish
Match: wdr27 (WD repeat domain 27 [Source:ZFIN;Acc:ZDB-GENE-051120-93])

HSP 1 Score: 162.925 bits (411), Expect = 6.269e-41
Identity = 161/677 (23.78%), Postives = 306/677 (45.20%), Query Frame = 1
Query:  547 IVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFE----IMNIAQSEE---SKC---GIVD-----LILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWK-----SLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNID--CILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSI-DHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKF--MTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNK-TSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCI-CMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNI 2493
            ++I+I  D TF +   ++  ILF S+VLS  P+  L++ +   + I G+  G+L  +++ +    R + +L L +                          EQK E    +++  QS     ++C   G V+     L ++ +   + + S  LQ  G+     + + +  GL  L+  + E+LSF   K     S+   ++ +   +  +  L ++L       L ++ + +D  C+ +     ++E+ S++ + PL+ +S L+  L     K      +K   N + S+ D  L F T+VKSSGY    P R  F+P TN              M  L  +YPS       +     + +    + +L+ S  G  + C L +GS  + +S       V       +  V WS   ++ + T++  ++ I++   +  +L+  +    K +     +FY LD+F     G    L  Y LD  ++DI+RYK  SK K   ++S      IT+  ++N FYSY I++ +G +D  + + D+N+ +++ +    H R +  +  NQGS +   +  ++N + SS+   G+KLWD+R   C + Y +  ++     +  F+PCG+ +     D S + YD RS+ F+  ++ ++ET  +   +P    + + T  G +
Sbjct:  171 LLISISEDRTFKIWDVKKGGILFESAVLSAYPLLSLSFMKQNGQFITGSGDGQLWCYTLPVDHKCRLVTKLDLSKL-------------------------EQKHERNLRMISPPQSRTDGTARCDERGAVETAKPVLRIWPQTPKINHAS--LQQRGS----YVWIGSSDGLCLLDLDTSELLSFLPLKGDLSISIAGSWVISEGLDGSMRCLVSSLFETSVVLLVVNGVRLDELCLRMAKSFSVEEQLSVMPSSPLMTTSPLKAELA----KKGPKPQRKGGVNYQTSVKDQALVFHTQVKSSGY-NTAPHRTMFRPKTNIKKKSSSITKTSTTMNDLLSEYPSHSEAPSVSFAHLMVSTSPTTMNALQYSGDGKQIVCGLGDGSVLLYNSSLTGNPDVYTGHSKAVNTVCWSHSKRWFLSTSEDPTLCIWTTSASEPVLTMREDQFAKPIRS--AQFYYLDKFLLLASGSNLMLYLYHLDNTKDDIKRYKQRSKFKLTGKFSMKSGTDITSISAVNDFYSY-IVLAAG-ADRTIQVFDMNRGSLVTQIPDAHCRAVHHLAQNQGSSFCTQAVQAYNLFLSSALTDGLKLWDLRTARCVRRY-ESHVNRCLHCTAAFSPCGRFIATGSEDHSAYIYDTRSSIFLHKLQRHSETVLNVAFNPAKPELLTGTLDGKL 806          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Xenopus
Match: ENSXETT00000018267.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:40178885:40249433:1 gene:ENSXETG00000008180.1 transcript:ENSXETT00000018267.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 9.908e-24
Identity = 62/211 (29.38%), Postives = 113/211 (53.55%), Query Frame = 1
Query: 1843 RFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMII-IGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQ-ILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMI 2466
            +FY +D F   + G +F L+ Y+LDE ++D++RYK  S  K V ++      +IT   ++N FYSY+++ +G   S+  L + DLN    +   +  H R   +I  N+GS ++  +  ++N + +++   G+KLWD+R   C + + +  I+      I  +PCG+ I C   D S + YDI S+ ++  +  +TET  +   +P    +
Sbjct:  313 QFYYMDNFILLSSGAEFHLLKYSLDEVKDDLKRYKQKSWCKSVQKFQMDTAVEITGLSAVNDFYSYLVLAVG---SNRTLEIFDLNLNRSVAVIRDVHPRAAHQICQNKGSAFTTQASEAYNLFVTTAIGDGLKLWDMRTLRCVRRF-EGHINRSQPCGIAISPCGRFIACGSEDRSAYLYDIHSSTYLQKLSGHTETVINVAFNPSSPQV 519          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Mouse
Match: Wdr27 (WD repeat domain 27 [Source:MGI Symbol;Acc:MGI:1918932])

HSP 1 Score: 162.925 bits (411), Expect = 7.747e-41
Identity = 163/697 (23.39%), Postives = 297/697 (42.61%), Query Frame = 1
Query:  550 VIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGG------------AREIYRLRL-----------------HEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFD--KLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPS-----DGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNK-TSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQ-FYPKPKISSRYSNSIQFTPCGQIL-CICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIE 2496
            +I++  D +F V       +++ SS+L+  P+  L  +E   +L+ G+  G+L  FS+ + G              RE +  R                  HEA   G A                   E  F I+++A          DL L D  +  F    ++            L + + T LF LN  SFE+   L F  ++SL +     C M +     K + + +++     + L +D+  +  +  + Y    +  S++ +  +LP+S L     +   K   L   K +  K    D PL F TKV+SSGY  + P    F P TN      K  NK  +K K +Y       + F      ++  +  + + +  L+ S  G  LAC L N    + ++            D  +  + WS + ++L+ T +  ++ ++SV  +R  L    + D     +   +FY +D F   + G +F L+ Y +D  R+DI RYK  S+ K ++    +    IT+  ++N FYS++++      D  + + DLN           H+R + RI  N+GS +     +++N + +++   G++LWD+R   C + F   P  S  Y   + F+PCG+++ C   D   + Y++ S+ F+  +  +T+T T+   +P    + ++T  G ++
Sbjct:  179 LISVSEDRSFKVWDFCVGSLIYSSSILTAYPLLNLLINEENQQLVTGSADGQLWIFSL-MEGHHYHCVAHVDVRKKRETFTTRRMMAEQCSLPEDHQCRCRHEADKRGEA-------------------EATFPILSLAP--------CDLCLPDSQRGAFASECTK-----------CLWIGSSTALFILNLASFELEAALHFKEFQSLSVQVAGSCAMVSEPMSAKAFCMLSSMFGSKIAVLEIDLAAL--LSTQQYPRAGKVLSVLASSCVLPTSPLY--FGIIKEKFPKLANTKQHAVKSVVEDRPLVFHTKVRSSGYT-LAPHMAMFSPKTNI-----KHHNKRSSKYKNNYKCKECSLENFLPRNLSRQVAVAQKPVAVSCLQFSGDGQKLACGLGNHLSLVFNASLSGPPAAFSGHDGAVSTICWSHDKRWLLSTGRDRTLRVWSV--HRTELMLLLAPDAFPKPVTSAQFYYMDTFILLSSGPEFCLLKYHIDLCRDDIRRYKPKSRYKPIFRLPMTSGADITSLSAVNDFYSHIVLTAG--RDRAVEVFDLNAGCSAAVLAEVHSRPVHRICQNKGSSFVAQHSLAYNLFLTAAVGDGIRLWDLRNLRCVRCFEGHPNRS--YPCGVAFSPCGRLMACGAEDRHAYVYEMGSSSFLHRLAGHTDTITEVAFNPAAPQLVTATLDGKLQ 820          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Mouse
Match: Wdr27 (WD repeat domain 27 [Source:MGI Symbol;Acc:MGI:1918932])

