Phosphoenolpyruvate carboxykinase [GTP]

Overview
NamePhosphoenolpyruvate carboxykinase [GTP]
Smed IDSMED30008553
Length (bp)2105
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoenolpyruvate carboxykinase [GTP] (SMED30008553) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoenolpyruvate carboxykinase [GTP] (SMED30008553) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoenolpyruvate carboxykinase [GTP] (SMED30008553) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoenolpyruvate carboxykinase [GTP] (SMED30008553) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008553

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30008553SMESG000062868.1 dd_Smed_v4_196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30008553SMESG000062868.1 dd_Smed_v4_196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008553SMESG000062868.1 dd_Smed_v4_196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008553SMESG000062868.1 dd_Smed_v4_196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008553SMESG000062868.1 dd_Smed_v4_196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008553SMESG000062868.1 OX_Smed_1.0.13291ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30008553SMESG000062868.1 dd_Smed_v6_196_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008553SMESG000062868.1 dd_Smed_v4_196_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Match: PCK2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:8725])

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 361/611 (59.08%), Postives = 465/611 (76.10%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            +  GD   LP  ++ F+   A +C+P  ++ICDG E E T  +T L+++G +  L K  N ++ RTDP DVARVESKT I T ++  TVP    G++G LG W++P D    V ER  GCM GR MY++PFSMGP+GSPLS+IG+QLTDS YVV  MRIMTR+   V   L D  FVKC+HSVG P     + ++ WPCNPEKTLI H+PD+R IIS+GSGYGGNSLLGKKCFALRIA R+A DEGW+AEHMLI+ +T+P G+++++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWMRFD  G LRAINPE GFFGVAPGT+  TNPNAM T Q N+IFTNVAET+DG  YWEG+++ + P + VTSWLG   K GDK   P AHPNSRFC PA QCPI+ P WE P+GVPI AI+FGGRRP+G+PLV +AF+W+HGV +G++++SE+TAAAE KGK IMHDP AMRPF GYNFG YL+HWL +E + G ++P IFHVNWFR +E G F+WPGFG+N RV+DW+CRR+ GED A  +PIGL+PK+G+LD+SGL  +   ++F+LPK++  +++++ + +L EQ  +DLP  V+ +L+  E+R+H M
Sbjct:   32 VLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTVPLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKE--PCAHPNSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRRDEAGHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM 640          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Match: PCK2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:8725])

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 361/611 (59.08%), Postives = 465/611 (76.10%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            +  GD   LP  ++ F+   A +C+P  ++ICDG E E T  +T L+++G +  L K  N ++ RTDP DVARVESKT I T ++  TVP    G++G LG W++P D    V ER  GCM GR MY++PFSMGP+GSPLS+IG+QLTDS YVV  MRIMTR+   V   L D  FVKC+HSVG P     + ++ WPCNPEKTLI H+PD+R IIS+GSGYGGNSLLGKKCFALRIA R+A DEGW+AEHMLI+ +T+P G+++++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWMRFD  G LRAINPE GFFGVAPGT+  TNPNAM T Q N+IFTNVAET+DG  YWEG+++ + P + VTSWLG   K GDK   P AHPNSRFC PA QCPI+ P WE P+GVPI AI+FGGRRP+G+PLV +AF+W+HGV +G++++SE+TAAAE KGK IMHDP AMRPF GYNFG YL+HWL +E + G ++P IFHVNWFR +E G F+WPGFG+N RV+DW+CRR+ GED A  +PIGL+PK+G+LD+SGL  +   ++F+LPK++  +++++ + +L EQ  +DLP  V+ +L+  E+R+H M
Sbjct:   32 VLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTVPLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKE--PCAHPNSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRRDEAGHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM 640          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Match: PCK1 (phosphoenolpyruvate carboxykinase 1 [Source:HGNC Symbol;Acc:HGNC:8724])

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 344/611 (56.30%), Postives = 454/611 (74.30%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDL-EKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            + +G    LP+ V+ F+   A +C+P  ++ICDG E+E   ++ +++E G L  L K +N ++  TDP DVAR+ESKT I T+ +  TVP  K G    LG+W++ ED  +    R  GCM GR MY+IPFSMGP+GSPLSKIGI+LTDS YVV  MRIMTR+   V   + D  FVKC+HSVGCP P  + ++N+WPCNPE TLIAHLPD R IIS+GSGYGGNSLLGKKCFALR+A R+A +EGW+AEHMLI+ +TNP+GE+K++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWM+FD  G LRAINPE GFFGVAPGT+ KTNPNA+KT QKN+IFTNVAET+DG  YWEG+++ +   + +TSW   +    D    P AHPNSRFC PASQCPII   WE P+GVPI  I+FGGRRP G+PLV +A  W+HGV +GA+++SEATAAAE KGK IMHDP AMRPF GYNFG+YL HWL + + P  K+P IFHVNWFR +++GKF+WPGFG+N RV++WM  R++G+   + +PIG +PK+ +L++ GL  +   E+F++ K +  +++++ +K+L +Q   DLP  + +++   ++RI  M
Sbjct:   15 VVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQMEEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQ-LGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPVLEAVGDGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGE--PCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWMFNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQVNADLPCEIEREILALKQRISQM 622          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Match: PCK2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:8725])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 317/508 (62.40%), Postives = 402/508 (79.13%), Query Frame = 2
Query:  452 IAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            ++P D    V ER  GCM GR MY++PFSMGP+GSPLS+IG+QLTDS YVV  MRIMTR+   V   L D  FVKC+HSVG P     + ++ WPCNPEKTLI H+PD+R IIS+GSGYGGNSLLGKKCFALRIA R+A DEGW+AEHMLI+ +T+P G+++++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWMRFD  G LRAINPE GFFGVAPGT+  TNPNAM T Q N+IFTNVAET+DG  YWEG+++ + P + VTSWLG   K GDK   P AHPNSRFC PA QCPI+ P WE P+GVPI AI+FGGRRP+G+PLV +AF+W+HGV +G++++SE+TAAAE KGK IMHDP AMRPF GYNFG YL+HWL +E + G ++P IFHVNWFR +E G F+WPGFG+N RV+DW+CRR+ GED A  +PIGL+PK+G+LD+SGL  +   ++F+LPK++  +++++ + +L EQ  +DLP  V+ +L+  E+R+H M
Sbjct:    1 MSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKE--PCAHPNSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRRDEAGHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM 506          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Match: PCK2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:8725])