HSP 1 Score: 162.925 bits (411), Expect = 7.747e-41
Identity = 163/697 (23.39%), Postives = 297/697 (42.61%), Query Frame = 1
Query:  550 VIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGG------------AREIYRLRL-----------------HEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFD--KLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPS-----DGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNK-TSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQ-FYPKPKISSRYSNSIQFTPCGQIL-CICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIE 2496
            +I++  D +F V       +++ SS+L+  P+  L  +E   +L+ G+  G+L  FS+ + G              RE +  R                  HEA   G A                   E  F I+++A          DL L D  +  F    ++            L + + T LF LN  SFE+   L F  ++SL +     C M +     K + + +++     + L +D+  +  +  + Y    +  S++ +  +LP+S L     +   K   L   K +  K    D PL F TKV+SSGY  + P    F P TN      K  NK  +K K +Y       + F      ++  +  + + +  L+ S  G  LAC L N    + ++            D  +  + WS + ++L+ T +  ++ ++SV  +R  L    + D     +   +FY +D F   + G +F L+ Y +D  R+DI RYK  S+ K ++    +    IT+  ++N FYS++++      D  + + DLN           H+R + RI  N+GS +     +++N + +++   G++LWD+R   C + F   P  S  Y   + F+PCG+++ C   D   + Y++ S+ F+  +  +T+T T+   +P    + ++T  G ++
Sbjct:  179 LISVSEDRSFKVWDFCVGSLIYSSSILTAYPLLNLLINEENQQLVTGSADGQLWIFSL-MEGHHYHCVAHVDVRKKRETFTTRRMMAEQCSLPEDHQCRCRHEADKRGEA-------------------EATFPILSLAP--------CDLCLPDSQRGAFASECTK-----------CLWIGSSTALFILNLASFELEAALHFKEFQSLSVQVAGSCAMVSEPMSAKAFCMLSSMFGSKIAVLEIDLAAL--LSTQQYPRAGKVLSVLASSCVLPTSPLY--FGIIKEKFPKLANTKQHAVKSVVEDRPLVFHTKVRSSGYT-LAPHMAMFSPKTNI-----KHHNKRSSKYKNNYKCKECSLENFLPRNLSRQVAVAQKPVAVSCLQFSGDGQKLACGLGNHLSLVFNASLSGPPAAFSGHDGAVSTICWSHDKRWLLSTGRDRTLRVWSV--HRTELMLLLAPDAFPKPVTSAQFYYMDTFILLSSGPEFCLLKYHIDLCRDDIRRYKPKSRYKPIFRLPMTSGADITSLSAVNDFYSHIVLTAG--RDRAVEVFDLNAGCSAAVLAEVHSRPVHRICQNKGSSFVAQHSLAYNLFLTAAVGDGIRLWDLRNLRCVRCFEGHPNRS--YPCGVAFSPCGRLMACGAEDRHAYVYEMGSSSFLHRLAGHTDTITEVAFNPAAPQLVTATLDGKLQ 820          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Mouse
Match: Wdr27 (WD repeat domain 27 [Source:MGI Symbol;Acc:MGI:1918932])

HSP 1 Score: 133.265 bits (334), Expect = 1.744e-31
Identity = 143/614 (23.29%), Postives = 256/614 (41.69%), Query Frame = 1
Query:  550 VIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGG------------AREIYRLRL-----------------HEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFD--KLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPS-----DGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNK-TSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIR 2253
            +I++  D +F V       +++ SS+L+  P+  L  +E   +L+ G+  G+L  FS+ + G              RE +  R                  HEA   G A                   E  F I+++A          DL L D  +  F    ++            L + + T LF LN  SFE+   L F  ++SL +     C M +     K + + +++     + L +D+  +  +  + Y    +  S++ +  +LP+S L     +   K   L   K +  K    D PL F TKV+SSGY  + P    F P TN      K  NK  +K K +Y       + F      ++  +  + + +  L+ S  G  LAC L N    + ++            D  +  + WS + ++L+ T +  ++ ++SV  +R  L    + D     +   +FY +D F   + G +F L+ Y +D  R+DI RYK  S+ K ++    +    IT+  ++N FYS++++      D  + + DLN           H+R + RI  N+GS +     +++N + +++   G++LWD+R
Sbjct:  179 LISVSEDRSFKVWDFCVGSLIYSSSILTAYPLLNLLINEENQQLVTGSADGQLWIFSL-MEGHHYHCVAHVDVRKKRETFTTRRMMAEQCSLPEDHQCRCRHEADKRGEA-------------------EATFPILSLAP--------CDLCLPDSQRGAFASECTK-----------CLWIGSSTALFILNLASFELEAALHFKEFQSLSVQVAGSCAMVSEPMSAKAFCMLSSMFGSKIAVLEIDLAAL--LSTQQYPRAGKVLSVLASSCVLPTSPLY--FGIIKEKFPKLANTKQHAVKSVVEDRPLVFHTKVRSSGYT-LAPHMAMFSPKTNI-----KHHNKRSSKYKNNYKCKECSLENFLPRNLSRQVAVAQKPVAVSCLQFSGDGQKLACGLGNHLSLVFNASLSGPPAAFSGHDGAVSTICWSHDKRWLLSTGRDRTLRVWSV--HRTELMLLLAPDAFPKPVTSAQFYYMDTFILLSSGPEFCLLKYHIDLCRDDIRRYKPKSRYKPIFRLPMTSGADITSLSAVNDFYSHIVLTAG--RDRAVEVFDLNAGCSAAVLAEVHSRPVHRICQNKGSSFVAQHSLAYNLFLTAAVGDGIRLWDLR 739          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Mouse
Match: Wdr27 (WD repeat domain 27 [Source:MGI Symbol;Acc:MGI:1918932])

HSP 1 Score: 133.265 bits (334), Expect = 1.744e-31
Identity = 143/614 (23.29%), Postives = 256/614 (41.69%), Query Frame = 1
Query:  550 VIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGG------------AREIYRLRL-----------------HEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFD--KLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPS-----DGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNK-TSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIR 2253
            +I++  D +F V       +++ SS+L+  P+  L  +E   +L+ G+  G+L  FS+ + G              RE +  R                  HEA   G A                   E  F I+++A          DL L D  +  F    ++            L + + T LF LN  SFE+   L F  ++SL +     C M +     K + + +++     + L +D+  +  +  + Y    +  S++ +  +LP+S L     +   K   L   K +  K    D PL F TKV+SSGY  + P    F P TN      K  NK  +K K +Y       + F      ++  +  + + +  L+ S  G  LAC L N    + ++            D  +  + WS + ++L+ T +  ++ ++SV  +R  L    + D     +   +FY +D F   + G +F L+ Y +D  R+DI RYK  S+ K ++    +    IT+  ++N FYS++++      D  + + DLN           H+R + RI  N+GS +     +++N + +++   G++LWD+R
Sbjct:  179 LISVSEDRSFKVWDFCVGSLIYSSSILTAYPLLNLLINEENQQLVTGSADGQLWIFSL-MEGHHYHCVAHVDVRKKRETFTTRRMMAEQCSLPEDHQCRCRHEADKRGEA-------------------EATFPILSLAP--------CDLCLPDSQRGAFASECTK-----------CLWIGSSTALFILNLASFELEAALHFKEFQSLSVQVAGSCAMVSEPMSAKAFCMLSSMFGSKIAVLEIDLAAL--LSTQQYPRAGKVLSVLASSCVLPTSPLY--FGIIKEKFPKLANTKQHAVKSVVEDRPLVFHTKVRSSGYT-LAPHMAMFSPKTNI-----KHHNKRSSKYKNNYKCKECSLENFLPRNLSRQVAVAQKPVAVSCLQFSGDGQKLACGLGNHLSLVFNASLSGPPAAFSGHDGAVSTICWSHDKRWLLSTGRDRTLRVWSV--HRTELMLLLAPDAFPKPVTSAQFYYMDTFILLSSGPEFCLLKYHIDLCRDDIRRYKPKSRYKPIFRLPMTSGADITSLSAVNDFYSHIVLTAG--RDRAVEVFDLNAGCSAAVLAEVHSRPVHRICQNKGSSFVAQHSLAYNLFLTAAVGDGIRLWDLR 739          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Mouse
Match: Wdr27 (WD repeat domain 27 [Source:MGI Symbol;Acc:MGI:1918932])