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 317/508 (62.40%), Postives = 402/508 (79.13%), Query Frame = 2
Query:  452 IAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            ++P D    V ER  GCM GR MY++PFSMGP+GSPLS+IG+QLTDS YVV  MRIMTR+   V   L D  FVKC+HSVG P     + ++ WPCNPEKTLI H+PD+R IIS+GSGYGGNSLLGKKCFALRIA R+A DEGW+AEHMLI+ +T+P G+++++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWMRFD  G LRAINPE GFFGVAPGT+  TNPNAM T Q N+IFTNVAET+DG  YWEG+++ + P + VTSWLG   K GDK   P AHPNSRFC PA QCPI+ P WE P+GVPI AI+FGGRRP+G+PLV +AF+W+HGV +G++++SE+TAAAE KGK IMHDP AMRPF GYNFG YL+HWL +E + G ++P IFHVNWFR +E G F+WPGFG+N RV+DW+CRR+ GED A  +PIGL+PK+G+LD+SGL  +   ++F+LPK++  +++++ + +L EQ  +DLP  V+ +L+  E+R+H M
Sbjct:    1 MSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKE--PCAHPNSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRRDEAGHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM 506          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Match: pck-2 (Phosphoenolypyruvate CarboxyKinase [Source:UniProtKB/TrEMBL;Acc:Q7JKI2])

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 415/625 (66.40%), Postives = 496/625 (79.36%), Query Frame = 2
Query:  104 VHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEV-DPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGE-DIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            V+EVV+  LGH+PI KGD+H LP KVQ FIA+ A + +PR ++ICDG + EA E+I KL ERG L  L   EN++ICRTDP DVARVESKT++ TKNK+ TV H KEG + I+G W+APEDL  E+  R  GCM GR+MY+IPFSMGP+G PLSKIGIQLTDSNYVVL MRIMTRV+  VW  L +  FV+C+HSVG PRP  ++VINHWPCNPE+ LIAH P ER I S+GSGYGGNSLLGKKCFALRIA  IA DEGWMAEHMLIM VT P G E FIAAAFPSACGKTN+AMLEP LPGWKV+ VGDDIAWM+F E G L AINPEAGFFGVAPGT+ KTNP A+ TFQKNSIFTNVAET +G Y+WEG+E E+ D N+++T+WLG K  +G+   G AAHPNSRF  PA+QCPIIHP WE PQGVPI AI+FGGRRP+G+PL+ +   W+HGV  G+ LKSEATAAAEF GK +MHDPMAMRPFMGYNFG+YLQHWLDL+   RKMP I+HVNWFR +   KF+WPGFGDNIRVIDW+ RR++GE +I   +PIG +P KGS+++ GL +V W+E+ ++P +Y  +D QE +KFL EQ GEDLP  V  ++D QEKR+  +
Sbjct:   32 VNEVVMKRLGHVPILKGDFHLLPAKVQRFIAEKAELMRPRGIFICDGSQHEADELIDKLIERGMLSKLEAYENNYICRTDPKDVARVESKTWMVTKNKYDTVTHTKEGVEPIMGHWLAPEDLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRVNNDVWDALGNQDFVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKCFALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEPTLPGWKVRCVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTSNKTNPMAVATFQKNSIFTNVAETANGEYFWEGLEDEIADKNVDITTWLGEKWHIGE--PGVAAHPNSRFAAPANQCPIIHPDWESPQGVPIEAIIFGGRRPQGVPLIYETNSWEHGVFTGSCLKSEATAAAEFTGKTVMHDPMAMRPFMGYNFGKYLQHWLDLKTDSRKMPKIYHVNWFRKDSNNKFLWPGFGDNIRVIDWIIRRLDGEQEIGVETPIGTVPAKGSINLEGLGEVNWDELMSVPADYWKQDAQEIRKFLDEQVGEDLPEPVRAEMDAQEKRVQTL 654          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Match: pck-2 (Phosphoenolypyruvate CarboxyKinase [Source:UniProtKB/TrEMBL;Acc:Q7JKI2])

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 415/625 (66.40%), Postives = 496/625 (79.36%), Query Frame = 2
Query:  104 VHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEV-DPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGE-DIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            V+EVV+  LGH+PI KGD+H LP KVQ FIA+ A + +PR ++ICDG + EA E+I KL ERG L  L   EN++ICRTDP DVARVESKT++ TKNK+ TV H KEG + I+G W+APEDL  E+  R  GCM GR+MY+IPFSMGP+G PLSKIGIQLTDSNYVVL MRIMTRV+  VW  L +  FV+C+HSVG PRP  ++VINHWPCNPE+ LIAH P ER I S+GSGYGGNSLLGKKCFALRIA  IA DEGWMAEHMLIM VT P G E FIAAAFPSACGKTN+AMLEP LPGWKV+ VGDDIAWM+F E G L AINPEAGFFGVAPGT+ KTNP A+ TFQKNSIFTNVAET +G Y+WEG+E E+ D N+++T+WLG K  +G+   G AAHPNSRF  PA+QCPIIHP WE PQGVPI AI+FGGRRP+G+PL+ +   W+HGV  G+ LKSEATAAAEF GK +MHDPMAMRPFMGYNFG+YLQHWLDL+   RKMP I+HVNWFR +   KF+WPGFGDNIRVIDW+ RR++GE +I   +PIG +P KGS+++ GL +V W+E+ ++P +Y  +D QE +KFL EQ GEDLP  V  ++D QEKR+  +
Sbjct:   32 VNEVVMKRLGHVPILKGDFHLLPAKVQRFIAEKAELMRPRGIFICDGSQHEADELIDKLIERGMLSKLEAYENNYICRTDPKDVARVESKTWMVTKNKYDTVTHTKEGVEPIMGHWLAPEDLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRVNNDVWDALGNQDFVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKCFALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEPTLPGWKVRCVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTSNKTNPMAVATFQKNSIFTNVAETANGEYFWEGLEDEIADKNVDITTWLGEKWHIGE--PGVAAHPNSRFAAPANQCPIIHPDWESPQGVPIEAIIFGGRRPQGVPLIYETNSWEHGVFTGSCLKSEATAAAEFTGKTVMHDPMAMRPFMGYNFGKYLQHWLDLKTDSRKMPKIYHVNWFRKDSNNKFLWPGFGDNIRVIDWIIRRLDGEQEIGVETPIGTVPAKGSINLEGLGEVNWDELMSVPADYWKQDAQEIRKFLDEQVGEDLPEPVRAEMDAQEKRVQTL 654          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Match: pck-2 (Phosphoenolypyruvate CarboxyKinase [Source:UniProtKB/TrEMBL;Acc:Q7JKI2])

HSP 1 Score: 830.476 bits (2144), Expect = 0.000e+0
Identity = 411/617 (66.61%), Postives = 490/617 (79.42%), Query Frame = 2
Query:  128 LGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEV-DPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGE-DIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            LGH+PI KGD+H LP KVQ FIA+ A + +PR ++ICDG + EA E+I KL ERG L  L   EN++ICRTDP DVARVESKT++ TKNK+ TV H KEG + I+G W+APEDL  E+  R  GCM GR+MY+IPFSMGP+G PLSKIGIQLTDSNYVVL MRIMTRV+  VW  L +  FV+C+HSVG PRP  ++VINHWPCNPE+ LIAH P ER I S+GSGYGGNSLLGKKCFALRIA  IA DEGWMAEHMLIM VT P G E FIAAAFPSACGKTN+AMLEP LPGWKV+ VGDDIAWM+F E G L AINPEAGFFGVAPGT+ KTNP A+ TFQKNSIFTNVAET +G Y+WEG+E E+ D N+++T+WLG K  +G+   G AAHPNSRF  PA+QCPIIHP WE PQGVPI AI+FGGRRP+G+PL+ +   W+HGV  G+ LKSEATAAAEF GK +MHDPMAMRPFMGYNFG+YLQHWLDL+   RKMP I+HVNWFR +   KF+WPGFGDNIRVIDW+ RR++GE +I   +PIG +P KGS+++ GL +V W+E+ ++P +Y  +D QE +KFL EQ GEDLP  V  ++D QEKR+  +
Sbjct:    4 LGHVPILKGDFHLLPAKVQRFIAEKAELMRPRGIFICDGSQHEADELIDKLIERGMLSKLEAYENNYICRTDPKDVARVESKTWMVTKNKYDTVTHTKEGVEPIMGHWLAPEDLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRVNNDVWDALGNQDFVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKCFALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEPTLPGWKVRCVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTSNKTNPMAVATFQKNSIFTNVAETANGEYFWEGLEDEIADKNVDITTWLGEKWHIGE--PGVAAHPNSRFAAPANQCPIIHPDWESPQGVPIEAIIFGGRRPQGVPLIYETNSWEHGVFTGSCLKSEATAAAEFTGKTVMHDPMAMRPFMGYNFGKYLQHWLDLKTDSRKMPKIYHVNWFRKDSNNKFLWPGFGDNIRVIDWIIRRLDGEQEIGVETPIGTVPAKGSINLEGLGEVNWDELMSVPADYWKQDAQEIRKFLDEQVGEDLPEPVRAEMDAQEKRVQTL 618          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Match: pck-2 (Phosphoenolypyruvate CarboxyKinase [Source:UniProtKB/TrEMBL;Acc:Q7JKI2])

HSP 1 Score: 830.476 bits (2144), Expect = 0.000e+0
Identity = 411/617 (66.61%), Postives = 490/617 (79.42%), Query Frame = 2
Query:  128 LGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEV-DPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGE-DIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            LGH+PI KGD+H LP KVQ FIA+ A + +PR ++ICDG + EA E+I KL ERG L  L   EN++ICRTDP DVARVESKT++ TKNK+ TV H KEG + I+G W+APEDL  E+  R  GCM GR+MY+IPFSMGP+G PLSKIGIQLTDSNYVVL MRIMTRV+  VW  L +  FV+C+HSVG PRP  ++VINHWPCNPE+ LIAH P ER I S+GSGYGGNSLLGKKCFALRIA  IA DEGWMAEHMLIM VT P G E FIAAAFPSACGKTN+AMLEP LPGWKV+ VGDDIAWM+F E G L AINPEAGFFGVAPGT+ KTNP A+ TFQKNSIFTNVAET +G Y+WEG+E E+ D N+++T+WLG K  +G+   G AAHPNSRF  PA+QCPIIHP WE PQGVPI AI+FGGRRP+G+PL+ +   W+HGV  G+ LKSEATAAAEF GK +MHDPMAMRPFMGYNFG+YLQHWLDL+   RKMP I+HVNWFR +   KF+WPGFGDNIRVIDW+ RR++GE +I   +PIG +P KGS+++ GL +V W+E+ ++P +Y  +D QE +KFL EQ GEDLP  V  ++D QEKR+  +
Sbjct:    4 LGHVPILKGDFHLLPAKVQRFIAEKAELMRPRGIFICDGSQHEADELIDKLIERGMLSKLEAYENNYICRTDPKDVARVESKTWMVTKNKYDTVTHTKEGVEPIMGHWLAPEDLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRVNNDVWDALGNQDFVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKCFALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEPTLPGWKVRCVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTSNKTNPMAVATFQKNSIFTNVAETANGEYFWEGLEDEIADKNVDITTWLGEKWHIGE--PGVAAHPNSRFAAPANQCPIIHPDWESPQGVPIEAIIFGGRRPQGVPLIYETNSWEHGVFTGSCLKSEATAAAEFTGKTVMHDPMAMRPFMGYNFGKYLQHWLDLKTDSRKMPKIYHVNWFRKDSNNKFLWPGFGDNIRVIDWIIRRLDGEQEIGVETPIGTVPAKGSINLEGLGEVNWDELMSVPADYWKQDAQEIRKFLDEQVGEDLPEPVRAEMDAQEKRVQTL 618          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Match: pck-2 (Phosphoenolypyruvate CarboxyKinase [Source:UniProtKB/TrEMBL;Acc:Q7JKI2])