HSP 1 Score: 92.4337 bits (228), Expect = 3.214e-20
Identity = 56/221 (25.34%), Postives = 107/221 (48.42%), Query Frame = 1
Query: 1597 GDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNK-TSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIR 2253
            G  LAC L N    + ++            D  +  + WS + ++L+ T +  ++ ++SV  +R  L    + D     +   +FY +D F   + G +F L+ Y +D  R+DI RYK  S+ K ++    +    IT+  ++N FYS++++      D  + + DLN           H+R + RI  N+GS +     +++N + +++   G++LWD+R
Sbjct:   15 GQKLACGLGNHLSLVFNASLSGPPAAFSGHDGAVSTICWSHDKRWLLSTGRDRTLRVWSV--HRTELMLLLAPDAFPKPVTSAQFYYMDTFILLSSGPEFCLLKYHIDLCRDDIRRYKPKSRYKPIFRLPMTSGADITSLSAVNDFYSHIVLTAG--RDRAVEVFDLNAGCSAAVLAEVHSRPVHRICQNKGSSFVAQHSLAYNLFLTAAVGDGIRLWDLR 231          
BLAST of WD repeat-containing protein 27-like vs. UniProt/SwissProt
Match: sp|A2RRH5|WDR27_HUMAN (WD repeat-containing protein 27 OS=Homo sapiens OX=9606 GN=WDR27 PE=1 SV=3)