HSP 1 Score: 830.476 bits (2144), Expect = 0.000e+0
Identity = 411/617 (66.61%), Postives = 490/617 (79.42%), Query Frame = 2
Query:  128 LGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEV-DPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGE-DIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            LGH+PI KGD+H LP KVQ FIA+ A + +PR ++ICDG + EA E+I KL ERG L  L   EN++ICRTDP DVARVESKT++ TKNK+ TV H KEG + I+G W+APEDL  E+  R  GCM GR+MY+IPFSMGP+G PLSKIGIQLTDSNYVVL MRIMTRV+  VW  L +  FV+C+HSVG PRP  ++VINHWPCNPE+ LIAH P ER I S+GSGYGGNSLLGKKCFALRIA  IA DEGWMAEHMLIM VT P G E FIAAAFPSACGKTN+AMLEP LPGWKV+ VGDDIAWM+F E G L AINPEAGFFGVAPGT+ KTNP A+ TFQKNSIFTNVAET +G Y+WEG+E E+ D N+++T+WLG K  +G+   G AAHPNSRF  PA+QCPIIHP WE PQGVPI AI+FGGRRP+G+PL+ +   W+HGV  G+ LKSEATAAAEF GK +MHDPMAMRPFMGYNFG+YLQHWLDL+   RKMP I+HVNWFR +   KF+WPGFGDNIRVIDW+ RR++GE +I   +PIG +P KGS+++ GL +V W+E+ ++P +Y  +D QE +KFL EQ GEDLP  V  ++D QEKR+  +
Sbjct:    4 LGHVPILKGDFHLLPAKVQRFIAEKAELMRPRGIFICDGSQHEADELIDKLIERGMLSKLEAYENNYICRTDPKDVARVESKTWMVTKNKYDTVTHTKEGVEPIMGHWLAPEDLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGIQLTDSNYVVLSMRIMTRVNNDVWDALGNQDFVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPPEREIWSFGSGYGGNSLLGKKCFALRIASNIAKDEGWMAEHMLIMGVTRPCGREHFIAAAFPSACGKTNLAMLEPTLPGWKVRCVGDDIAWMKFGEDGRLYAINPEAGFFGVAPGTSNKTNPMAVATFQKNSIFTNVAETANGEYFWEGLEDEIADKNVDITTWLGEKWHIGE--PGVAAHPNSRFAAPANQCPIIHPDWESPQGVPIEAIIFGGRRPQGVPLIYETNSWEHGVFTGSCLKSEATAAAEFTGKTVMHDPMAMRPFMGYNFGKYLQHWLDLKTDSRKMPKIYHVNWFRKDSNNKFLWPGFGDNIRVIDWIIRRLDGEQEIGVETPIGTVPAKGSINLEGLGEVNWDELMSVPADYWKQDAQEIRKFLDEQVGEDLPEPVRAEMDAQEKRVQTL 618          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Fly
Match: Pepck1 (gene:FBgn0003067 transcript:FBtr0086701)

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 352/618 (56.96%), Postives = 452/618 (73.14%), Query Frame = 2
Query:  125 HLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNA-FVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL--DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            H+  +PI  G+   L   V+ F+ +   +C+P  ++ICDG E E   +I  L E GT+  L K +N ++ RT+P DVARVES+TFI T+ +  T+P   EG KG LG WI+P D++  V +R  GCM GR MY++PFSMGP+GSPLSKIGI+LTDS YVV  MRIMTR+   V   L+    FV+ +HSVG P  + +     WPC+PE+T+I H P E LI+SYGSGYGGNSLLGKKCFALRI   IA  EGW+AEHMLI+ +T+PKGE+K+I AAFPSACGKTN+AML P L  +KV+ VGDDIAWM+FD  GVLRAINPE GFFGVAPGT+ +TNP AM T  KN+IFTNVA T+DG  +WEGME  + PN+++T WLG K    D  K PAAHPNSRFC PA+QCPII   WEDP GVPISA++FGGRRP G+PL+ +A DW HGV +GA+++SEATAAAE KGK IMHDP AMRPF GYNFG Y+ HWL +EK G ++P IFHVNWFR + +GKF+WPG+G+N RV++W+ RRVNGE     S IG +P +G+L++ G+   V  +E+F+LPK + ++++++ + +   Q G DLPA + QQLDE   R+ N+
Sbjct:   34 HIRGIPISYGNVDLLTTGVRAFVEEGIALCQPDQVHICDGSEQENKVLIKSLLEAGTIVPLPKYDNCWLARTNPADVARVESRTFICTERREETIPTPVEGVKGTLGNWISPSDMDAAVQQRFPGCMKGRTMYVVPFSMGPVGSPLSKIGIELTDSAYVVASMRIMTRMGAAVLRQLAKKEEFVRALHSVGAP-ANGQVEQPSWPCDPERTIILHKPAENLIVSYGSGYGGNSLLGKKCFALRIGSTIAKQEGWLAEHMLILGITDPKGEKKYITAAFPSACGKTNLAMLNPSLANYKVECVGDDIAWMKFDSQGVLRAINPENGFFGVAPGTSMETNPIAMNTVFKNTIFTNVASTSDGGVFWEGMESSLAPNVQITDWLG-KPWTKDSGK-PAAHPNSRFCTPAAQCPIIDEAWEDPAGVPISAMLFGGRRPAGVPLIYEARDWTHGVFIGAAMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGDYVAHWLSMEKRG-QVPKIFHVNWFRKSAEGKFMWPGYGENSRVLEWILRRVNGESCYVDSAIGHIPAEGALNLDGMKDKVDVKEIFSLPKEFWSQEVKDIRTYFESQVGADLPASIYQQLDELSSRVDNL 647          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Fly
Match: Pepck2 (gene:FBgn0034356 transcript:FBtr0086699)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 353/615 (57.40%), Postives = 452/615 (73.50%), Query Frame = 2
Query:  137 MPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLS--DNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKG-PAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            + I  GD   L   V+ ++ K   +C+P  ++ICDG E E+  +   + ++GT+  L K EN ++ RT+P DVARVE KTFIST +K  TVP  ++ + G+LG WIA +D+   + ER  GCM GR MY+IPFSMGP+GSPLSKIGI++TDS YVV  M+IMTR    V +YL   D  FVKC+HSVG P+    + +  WPC+PE+T++ H P E  I+SYGSGYGGNSLLGKKC ALRI   IA  EGW+AEHMLI+ +TNP+G++ +IAAAFPSACGKTN+AM+ P LPG+KV+ VGDDIAWM+FD  GVLRAINPE GFFGVAPGT+  TNP AM T  +NS+FTNVA T+DG  YWEGMEK+    + VT WLG   K+  +  G PAAHPNSRFC PASQCPII P WED +GVPISAI+FGGRRP G+PLV +A DWKHGV +GA+++SEATAAAEFKGK IMHDP AMRPF GYNFG YL HWL +E+ G ++P IFHVNWFR + +GKF+WPGFG+N RV+DW+ RRV GE   E SPIG LP K SL++  L+ +  +++F+LPK++  +++   +++  EQ G  LP  V ++L E + R+ +M
Sbjct:   29 LSIQYGDAKILTPAVKQYVEKCVELCQPERVHICDGTEVESKLLQGIMLKKGTIIPLPKYENCWLARTNPADVARVEGKTFISTDSKEQTVPVTEKATPGMLGNWIAEKDMQAAIKERFPGCMKGRTMYVIPFSMGPVGSPLSKIGIEITDSPYVVESMKIMTRAGNPVLNYLQSGDGQFVKCLHSVGTPKSG-VQAMPSWPCDPERTIVLHKPAENEIVSYGSGYGGNSLLGKKCLALRIGSTIAKREGWLAEHMLILGITNPQGKKIYIAAAFPSACGKTNLAMMTPTLPGYKVECVGDDIAWMKFDNKGVLRAINPENGFFGVAPGTSRATNPIAMDTIFRNSVFTNVASTSDGGVYWEGMEKDQLKGVTVTDWLG---KLWSQESGKPAAHPNSRFCTPASQCPIIDPAWEDSEGVPISAILFGGRRPSGVPLVYEARDWKHGVFIGAAMRSEATAAAEFKGKVIMHDPFAMRPFFGYNFGDYLGHWLSMEQRG-QVPKIFHVNWFRKSSEGKFLWPGFGENSRVLDWIFRRVEGEQCFEDSPIGRLPSKNSLNLDSLENIDLDQLFDLPKDFWEQEVAAIERYFEEQVGHHLPGAVAEELRELKARVADM 638          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Fly
Match: Pepck2 (gene:FBgn0034356 transcript:FBtr0113093)

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 339/566 (59.89%), Postives = 427/566 (75.44%), Query Frame = 2
Query:  284 ERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLS--DNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKG-PAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            ++GT+  L K EN ++ RT+P DVARVE KTFIST +K  TVP  ++ + G+LG WIA +D+   + ER  GCM GR MY+IPFSMGP+GSPLSKIGI++TDS YVV  M+IMTR    V +YL   D  FVKC+HSVG P+    + +  WPC+PE+T++ H P E  I+SYGSGYGGNSLLGKKC ALRI   IA  EGW+AEHMLI+ +TNP+G++ +IAAAFPSACGKTN+AM+ P LPG+KV+ VGDDIAWM+FD  GVLRAINPE GFFGVAPGT+  TNP AM T  +NS+FTNVA T+DG  YWEGMEK+    + VT WLG   K+  +  G PAAHPNSRFC PASQCPII P WED +GVPISAI+FGGRRP G+PLV +A DWKHGV +GA+++SEATAAAEFKGK IMHDP AMRPF GYNFG YL HWL +E+ G ++P IFHVNWFR + +GKF+WPGFG+N RV+DW+ RRV GE   E SPIG LP K SL++  L+ +  +++F+LPK++  +++   +++  EQ G  LP  V ++L E + R+ +M
Sbjct:    3 KKGTIIPLPKYENCWLARTNPADVARVEGKTFISTDSKEQTVPVTEKATPGMLGNWIAEKDMQAAIKERFPGCMKGRTMYVIPFSMGPVGSPLSKIGIEITDSPYVVESMKIMTRAGNPVLNYLQSGDGQFVKCLHSVGTPKSG-VQAMPSWPCDPERTIVLHKPAENEIVSYGSGYGGNSLLGKKCLALRIGSTIAKREGWLAEHMLILGITNPQGKKIYIAAAFPSACGKTNLAMMTPTLPGYKVECVGDDIAWMKFDNKGVLRAINPENGFFGVAPGTSRATNPIAMDTIFRNSVFTNVASTSDGGVYWEGMEKDQLKGVTVTDWLG---KLWSQESGKPAAHPNSRFCTPASQCPIIDPAWEDSEGVPISAILFGGRRPSGVPLVYEARDWKHGVFIGAAMRSEATAAAEFKGKVIMHDPFAMRPFFGYNFGDYLGHWLSMEQRG-QVPKIFHVNWFRKSSEGKFLWPGFGENSRVLDWIFRRVEGEQCFEDSPIGRLPSKNSLNLDSLENIDLDQLFDLPKDFWEQEVAAIERYFEEQVGHHLPGAVAEELRELKARVADM 563          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Zebrafish
Match: pck1 (phosphoenolpyruvate carboxykinase 1 (soluble) [Source:ZFIN;Acc:ZDB-GENE-030909-11])