HSP 1 Score: 153.68 bits (387), Expect = 4.295e-37
Identity = 150/670 (22.39%), Postives = 286/670 (42.69%), Query Frame = 1
Query:  550 VIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMN-IAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLA--------VSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLP-LKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNK-TSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQI-LCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIE 2496
            +I+   D  F V  H    +++ SSVLS  P+  L  D    +L+ G   G+L  FS+      R + R+ L +              +         P E +    + + + E+ +              LR    DL  + N     L+        + +  GLF  N  + E+   L +  ++SL +     C + N T + K+  L  +L      ++ +  +N   ++     P + +  S+  +  +LP+S L   L +   KS+    ++    +    D  L F +KV+SSGYA   P    F P TN  S  +       +  ++ YP +     K   +         +  ++ S  G  LAC L+N    + D+       V    D  +  V WS + ++L+   +  ++ ++S       L+     D  S  +   +FY +D F   + G +F+L+ Y +D  +++I+RYK  SK K +   S++    +T+  ++N FYS+ I++ +G  +  + + DLN           H+R + +I  N+GS ++   P ++N + +++   G++LWD+R   C + + +   +  Y   I F+PCG+   C   D   + Y++ S+ F   +  +T+T T    +P    + ++T  G ++
Sbjct:  180 LISASEDRGFKVWDHCTGSLIYSSSVLSAYPLLSLFIDAESRQLVTGCADGQLWIFSLMDGHHYRRVARVDLRK-------KTETFSTRRVKSGLCSQPEESQLPSTSALGKGEQVEV---------TFPVLRLAPCDLSLIPNSACGCLSSENTRCVWIGSSVGLFVFNLANLEVEAALYYKDFQSLSILLAGSCALRNRTADQKVLCLLASLF---GGKIAVLEINPAALVRAQQCPSMGQSLSVPASSCVLPTSPLY--LGIAKEKSTKAASEQRRAARNVMKDQRLVFHSKVRSSGYAS-APHVTMFSPKTNIKSEGKGSSRSRSSCAREAYPVECAVPTKPGPQVAAAPTCTRVCCIQYSGDGQWLACGLANHLLLVFDASLTGTPAVFSGHDGAVNAVCWSQDRRWLLSAARDGTLRMWSA--RGAELALLLGKDMFSKPIQSAQFYYIDAFILLSSGPEFQLLRYHIDTCKDEIKRYKQKSKSKLICRLSTTGAVDMTSLSAVNDFYSH-IVLAAG-RNRTVEVFDLNAGCSAAVIAEAHSRPVHQICQNKGSSFTTQQPQAYNLFLTTAIGDGMRLWDLRTLRCERHF-EGHPTRGYPCGIAFSPCGRFAACGAEDRHAYVYEMGSSTFSHRLAGHTDTVTGVAFNPSAPQLATATLDGKLQ 822          
BLAST of WD repeat-containing protein 27-like vs. UniProt/SwissProt
Match: sp|Q8C5V5|WDR27_MOUSE (WD repeat-containing protein 27 OS=Mus musculus OX=10090 GN=Wdr27 PE=2 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 1.220e-30
Identity = 143/614 (23.29%), Postives = 256/614 (41.69%), Query Frame = 1
Query:  550 VIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGG------------AREIYRLRL-----------------HEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFD--KLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPS-----DGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNK-TSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIR 2253
            +I++  D +F V       +++ SS+L+  P+  L  +E   +L+ G+  G+L  FS+ + G              RE +  R                  HEA   G A                   E  F I+++A          DL L D  +  F    ++            L + + T LF LN  SFE+   L F  ++SL +     C M +     K + + +++     + L +D+  +  +  + Y    +  S++ +  +LP+S L     +   K   L   K +  K    D PL F TKV+SSGY  + P    F P TN      K  NK  +K K +Y       + F      ++  +  + + +  L+ S  G  LAC L N    + ++            D  +  + WS + ++L+ T +  ++ ++SV  +R  L    + D     +   +FY +D F   + G +F L+ Y +D  R+DI RYK  S+ K ++    +    IT+  ++N FYS++++      D  + + DLN           H+R + RI  N+GS +     +++N + +++   G++LWD+R
Sbjct:  179 LISVSEDRSFKVWDFCVGSLIYSSSILTAYPLLNLLINEENQQLVTGSADGQLWIFSL-MEGHHYHCVAHVDVRKKRETFTTRRMMAEQCSLPEDHQCRCRHEADKRGEA-------------------EATFPILSLAP--------CDLCLPDSQRGAFASECTK-----------CLWIGSSTALFILNLASFELEAALHFKEFQSLSVQVAGSCAMVSEPMSAKAFCMLSSMFGSKIAVLEIDLAAL--LSTQQYPRAGKVLSVLASSCVLPTSPLY--FGIIKEKFPKLANTKQHAVKSVVEDRPLVFHTKVRSSGYT-LAPHMAMFSPKTNI-----KHHNKRSSKYKNNYKCKECSLENFLPRNLSRQVAVAQKPVAVSCLQFSGDGQKLACGLGNHLSLVFNASLSGPPAAFSGHDGAVSTICWSHDKRWLLSTGRDRTLRVWSV--HRTELMLLLAPDAFPKPVTSAQFYYMDTFILLSSGPEFCLLKYHIDLCRDDIRRYKPKSRYKPIFRLPMTSGADITSLSAVNDFYSHIVLTAG--RDRAVEVFDLNAGCSAAVLAEVHSRPVHRICQNKGSSFVAQHSLAYNLFLTAAVGDGIRLWDLR 739          
BLAST of WD repeat-containing protein 27-like vs. TrEMBL
Match: A0A287CVD2 (Uncharacterized protein OS=Ictidomys tridecemlineatus OX=43179 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 3.736e-46
Identity = 182/809 (22.50%), Postives = 359/809 (44.38%), Query Frame = 1
Query:  139 CVYQFSGKKLT------ESNEILCNQGPLFKIKC--FEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFS-NKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWE-QKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKP-SMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLI-LTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQ-FYPKPKISSRYSNSIQFTPCGQ-ILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIE 2496
            C +   G +L        S+++L  QG L  I    F +    P++ S S  C+ +WN+D+ +  + KG    G ++    +L  K   + FS +  +       +++  +++    S S L + E   G   +           I+I++  D +F V  H    +++ SSV +  P+  L   E   +L+ G   G+L  FS+      R + R+ L +        N     +         P E Q+     + Q EE++  +  +++       R +      L +     L +++ TGLF  +  S E+   L F  ++ L +     C +++   + K + L  ++    K    L++ ++D ++     P+ EK  S++ +  +LP+S L   L +   KS+    +K +  +    D PL F  KV+SSGYA + P+   F P TN     ++     +   +++YP +     K  K+  +  +   +  ++ S  G  LAC L+N    I ++        +   D  +  + WS + ++L+      ++ ++SV  +RK L            +   +FY +D F   + G++ +L+ Y +D  R++I+RYK  S+ +CV   S+    ++T+  ++N FYS++++      +  L + DLN           H+R I +I  N+GS ++     ++N + +++   GV+LWD+R   C + F   P  +  Y   I F+PCG+ + C   D   + Y++  + F   +  +T+T ++   +P    + ++T  G ++
Sbjct:   40 CAFPLHGNQLCLWSIRDPSHQLLILQGHLQSITAMAFGNKENPPLICSASQDCLMIWNLDECREKSLKGLVPRGTVMG---TLLEKVLYLRFSPDDRVVAACAGSRVLVLDVE----SPSVLVELEGHQGTVTAA--EFCPWQGQILISVSEDRSFKVWDHCMGTLVYSSSVFAAYPLLSLFIHEDSKQLLTGCADGQLWVFSLVERHRYRCVARVDLRK-------RNKAFFTRRMESEGCSLPEESQRPSRKMLDQGEEAEAAL-PILMLASCYLPRLLDAGCGVLPSESSACLWIASSTGLFIFHLASLELEHALHFKDFRCLSVQVAGSCAVTSQAADHKAFCLLTSMF--GKRIAILEV-SLDTLVRSQQGPVPEKALSVLASSCVLPTSPLY--LGVVKGKSTKPSGQKQSAVQSAVGDQPLVFHAKVRSSGYA-LPPRVTMFSPKTNIKKDGKRSSKCKINCKREEYPLETSVPSKPSKQVAVCQEPTAVSCVQFSGDGRWLACGLANSLSLIFEASLTGTPAALSGHDGAVSTLCWSHDQRWLLSAAQDQTLRLWSV--HRKELLLLLDRGRLCKPVPSAQFYYMDAFILLSSGQELQLLRYHVDPVRDEIKRYKPRSRYECVLRLSTRGATEVTSLSAVNDFYSHVVLTAG--RNRTLQVFDLNTGCSAAVIAEAHSRPIHQICQNKGSSFTTQQFQAYNLFLTTAVGEGVRLWDLRTLRCERSFEGHP--NRGYPCRIAFSPCGRFVACGAEDRHAYVYNLGCSTFSHRLAGHTDTVSEVAFNPAAPQLATATVDGKLQ 819          
BLAST of WD repeat-containing protein 27-like vs. TrEMBL
Match: U3JKG2 (Uncharacterized protein OS=Ficedula albicollis OX=59894 GN=WDR27 PE=4 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.179e-45
Identity = 169/680 (24.85%), Postives = 315/680 (46.32%), Query Frame = 1
Query:  547 IVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKC--------GIVDL----ILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWK-----SLKL---CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSM--ICNEPLLPSSVLQKCL--NLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLK---QDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLI-LTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCY-ASSSDSGVKLWDIRMKNCTQFYPKPKISSR-YSNSIQFTPCGQILCICMDES-IHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNI 2493
            +++++  D TF V  +  ++++++S +++  P+  L  DE   ++I G   G+L  FS+ +    R +  + L +                  E      W+   EI    Q+    C        G V++    +L +  DF      +     +       + T TGL  +N  +FE+ +F S++     S+++   C ++      K+  L  ++     + L +++  +       +LP   + S+  I    LL +S L K L  N+    S  L  K T K+K      PL F +K+KSSGY    P+   F P TN   LK++E +K+ T  K   ++YP +    IK  K+  +  +   +F ++ S  G+ LAC  ++ +  I +S   +   V    D  + +V WS + K+L+  +   ++ ++SV      L   K    K++     +FY +D F    CG +F L+++ LD  ++D++RYK  S  K V ++  +   +IT+  ++N+FYSY+++     S+  L + DLN        Q  H R + +I  N+GS +S   P ++N +  +++  G+KLWD+R   C + +     SSR Y   I  +PCG+ +    D+   + Y++RS+ F+  +  +TE+    + SP    + ++T  G +
Sbjct:   32 MLVSVSEDRTFKVWDYSTSQLIYQSGIITAFPLLSLLIDEENKQIITGCAEGQLWIFSLIIDHNYRCVAHIDLKK----------------EQEKFCNKVWKSGKEIGE-GQNNSKLCKTDNMRPEGSVEMSLPILLIEHCDFFSCFHNEENIYSSQNTSYFWIGTSTGLLIINLANFELETFLSYRDYSDLSIRIARSCALTRKAANGKVLCLITSMFEDMIAVLEVNLAALVRAQHSDFLPHANEKSLSVIARCNLLANSPLCKGLKKNVKETSSKTLGVKNTVKDK------PLVFHSKIKSSGYTA-APRMTMFSPNTN---LKKQEVSKWKTSCKCKNKEYPLESCPPIKYEKEISVTCKSTPIFCVQYSGDGELLACGQADKTVLIFNSNLTDVHNVFSGHDGAVNSVGWSHDRKWLVSASEDRTLRVWSVCNKELALILGKEKFHKTVRF--AQFYFIDTFILLCCGAEFHLLSFHLDTTKDDLKRYKQRSVCKLVQKFPMTSTMEITSLSAVNEFYSYIVLTAG--SNRALEVFDLNAGCSTAVIQEAHVRPVHQICQNKGSSFSTQQPEAYNLFLTTAAGDGIKLWDLRTLRCERRFAGH--SSRCYPCGIAVSPCGRFVASGSDDKYAYIYEMRSSTFLSKLGRHTESVISVSFSPSSPQLTTATLDGKL 678          
BLAST of WD repeat-containing protein 27-like vs. TrEMBL
Match: I3N081 (Uncharacterized protein OS=Ictidomys tridecemlineatus OX=43179 PE=4 SV=2)