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 347/608 (57.07%), Postives = 454/608 (74.67%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRI 1960
            + +GD   L   V+ FI     +C+P AL+ICDG E E + I++ L+E+G +  L K  N ++ RTDP DVARVESKT I T  +  TVP    G    LG+W+ PE+ ++ +  R  GCM GR+MY+IPFSMGP+GSPLSKIG++LTDS YVV  MRIMTR+   V   L +  FV+C+HSVGCP P  + ++N+WPCNPE TL+AH+PD+R I+S+GSGYGGNSLLGKKCFALRIA RIA +EGW+AEHMLI+ +TNP G++K+ AAAFPSACGKTN+AML+P LPGWKV+ VGDDIAWM+FD+ G LRAINPE GFFGVAPGT+ KTNPNAM T   N++FTNVAE++DG  +WEGM++++   + +TSW        D    P AHPNSRFC PA+QCPII P+WE P+GVPI AI+FGGRRP+G+PLV +AFDW HGV +GAS++SEATAAAE KGK IMHDP AMRPF GYNFG+YL HWL +E +PG K+P IFHVNWF  +  G+F+WPGFG+NIRV++WM  R++G   A  + +GL+P  G+L++ GL DV+  E+F + + +  +++QE +++   +   DLP  + +QL+  E R+
Sbjct:   15 VLQGDLASLSASVREFIDSSVSLCQPDALHICDGSEQENSTILSLLEEQGAIKRLRKYSNCWLARTDPRDVARVESKTVIVTAEQRDTVPTPTGGGVSQLGRWMCPEEWDKAMNLRFPGCMKGRVMYVIPFSMGPVGSPLSKIGVELTDSPYVVASMRIMTRMGKTVLSALGNGEFVRCLHSVGCPLPLRKPLVNNWPCNPELTLVAHIPDQRKIVSFGSGYGGNSLLGKKCFALRIASRIAKEEGWLAEHMLILGITNPAGQKKYFAAAFPSACGKTNLAMLKPSLPGWKVECVGDDIAWMKFDKEGNLRAINPENGFFGVAPGTSSKTNPNAMSTISCNTLFTNVAESSDGGVFWEGMDEDLPEGVTLTSWKNQPWTPEDGE--PCAHPNSRFCTPAAQCPIIDPQWESPEGVPIEAIIFGGRRPQGVPLVYEAFDWAHGVFVGASMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGQYLSHWLSMEQRPGAKLPKIFHVNWFGRSSSGRFLWPGFGENIRVLEWMFGRLSGGAEARTTAVGLVPADGALNLHGLPDVEPLELFRVSQEFWMQELQEIREYFSRELNRDLPQEMQRQLELLEHRL 620          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Zebrafish
Match: pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:ZFIN;Acc:ZDB-GENE-040426-2266])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 334/609 (54.84%), Postives = 438/609 (71.92%), Query Frame = 2
Query:  167 LPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNA-FVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE--KPGRKMPLIFHVNWFRLNEQ-GKFVWPGFGDNIRVIDWM---CRRVNGEDIAEPSPIGLLPKKGSLDISGL--DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHN 1966
            LP  V  F++  A  CKP  +++  G  +E  +++  L++ G +  L K EN ++ RTDP DVARVESKT I TKN+  T+P    G+K  LG W++ +D  +   +R  GCM GR MY+IPFSMGP+ S L+K G+Q+TDS YVV  M IMTR+   V   L+  A FV+C HSVG P P    ++N WPCNPEK LI+HLPD R I+S+GSGYGGNSLLGKKCFALRIA RIA DEGW+AEHMLI+ +TNP+G +++IAAAFPSACGKTN+AM++P LPGWKV+ VGDDIAWM+FD  G LRAINPE GFFGVAPGT+ KTNP+AM+T  +N++FTNV ET+DG  +WEG+E    P +++T W G   K GD +    AHPNSRFC PA QCPII P WE  +GVPI AIVFGGRRPEG+PLV ++F+W+HGV +GA+++SE+TAAAE KGK IMHDP AMRPF GYNFG YL HWL +E  K   ++P IFHVNWFR +++ G F+WPGFG+N RV++W+   C R +  + A  S +G +P+ G+++  GL  ++    +F+LPK +  ++ QE + +  +Q G DLPA V  +L   E+R+ +
Sbjct:   31 LPPSVAEFVSGAAAECKPAKVHVVTGTPEETADLLANLEKEGMVKKLAKYENCWLARTDPKDVARVESKTVIVTKNQRDTIPIPSGGAKSQLGSWMSEQDFQKAREDRFPGCMAGRTMYVIPFSMGPVNSSLAKFGVQVTDSPYVVASMGIMTRMGTPVMEKLAQGAEFVRCQHSVGRPLPLKGPLVNSWPCNPEKVLISHLPDTRQILSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYIAAAFPSACGKTNLAMMKPSLPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSLKTNPHAMETISRNTVFTNVGETSDGGVWWEGLEPPA-PGIKLTDWHGKSWKYGDSTL--CAHPNSRFCAPAGQCPIIDPLWESDEGVPIDAIVFGGRRPEGVPLVYESFNWRHGVFVGAAMRSESTAAAEHKGKVIMHDPFAMRPFFGYNFGDYLSHWLSMETRKGPTQLPKIFHVNWFRKDQKTGSFLWPGFGENARVLEWIFKRCGRTSENEAATKSIVGWIPQNGAINTEGLGGNIDMGALFDLPKPFWQKETQELRTYFNQQVGADLPAQVEGELKALEERVRD 636          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Zebrafish
Match: pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:ZFIN;Acc:ZDB-GENE-040426-2266])