HSP 1 Score: 187.193 bits (474), Expect = 1.471e-45
Identity = 182/803 (22.67%), Postives = 353/803 (43.96%), Query Frame = 1
Query:  139 CVYQFSGKKLT------ESNEILCNQGPLFKIKC--FEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFS-NKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWE-QKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKP-SMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLI-LTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQ-FYPKPKISSRYSNSIQFTPCGQ-ILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSST 2478
            C +   G +L        S+++L  QG L  I    F +    P++ S S  C+ +WN+D+ +  + KG    G ++    +L  K   + FS +  +       +++  +++    S S L + E   G   +           I+I++  D +F V  H    +++ SSV +  P+  L   E   +L+ G   G+L  FS+      R + R+ L +        N     +         P E Q+     + Q EE++  +  +++       R +      L +     L +++ TGLF  +  S E+   L F  ++ L +     C +++   + K + L  ++    K    L++ ++D ++     P+ EK  S++ +  +LP+S L   L +   KS+    +K +  +    D PL F  KV+SSGYA + P+   F P TN     ++     +   +++YP +     K  K+  +  +   +  ++ S  G  LAC L+N    I ++        +   D  +  + WS + ++L+      ++ ++SV  +RK L            +   +FY +D F   + G++ +L+ Y +D  R++I+RYK  S+ +CV   S+    ++T+  ++N FYS++++      +  L + DLN           H+R I +I  N+GS ++     ++N + +++   GV+LWD+R   C + F   P     Y   I F+PCG+ + C   D   + Y++  + F   +  +T+T ++   +P    I   T
Sbjct:   40 CAFPLHGNQLCLWSIRDPSHQLLILQGHLQSITAMAFGNKENPPLICSASQDCLMIWNLDECREKSLKGLVPRGTVMG---TLLEKVLYLRFSPDDRVVAACAGSRVLVLDVE----SPSVLVELEGHQGTVTA--AEFCPWQGQILISVSEDRSFKVWDHCMGTLVYSSSVFAAYPLLSLFIHEDSKQLLTGCADGQLWVFSLVERHRYRCVARVDLRK-------RNKAFFTRRMESEGCSLPEESQRPSRKMLDQGEEAEAAL-PILMLASCYLPRLLDAGCGVLPSESSACLWIASSTGLFIFHLASLELEHALHFKDFRCLSVQVAGSCAVTSQAADHKAFCLLTSMF--GKRIAILEV-SLDTLVRSQQGPVPEKALSVLASSCVLPTSPLY--LGVVKGKSTKPSGQKQSAVQSAVGDQPLVFHAKVRSSGYA-LPPRVTMFSPKTNIKKDGKRSSKCKINCKREEYPLETSVPSKPSKQVAVCQEPTAVSCVQFSGDGRWLACGLANSLSLIFEASLTGTPAALSGHDGAVSTLCWSHDQRWLLSAAQDQTLRLWSV--HRKELLLLLDRGRLCKPVPSAQFYYMDAFILLSSGQELQLLRYHVDPVRDEIKRYKPRSRYECVLRLSTRGATEVTSLSAVNDFYSHVVLTAG--RNRTLQVFDLNTGCSAAVIAEAHSRPIHQICQNKGSSFTTQQFQAYNLFLTTAVGEGVRLWDLRTLRCERSFEGHPNRG--YPCRIAFSPCGRFVACGAEDRHAYVYNLGCSTFSHRLAGHTDTVSEVAFNPAAPQIHPPT 813          
BLAST of WD repeat-containing protein 27-like vs. TrEMBL
Match: I3NAG9 (Uncharacterized protein OS=Ictidomys tridecemlineatus OX=43179 PE=4 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 9.121e-45
Identity = 178/794 (22.42%), Postives = 350/794 (44.08%), Query Frame = 1
Query:  139 CVYQFSGKKLT------ESNEILCNQGPLFKIKC--FEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFS-NKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWE-QKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEI---LSFNSWKSLKL-----CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKP-SMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLI-LTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQ-FYPKPKISSRYSNSIQFTPCGQ-ILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSP 2451
            C +   G +L        S+++L  QG L  I    F +    P++ S S  C+ +WN+D+ +  + KG    G ++    +L  K   + FS +  +       +++  +++    S S L + E   G   +           I+I++  D +F V  H    +++ SSV +  P+  L   E   +L+ G   G+L  FS+      R + R+ L +        N     +         P E Q+     + Q EE++  +  +++       R +      L +     L +++ TGLF  +  S E+   L F  ++ L +     C +++   + K + L  ++       + +  +++D ++     P+ EK  S++ +  +LP+S L   L +   KS+    +K +  +    D PL F  KV+SSGYA + P+   F P TN     ++     +   +++YP +     K  K+  +  +   +  ++ S  G  LAC L+N    I ++        +   D  +  + WS + ++L+      ++ ++SV  +RK L            +   +FY +D F   + G++ +L+ Y +D  R++I+RYK  S+ +CV   S+    ++T+  ++N FYS++++      +  L + DLN           H+R I +I  N+GS ++     ++N + +++   GV+LWD+R   C + F   P     Y   I F+PCG+ + C   D   + Y++  + F   +  +T+T ++   +P
Sbjct:   40 CAFPLHGNQLCLWSIRDPSHQLLILQGHLQSITAMAFGNKENPPLICSASQDCLMIWNLDECREKSLKGLVPRGTVMG---TLLEKVLYLRFSPDDRVVAACAGSRVLVLDVE----SPSVLVELEGHQGTVTA--AEFCPWQGQILISVSEDRSFKVWDHCMGTLVYSSSVFAAYPLLSLFIHEDSKQLLTGCADGQLWVFSLVERHRYRCVARVDLRK-------RNKAFFTRRMESEGCSLPEESQRPSRKMLDQGEEAEAAL-PILMLASCYLPRLLDAGCGVLPSESSACLWIASSTGLFIFHLASLELEHALHFKDFRCLSVQVAGSCAVTSQAADHKAFCLLTSMF---GKRIAILEVSLDTLVRSQQGPVPEKALSVLASSCVLPTSPLY--LGVVKGKSTKPSGQKQSAVQSAVGDQPLVFHAKVRSSGYA-LPPRVTMFSPKTNIKKDGKRSSKCKINCKREEYPLETSVPSKPSKQVAVCQEPTAVSCVQFSGDGRWLACGLANSLSLIFEASLTGTPAALSGHDGAVSTLCWSHDQRWLLSAAQDQTLRLWSV--HRKELLLLLDRGRLCKPVPSAQFYYMDAFILLSSGQELQLLRYHVDPVRDEIKRYKPRSRYECVLRLSTRGATEVTSLSAVNDFYSHVVLTAG--RNRTLQVFDLNTGCSAAVIAEAHSRPIHQICQNKGSSFTTQQFQAYNLFLTTAVGEGVRLWDLRTLRCERSFEGHPNRG--YPCRIAFSPCGRFVACGAEDRHAYVYNLGCSTFSHRLAGHTDTVSEVAFNP 804          
BLAST of WD repeat-containing protein 27-like vs. TrEMBL
Match: A0A2I0MV12 (WD repeat domain 27 (Fragment) OS=Columba livia OX=8932 GN=WDR27 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.400e-42
Identity = 168/654 (25.69%), Postives = 296/654 (45.26%), Query Frame = 1
Query:  547 IVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWK-----SLKL---CYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSM--ICNEPLLPSSVLQKCL--NLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQ---DYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLI-LTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCY-ASSSDSGVKLWDIRMKNCTQFYPKPKISSR-YSNSIQFTPCGQILCICMDES-IHFYDIRSTKFVCDIRSNTETYTDFTCSP 2451
            ++I++  D TF V  +   ++ ++S VL+  P+  L  DE   ++I G   G+L  FS+      R +  + L +        N              +    K   M    S E+    + ++L +  DFL     +     ++      + + TGL  +N  +FEI  F S+K     S++    C ++  T   K+  L  ++     S L +++  +       +L    K S+  I   P+L +S L K L  NL    S  L  K   K      D PL F  K+KSSGY  + P+   F P  N   LK+ E +K+ T  K+   +YP + +  IK  K+  +  +   +  ++ +  G+ LAC L++ +  I  S   +   V    D  + +V WS + K+L+  +   ++ ++SV  N   L   K   +K++     +FY +D F    CG +F L+ +  D  ++D++RYK  S  K V ++  +   +IT+  ++N FYSY+++     S+  L + DLN           H R + +I  N GS +S   P ++N +  +++  G+KLWD+R   C + +     SSR Y   I  +PCG+ +    D+   + Y++RS+ F   +  +TE+  +   SP
Sbjct:  177 MLISVSEDRTFKVWDYSTGQLRYQSGVLTAFPLLSLLVDEENKQIITGCAEGQLWIFSLINGHNYRCVAHINLKKEQE--RFCNKVWKSGKEIGEGRNNSKLCKTNNMRPGGSVETS---LPILLIEHCDFLVCFHNEENISFSLNASYFWIGSSTGLLIVNLANFEIEGFLSYKDYSDLSIRFAGSCALARKTVNGKVLCLITSMFEDITSVLEVNLAALVRTQQSDFLLCGNKNSLSVIARSPILTNSPLCKGLKKNLKEPSSKRLGVKSMVK------DQPLFFHNKIKSSGYT-VAPRMTMFSPNIN---LKKNEVSKWKTTCKRKNKEYPLESYPPIKYEKEISVTCKPTPICCIQYAGDGEKLACGLADKTVVIFSSNLTDTHNVFSGHDGAVNSVGWSHDKKFLVSASEDRTLRVWSVCNNESALILGKEKFQKTVRF--AQFYFIDTFILLCCGAEFHLLRFHPDTTKDDLKRYKQRSVCKLVQKFPMASTMEITSLSAVNDFYSYIVLTAG--SNRALEVFDLNAGCSTAVIPEAHTRSVHQICQNNGSSFSTQQPEAYNLFMTTAAGDGIKLWDLRTLRCERRFEGH--SSRCYPCGIAVSPCGRFIASGSDDKYAYIYEMRSSTFSHKLGGHTESVINVAFSP 809          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Nematostella
Match: EDO32062 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW45])