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 334/609 (54.84%), Postives = 437/609 (71.76%), Query Frame = 2
Query:  167 LPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNA-FVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE--KPGRKMPLIFHVNWFRLNEQ-GKFVWPGFGDNIRVIDWM---CRRVNGEDIAEPSPIGLLPKKGSLDISGL--DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHN 1966
            LP  V  F++  A  CKP  +++  G  +E  +++  L++ G +  L K EN ++ RTDP DVARVESKT I TKN+  T+P    G K  LG W++ +D  +   +R  GCM GR MY+IPFSMGP+ S L+K G+Q+TDS YVV  M IMTR+   V   L+  A FV+C HSVG P P    ++N WPCNPEK LI+HLPD R I+S+GSGYGGNSLLGKKCFALRIA RIA DEGW+AEHMLI+ +TNP+G +++IAAAFPSACGKTN+AM++P LPGWKV+ VGDDIAWM+FD  G LRAINPE GFFGVAPGT+ KTNP+AM+T  +N++FTNV ET+DG  +WEG+E    P +++T W G   K GD +    AHPNSRFC PA QCPII P WE  +GVPI AIVFGGRRPEG+PLV ++F+W+HGV +GA+++SE+TAAAE KGK IMHDP AMRPF GYNFG YL HWL +E  K   ++P IFHVNWFR +++ G F+WPGFG+N RV++W+   C R +  + A  S +G +P+ G+++  GL  ++    +F+LPK +  ++ QE + +  +Q G DLPA V  +L   E+R+ +
Sbjct:   31 LPPSVAEFVSGAAAECKPAKVHVVTGTPEETADLLANLEKEGMVKKLAKYENCWLARTDPKDVARVESKTVIVTKNQRDTIPIPSGGVKSQLGSWMSEQDFQKAREDRFPGCMAGRTMYVIPFSMGPVNSSLAKFGVQVTDSPYVVASMGIMTRMGTPVMEKLAQGAEFVRCQHSVGRPLPLKGPLVNSWPCNPEKVLISHLPDTRQILSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYIAAAFPSACGKTNLAMMKPSLPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSLKTNPHAMETISRNTVFTNVGETSDGGVWWEGLEPPA-PGIKLTDWHGKSWKYGDSTL--CAHPNSRFCAPAGQCPIIDPLWESDEGVPIDAIVFGGRRPEGVPLVYESFNWRHGVFVGAAMRSESTAAAEHKGKVIMHDPFAMRPFFGYNFGDYLSHWLSMETRKGPTQLPKIFHVNWFRKDQKTGSFLWPGFGENARVLEWIFKRCGRTSENEAATKSIVGWIPQNGAINTEGLGGNIDMGALFDLPKPFWQKETQELRTYFNQQVGADLPAQVEGELKALEERVRD 636          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Xenopus
Match: gca (grancalcin [Source:Xenbase;Acc:XB-GENE-983090])

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 365/603 (60.53%), Postives = 452/603 (74.96%), Query Frame = 2
Query:  167 LPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEK-PGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            LP  V+ F+ K A +C P+ ++ICDG   E   I+T L++ G L  L K  N ++ RTDP DVARVESKT I T+N   TVP    G KG LG W++P+D     AER  GCM GR MY++PFSMGP+GSPLSK G+QLTDS YVV  MRIMTR+   V   L D  FVKC+HSVG P P    ++N WPCNPEKT+IAH+PD R I+S+GSGYGGNSLLGKKCFALRIA RIA DEGW+AEHMLI+ +TNP G +++IAAAFPSACGKTN+AM+ P LPGWKVQ VGDDIAWM+FD  G LRAINPE GFFGVAPGT+ KTNPNA+ T ++N+IFTNVAET+DG  YWEG+++ + P + VTSWLG   K GDK   P AHPNSRFC PA+QCPI+   WE P+GVPI AI+FGGRRPEG+PLV ++++W HGV +GAS++SEATAAAE KGK IMHDP AMRPF GYNFG+YL HWL L+K PG ++P IFHVNWFR +  G F+WPGFG+N RV+DW+ RRV GE+ A  S IG LP +G+L++ GL  V    +F+LPK +  +++Q+  K+L EQ  +DLP  ++++L   E R+  M
Sbjct:    4 LPPAVREFVVKGAELCDPQNIHICDGSATENETIVTVLQQEGMLKKLHKYPNCWLARTDPKDVARVESKTVIVTENMRDTVPIPTTGVKGQLGNWMSPQDFERAKAERFPGCMRGRTMYVLPFSMGPVGSPLSKYGVQLTDSPYVVASMRIMTRMGSQVLDALGDGEFVKCLHSVGQPLPLKAPLVNSWPCNPEKTIIAHVPDSREIVSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPAGRKRYIAAAFPSACGKTNLAMMRPSLPGWKVQCVGDDIAWMKFDSEGRLRAINPENGFFGVAPGTSAKTNPNALSTVERNTIFTNVAETSDGGVYWEGLDQPLPPGVTVTSWLGKSWKPGDKE--PCAHPNSRFCAPAAQCPIMDDAWESPEGVPIDAIIFGGRRPEGVPLVYESYNWNHGVFVGASMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGQYLSHWLSLQKRPGLQLPKIFHVNWFRKDADGGFLWPGFGENARVLDWIFRRVEGEESARQSAIGYLPAEGALNLQGLGGVDTNALFSLPKGFWEKEVQDVGKYLTEQVTDDLPPQIMEELRGLEGRVKQM 604          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Xenopus
Match: slc5a6 (solute carrier family 5 (sodium/multivitamin and iodide cotransporter), member 6 [Source:Xenbase;Acc:XB-GENE-5737332])

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 353/611 (57.77%), Postives = 463/611 (75.78%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEK-PGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            + +G+ + L   VQ FI   A +C+P  ++ICDG E+E  +++  ++E G +  L K EN ++ RTDP DVAR+ESKT I T+ +  TVP  K G +  LG+W++ ED  +    R  GCM GR MY+IPFSMGPIGSPLSKIGI+LTDS YVV  MRIMTR+   V   L D  FVKC+HSVGCP P  + ++N+WPCNPE+TLIAH+P++R IIS+GSGYGGNSLLGKKCFALRIA RIA +EGW+AEHMLI+ +TNP+GE+K+ AAAFPSACGKTN+AM++P +PGWK++ VGDDIAWM+FDEHG LRAINPE GFFGVAPGT+ KTNP AM+T + N++FTNV ET+DG  YWEG+ + +DP + +TSW   +    D    P AHPNSRFC PASQCPII P+WE  +GVPI  I+FGGRRP G+PLV +A +W+HGV +G++++SEATAAAE KGK IMHDP AMRPF GYNFG+YL HWL +E  P  KMP IFHVNWFR +++  F+WPG+G+NIRV++WM +R+NGED A+ +PIG +P +G+L++ GL DV  EE+F L K +  +++++ KK+L +Q   DLP  + ++L   E+R+  +
Sbjct:   15 VKQGNLNRLSPAVQNFILANAKICQPDYIHICDGSEEENKKLLHLMEETGMIRRLHKYENCWLARTDPQDVARIESKTVIVTQEQRDTVPLAKSG-QSQLGRWMSEEDFKKAFKSRFPGCMKGRTMYVIPFSMGPIGSPLSKIGIELTDSPYVVASMRIMTRMGTAVLETLGDGEFVKCLHSVGCPLPLKKPLVNNWPCNPEQTLIAHIPEQREIISFGSGYGGNSLLGKKCFALRIASRIAKEEGWLAEHMLILGITNPEGEKKYFAAAFPSACGKTNLAMMKPSVPGWKIECVGDDIAWMKFDEHGNLRAINPENGFFGVAPGTSAKTNPYAMETIRNNTVFTNVGETSDGGIYWEGINESLDPGVTLTSWKNKEWTPEDGE--PCAHPNSRFCTPASQCPIIDPEWESQEGVPIEGIIFGGRRPTGVPLVYEALNWQHGVFVGSAMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGKYLAHWLSMEHLPSTKMPKIFHVNWFRKDKESNFLWPGYGENIRVLEWMFKRINGEDCAKETPIGYIPAEGALNLKGLGDVNVEELFELSKEFWEDEVKDIKKYLDDQVNADLPYEIERELSALEERLKQL 622          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Xenopus
Match: gca (grancalcin [Source:Xenbase;Acc:XB-GENE-983090])