HSP 1 Score: 114.39 bits (285), Expect = 5.668e-26
Identity = 96/393 (24.43%), Postives = 177/393 (45.04%), Query Frame = 1
Query: 1327 TNKNKRNSI-DHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTK-----LKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKT--SVDIYS--------VVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDS-GVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQ-ILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSP 2451
            T + K ++I D PLTFK+KVKSSGY  + P+ + F P TN+  L ++   K  T      L ++YP +     +  +K  L  Q   +  +  S  G  +AC L+N + H++       + V+   D  + +  +S +D++L LT+ T  +V ++S        V+   K   +     +    +       L          +  + N  +        +Y++N+K K V          IT    +N F+SY++      S+  + ++D+N   V+      H R +  I  NQGS ++     +++ + +++ + G+KLWD+R   C + Y +  ++  +   + F+PC + I     D S + +DIR T F   +  +TE  +D    P
Sbjct:  479 TARGKSSAIQDQPLTFKSKVKSSGYIDV-PRTKMFSPKTNAAKLPKEPTRKSSTDRQTSILAKEYPLESEPPTQLKEKFPLTCQPTAISEIVYSGSGKHVACALANKTAHVLRVSPAGKQIVLTGHDGPVTSAKFSHDDRWL-LTSSTDRTVRLWSPAVSDPLLVINTVKHNFTSDVGTKSKEKVSRVVILPLSSILEHLFVIRLPIDNPCVVARIGSWVKYQSNNKYKLVTMTQLERAQNITCFSCVNSFHSYIVFCCG--SNKSIEVIDMNAGRVVRVILDAHTRLVHSICQNQGSAFAAHPTEAYDLFLTAAVTDGIKLWDLRTNKCVRRY-EGHVNRSHPVGLAFSPCARYIATGSEDRSAYLFDIRGTSFSHRLTGHTEVVSDVAFHP 866          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Medaka
Match: ENSORLT00000044504.1 (WD repeat domain 27 [Source:NCBI gene;Acc:101175343])

HSP 1 Score: 132.109 bits (331), Expect = 2.812e-31
Identity = 105/396 (26.52%), Postives = 182/396 (45.96%), Query Frame = 1
Query: 1321 KKTNKNKRNSI-DHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPS-DGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCI-CMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIE 2496
            + +N  K+ S+ + PL F +KVKSSGY    P++  F P TN+      + +K ++ L  DYP+ D    I     + +++Q L    L+ S  G  + C L + S  +  S+     ++    D  +++V WSL  +Y  L+    + +          +        S  +   +FY LD+F     G    L  Y +D   +DI+RY   S  K      +S + +ITA  +IN F SY++++    SD  + ++D+N+  V       H+R I  I  N+GS +   +  S+N + +S+   G+KLWD+R   C + Y    I      S   +PCG+ +     D   + YDIRS+  +  +  +T+T    + +P    + + T  G + 
Sbjct:  390 EPSNPKKKGSVQEQPLVFHSKVKSSGYTS-SPRQVMFSPKTNAQKKSPPKKSKNVSSLHTDYPAEDAAPTIPCTDLSLVNNQVL---CLQHSGDGKQILCGLEDNSVLMYKSRLTGKPKIFIGHDKPVRSVSWSLSRQYW-LSASEDLSLRMWTHCSSEPAIVMGDGMFSKPIRGAQFYYLDKFVLLGSGPSLHLYLYNVDVTSDDIKRYHRRSVFKLATRLKTS-STEITAMSAINDFLSYIVLVCG--SDRSIQVVDMNRGGVASTMAEAHSRSIHCITQNKGSRFCTQTSDSYNLFLTSAITDGLKLWDLRTMRCVRRYDSHVIRCHPCFS-SISPCGRFIATGSEDNCAYIYDIRSSLHLHKLHRHTDTVLSVSFNPAKPELLTGTLDGKLR 776          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Medaka
Match: ENSORLT00000013475.2 (WD repeat domain 27 [Source:NCBI gene;Acc:101175343])

HSP 1 Score: 121.324 bits (303), Expect = 7.576e-28
Identity = 94/344 (27.33%), Postives = 160/344 (46.51%), Query Frame = 1
Query: 1321 KKTNKNKRNSI-DHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPS-DGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSS-DSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQIL 2343
            + +N  K+ S+ + PL F +KVKSSGY    P++  F P TN+      + +K ++ L  DYP+ D    I     + +++Q L    L+ S  G  + C L + S  +  S+     ++    D  +++V WSL  +Y  L+    + +          +        S  +   +FY LD+F     G    L  Y +D   +DI+RY   S  K      +S + +ITA  +IN F SY++++    SD  + ++D+N+  V       H+R I  I  N+GS +   +  S+N + +S+   G+KLWD+R   C + Y    I      S   +PCG+ +
Sbjct:  390 EPSNPKKKGSVQEQPLVFHSKVKSSGYTS-SPRQVMFSPKTNAQKKSPPKKSKNVSSLHTDYPAEDAAPTIPCTDLSLVNNQVL---CLQHSGDGKQILCGLEDNSVLMYKSRLTGKPKIFIGHDKPVRSVSWSLSRQYW-LSASEDLSLRMWTHCSSEPAIVMGDGMFSKPIRGAQFYYLDKFVLLGSGPSLHLYLYNVDVTSDDIKRYHRRSVFKLATRLKTS-STEITAMSAINDFLSYIVLVCG--SDRSIQVVDMNRGGVASTMAEAHSRSIHCITQNKGSRFCTQTSDSYNLFLTSAITDGLKLWDLRTMRCVRRYDSHVIRCHPCFS-SISPCGRFI 724          
BLAST of WD repeat-containing protein 27-like vs. Ensembl Medaka
Match: ENSORLT00000013477.2 (WD repeat domain 27 [Source:NCBI gene;Acc:101175343])

HSP 1 Score: 114.005 bits (284), Expect = 1.586e-25
Identity = 100/395 (25.32%), Postives = 172/395 (43.54%), Query Frame = 1
Query: 1321 KKTNKNKRNSI-DHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPS-DGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDS-GVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCI-CMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNI 2493
            + +N  K+ S+ + PL F +KVKSSGY    P++  F P TN+      + +K ++ L  DYP+ D    I     + +++Q L                CL +                    D  +++V WSL  +Y  L+    + +          +        S  +   +FY LD+F     G    L  Y +D   +DI+RY   S  K      +S + +ITA  +IN F SY++++    SD  + ++D+N+  V       H+R I  I  N+GS +   +  S+N + +S+ + G+KLWD+R   C + Y    I      S   +PCG+ +     D   + YDIRS+  +  +  +T+T    + +P    + + T  G +
Sbjct:  390 EPSNPKKKGSVQEQPLVFHSKVKSSGYTS-SPRQVMFSPKTNAQKKSPPKKSKNVSSLHTDYPAEDAAPTIPCTDLSLVNNQVL----------------CLQHSG-----------------HDKPVRSVSWSLSRQYW-LSASEDLSLRMWTHCSSEPAIVMGDGMFSKPIRGAQFYYLDKFVLLGSGPSLHLYLYNVDVTSDDIKRYHRRSVFKLATRLKTS-STEITAMSAINDFLSYIVLVCG--SDRSIQVVDMNRGGVASTMAEAHSRSIHCITQNKGSRFCTQTSDSYNLFLTSAITDGLKLWDLRTMRCVRRYDSHVIRCHPCFS-SISPCGRFIATGSEDNCAYIYDIRSSLHLHKLHRHTDTVLSVSFNPAKPELLTGTLDGKL 745          
BLAST of WD repeat-containing protein 27-like vs. Planmine SMEST
Match: SMESG000064082.1 (SMESG000064082.1)

HSP 1 Score: 1555.04 bits (4025), Expect = 0.000e+0
Identity = 815/815 (100.00%), Postives = 815/815 (100.00%), Query Frame = 1
Query:   67 MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIESHLLI 2511
            MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNSCSVIKSSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIESHLLI
Sbjct:    1 MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNSCSVIKSSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIESHLLI 815          
BLAST of WD repeat-containing protein 27-like vs. Planmine SMEST
Match: SMESG000064082.1 (SMESG000064082.1)

HSP 1 Score: 1524.22 bits (3945), Expect = 0.000e+0
Identity = 799/799 (100.00%), Postives = 799/799 (100.00%), Query Frame = 1
Query:   67 MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKM 2463
            MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNSCSVIKSSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKM
Sbjct:    1 MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNSCSVIKSSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKM 799          
BLAST of WD repeat-containing protein 27-like vs. Planmine SMEST
Match: SMESG000064082.1 (SMESG000064082.1)

HSP 1 Score: 1523.84 bits (3944), Expect = 0.000e+0
Identity = 799/799 (100.00%), Postives = 799/799 (100.00%), Query Frame = 1
Query:   67 MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKM 2463
            MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNSCSVIKSSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKM
Sbjct:    1 MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNSCSVIKSSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKM 799          
BLAST of WD repeat-containing protein 27-like vs. Planmine SMEST
Match: SMESG000064082.1 (SMESG000064082.1)

HSP 1 Score: 1522.29 bits (3940), Expect = 0.000e+0
Identity = 799/799 (100.00%), Postives = 799/799 (100.00%), Query Frame = 1
Query:   67 MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKM 2463
            MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNSCSVIKSSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKM
Sbjct:    1 MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNSCSVIKSSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKM 799          
BLAST of WD repeat-containing protein 27-like vs. Planmine SMEST
Match: SMESG000064082.1 (SMESG000064082.1)

HSP 1 Score: 1479.92 bits (3830), Expect = 0.000e+0
Identity = 786/815 (96.44%), Postives = 788/815 (96.69%), Query Frame = 1
Query:   67 MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDEYQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNXXXXXXXXXXXXXXXPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRXXXXXXXXXXXXXXXXXXGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIESHLLI 2511
            MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLS+                           +ISLTGGAREIYRLRLHEAPSYGSASNSCSVIKSSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIESHLLI
Sbjct:    1 MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKIKCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLFYKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSNFQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSLE--------------------------NISLTGGAREIYRLRLHEAPSYGSASNSCSVIKSSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQYLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIKLYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSSVLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPKREFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFLNLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWSLEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRFFHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASVSINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQGSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSIQFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMIFSSTNAGNIESHLLI 789          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 27-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
WDR271.359e-3622.52WD repeat domain 27 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR273.675e-3523.29WD repeat domain 27 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WD repeat-containing protein 27-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 27-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 27-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wdr276.269e-4123.78WD repeat domain 27 [Source:ZFIN;Acc:ZDB-GENE-0511... [more]
back to top
BLAST of WD repeat-containing protein 27-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000018267.19.908e-2429.38pep primary_assembly:Xenopus_tropicalis_v9.1:5:401... [more]
back to top
BLAST of WD repeat-containing protein 27-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr277.747e-4123.39WD repeat domain 27 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr277.747e-4123.39WD repeat domain 27 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr271.744e-3123.29WD repeat domain 27 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr271.744e-3123.29WD repeat domain 27 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr273.214e-2025.34WD repeat domain 27 [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of WD repeat-containing protein 27-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|A2RRH5|WDR27_HUMAN4.295e-3722.39WD repeat-containing protein 27 OS=Homo sapiens OX... [more]
sp|Q8C5V5|WDR27_MOUSE1.220e-3023.29WD repeat-containing protein 27 OS=Mus musculus OX... [more]
back to top
BLAST of WD repeat-containing protein 27-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A287CVD23.736e-4622.50Uncharacterized protein OS=Ictidomys tridecemlinea... [more]
U3JKG21.179e-4524.85Uncharacterized protein OS=Ficedula albicollis OX=... [more]
I3N0811.471e-4522.67Uncharacterized protein OS=Ictidomys tridecemlinea... [more]
I3NAG99.121e-4522.42Uncharacterized protein OS=Ictidomys tridecemlinea... [more]
A0A2I0MV121.400e-4225.69WD repeat domain 27 (Fragment) OS=Columba livia OX... [more]
back to top
BLAST of WD repeat-containing protein 27-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 27-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 27-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 27-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO320625.668e-2624.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 27-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000044504.12.812e-3126.52WD repeat domain 27 [Source:NCBI gene;Acc:10117534... [more]
ENSORLT00000013475.27.576e-2827.33WD repeat domain 27 [Source:NCBI gene;Acc:10117534... [more]
ENSORLT00000013477.21.586e-2525.32WD repeat domain 27 [Source:NCBI gene;Acc:10117534... [more]
back to top
BLAST of WD repeat-containing protein 27-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064082.10.000e+0100.00SMESG000064082.1[more]
SMESG000064082.10.000e+0100.00SMESG000064082.1[more]
SMESG000064082.10.000e+0100.00SMESG000064082.1[more]
SMESG000064082.10.000e+0100.00SMESG000064082.1[more]
SMESG000064082.10.000e+096.44SMESG000064082.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008555 ID=SMED30008555|Name=WD repeat-containing protein 27-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2547bp
AAAATTAATTTTTTTAAAAGTTTTTGCAAACTTTAATTTATCAGGTTAAC
ATATTACTAAGAAAATATGCTTTATAATTACATTGATACCATTAATTATA
ACGTATTAGTAATAAAAAATGATTCAAATGAAAAAATTTGTGTATATCAG
TTTTCAGGGAAAAAACTCACGGAATCTAATGAAATATTATGCAACCAAGG
CCCACTATTTAAAATCAAGTGCTTTGAAGATGTATACAAAAACCCCATGG
TTTTGTCTTTTTCAGATTCGTGTGTGAAATTATGGAATATTGACCAAGTA
AAATGTGATAATGAAAAAGGTACTAATACAGATGGAATTATCCTTTCTTG
TGAAATCTCATTATTCTATAAATGCTCTCTTATAACATTCAGTAACAAAT
GTCTGTATGTGGGAATTCATAAAAAACAAATGATGTCATTCAATCTGGAT
TGCAAAACCGGTTCAAGTTCTGATTTGAATAAATTTGAATTAAAAACCGG
TGAATTTTTATCAAATTTCCAAGTTATTTCCAAAGAAAATTCATTAATTG
TCATTGCGATTTGCAATGATCACACTTTTATTGTTATTAAACACCAAAGA
AATGAAATTCTTTTTCGGTCATCTGTACTATCGGTTAATCCTGTTTCGTG
CTTGACTTGGGATGAATATCAATCTCGATTGATTATTGGAACCTTAGCTG
GAGAATTATTGTATTTTAGTATATCATTAACTGGCGGTGCCCGTGAAATA
TATAGACTGAGACTGCATGAAGCCCCTAGCTATGGATCAGCGAGTAATTC
TTGCTCAGTTATTAAAAGTTCCTCAGAGCTTTCCCTACCTTCACCATGGG
AACAAAAGTTCGAAATAATGAACATTGCTCAATCAGAAGAAAGTAAATGT
GGAATTGTCGATTTGATATTGTTCGACAAATTAGATTTTCTTCGAAATAT
AAGTGAAGATTTACAATATTTAGGAAATGTCCCTATACTAATGCTTGCTG
TTTCAACGCAAACTGGACTTTTCTTCCTCAATCAAGTATCTTTTGAAATA
CTGAGTTTTAATTCTTGGAAATCTTTGAAATTATGTTACATGTCGAATGG
CACGAAAGAAATTAAACTCTACTCTTTGAAAAATAATCTTCTTACCCACG
ACAAAAGTGAACTAACTCTCGATATTCTGAATATCGACTGTATTCTTTTA
AAGCATTATTTACCGTTGAAGGAAAAACCGTCAATGATATGCAATGAACC
GTTGTTACCGTCTTCAGTTTTACAAAAATGCCTCAACTTACCTTCACTAA
AATCTTCAAATTTGGAGCCCAAGAAAACAAACAAAAATAAACGGAATTCT
ATTGATCATCCTTTAACGTTTAAAACAAAAGTTAAATCATCAGGTTATGC
CAAAATTGAACCAAAGCGAGAATTTTTCAAACCAATAACAAATTCAAACT
CTCTCAAACAGAAAGAACCGAATAAATTTATGACAAAATTAAAACAAGAT
TATCCTAGTGATGGATTTACAAAAATCAAAGCAATAAAAAAAACAAAACT
TGATTCTCAATTTCTGAATTTATTTTCTTTGAGGGTGTCAAATTACGGAG
ATTCGTTAGCATGTTGCTTGTCTAATGGCAGTTGTCATATAATAGACTCA
AAATCTCAGAATGCCAAGCAAGTCATCCATTCGTTTGATGACATAATCCA
GAATGTCCATTGGTCATTAGAAGATAAATATTTAATTCTTACAAACAAAA
CCTCTGTAGATATTTATTCGGTTGTTCAAAACCGAAAGCTTTTATCGAGT
GAAAAATCTTCGGATGAAAAGTCTTTAAATTTATTAGATGGCCGATTTTA
CTCTTTGGATAGATTTTTTCATTTTACGTGTGGGCGCAAATTCAAATTGA
TGAATTATGCTCTGGATGAAAATAGAGAAGATATTGAAAGATACAAAAAT
AATAGTAAAGTGAAATGTGTTTATGAATGGAGTTCCAGTGATAATAATCA
AATTACCGCCTCAGTCAGCATTAATCAATTTTACTCATACATGATCATTA
TTGGATCAGGATTGAGTGACAGCCGACTGACGTTACTTGATCTGAATAAA
ATGAATGTTATTGAGGAAAAGCAGTCATGTCACAACCGCAAAATAGACAG
AATTGTTGTTAATCAAGGATCTTTGTATTCAAATATATCTCCAGTAAGCT
TCAATTGTTACGCTTCGTCTTCGGATTCTGGAGTGAAACTTTGGGATATC
AGAATGAAAAATTGTACTCAATTTTATCCTAAACCAAAAATCAGTTCTAG
ATATTCAAATAGCATTCAATTTACTCCTTGTGGCCAAATTTTATGCATAT
GCATGGATGAATCCATTCATTTCTATGATATCAGGAGCACAAAATTTGTC
TGTGATATTCGATCGAATACAGAAACCTACACCGATTTTACATGCAGTCC
TCGTGATAAAATGATATTCTCTTCAACAAATGCGGGAAATATTGAATCGC
ATTTGTTGATATAATCTCAATAAACTCTACAACTATTTCAATCGGAG
back to top

protein sequence of SMED30008555-orf-1

>SMED30008555-orf-1 ID=SMED30008555-orf-1|Name=SMED30008555-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=816bp
MLYNYIDTINYNVLVIKNDSNEKICVYQFSGKKLTESNEILCNQGPLFKI
KCFEDVYKNPMVLSFSDSCVKLWNIDQVKCDNEKGTNTDGIILSCEISLF
YKCSLITFSNKCLYVGIHKKQMMSFNLDCKTGSSSDLNKFELKTGEFLSN
FQVISKENSLIVIAICNDHTFIVIKHQRNEILFRSSVLSVNPVSCLTWDE
YQSRLIIGTLAGELLYFSISLTGGAREIYRLRLHEAPSYGSASNSCSVIK
SSSELSLPSPWEQKFEIMNIAQSEESKCGIVDLILFDKLDFLRNISEDLQ
YLGNVPILMLAVSTQTGLFFLNQVSFEILSFNSWKSLKLCYMSNGTKEIK
LYSLKNNLLTHDKSELTLDILNIDCILLKHYLPLKEKPSMICNEPLLPSS
VLQKCLNLPSLKSSNLEPKKTNKNKRNSIDHPLTFKTKVKSSGYAKIEPK
REFFKPITNSNSLKQKEPNKFMTKLKQDYPSDGFTKIKAIKKTKLDSQFL
NLFSLRVSNYGDSLACCLSNGSCHIIDSKSQNAKQVIHSFDDIIQNVHWS
LEDKYLILTNKTSVDIYSVVQNRKLLSSEKSSDEKSLNLLDGRFYSLDRF
FHFTCGRKFKLMNYALDENREDIERYKNNSKVKCVYEWSSSDNNQITASV
SINQFYSYMIIIGSGLSDSRLTLLDLNKMNVIEEKQSCHNRKIDRIVVNQ
GSLYSNISPVSFNCYASSSDSGVKLWDIRMKNCTQFYPKPKISSRYSNSI
QFTPCGQILCICMDESIHFYDIRSTKFVCDIRSNTETYTDFTCSPRDKMI
FSSTNAGNIESHLLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR042411WDR27
IPR036322WD40_repeat_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 52..365
e-value: 3.1E-7
score: 31.7
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 477..812
e-value: 2.7E-16
score: 61.2
IPR042411WD repeat-containing protein 27PANTHERPTHR44525FAMILY NOT NAMEDcoord: 59..810
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 494..809
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 65..582