HSP 1 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 348/603 (57.71%), Postives = 433/603 (71.81%), Query Frame = 2
Query:  167 LPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEK-PGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            LP  V+ F+ K A +C P+ ++ICDG   E   I+T L++ G L  L K  N ++ RTDP DVARVESKT I T+N   TVP    G KG LG W++P+D     AER  GCM GR MY++PFSMGP+GSPLSK G+QLTDS YVV  MRIMTR+   V   L D  FVKC+HSVG P P    ++N WPCNPEKT+IAH+PD R I+S+GSGYGGNSLLGKKCFALRIA RIA DEGW+AEHMLI+ +TNP G +++IAAAFPSACGKTN+AM+ P LPGWKVQ VGDDIAWM+FD  G LRAINPE GFFGVAPGT+ KTNPNA+ T ++N+IFTNVAET+DG  YWEG+++ + P + VTSWLG   K GDK   P AHPNSRFC PA+QCPI+   WE P+GVPI AI+FGGRRPE +       +    V+L   + S    ++   GK IMHDP AMRPF GYNFG+YL HWL L+K PG ++P IFHVNWFR +  G F+WPGFG+N RV+DW+ RRV GE+ A  S IG LP +G+L++ GL  V    +F+LPK +  +++Q+  K+L EQ  +DLP  ++++L   E R+  M
Sbjct:    4 LPPAVREFVVKGAELCDPQNIHICDGSATENETIVTVLQQEGMLKKLHKYPNCWLARTDPKDVARVESKTVIVTENMRDTVPIPTTGVKGQLGNWMSPQDFERAKAERFPGCMRGRTMYVLPFSMGPVGSPLSKYGVQLTDSPYVVASMRIMTRMGSQVLDALGDGEFVKCLHSVGQPLPLKAPLVNSWPCNPEKTIIAHVPDSREIVSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPAGRKRYIAAAFPSACGKTNLAMMRPSLPGWKVQCVGDDIAWMKFDSEGRLRAINPENGFFGVAPGTSAKTNPNALSTVERNTIFTNVAETSDGGVYWEGLDQPLPPGVTVTSWLGKSWKPGDKE--PCAHPNSRFCAPAAQCPIMDDAWESPEGVPIDAIIFGGRRPEDMLYYSSYKNAWSTVILFMYVFSLLYFSS--TGKVIMHDPFAMRPFFGYNFGQYLSHWLSLQKRPGLQLPKIFHVNWFRKDADGGFLWPGFGENARVLDWIFRRVEGEESARQSAIGYLPAEGALNLQGLGGVDTNALFSLPKGFWEKEVQDVGKYLTEQVTDDLPPQIMEELRGLEGRVKQM 602          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Match: Pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:MGI Symbol;Acc:MGI:1860456])

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 360/611 (58.92%), Postives = 470/611 (76.92%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            +  GD   LP  V+ F+A+ A +C+P  ++ICDG E E T I+  L+E+G +  L K +N ++ RTDP DVARVESKT I T ++  TVP +  G++G LG W++P++    V ER  GCM GR+MY++PFSMGP+GSPLS+IG+QLTDS YVV  MRIMTR+   V   L D  F+KC+HSVG P       +  WPCNPEKTLI H+PD+R I+S+GSGYGGNSLLGKKCFALRIA R+A DEGW+AEHMLI+ +TNP G+++++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWMRFD  G LRAINPE GFFGVAPGT+  TNPNAM T Q N++FTNVAET+DG  YWEG+++ + P + +TSWLG   K GDK   P AHPNSRFC PA QCPI+ P WE P+GVPI AI+FGGRRP+G+PLV +AF+W+HGV +G++++SE+TAAAE KGK IMHDP AMRPF GYNFGRYL+HWL +E + G ++P IFHVNWFR +E G+F+WPGFG+N RV+DW+CRR+ GED A+ +PIGL+PK+G+LD+SGL  V   ++F++PK++  +++++ + +L EQ  +DLP  V+ +L+  E R+  M
Sbjct:   59 VLSGDMSQLPAGVRDFVARSAHLCQPEGIHICDGTEAENTAILALLEEQGLIRKLPKYKNCWLARTDPKDVARVESKTVIVTPSQRDTVPLLAGGARGQLGNWMSPDEFQRAVDERFPGCMQGRIMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFIKCLHSVGQPLTGHGDPVGQWPCNPEKTLIGHVPDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAATNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLPPGVTITSWLGKPWKPGDKE--PCAHPNSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKTIMHDPFAMRPFFGYNFGRYLEHWLSMEGQKGARLPRIFHVNWFRRDEAGRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGLSAVDTSQLFSIPKDFWEQEVRDIRGYLTEQVNQDLPKEVLAELEALEGRVQKM 667          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Match: Pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:MGI Symbol;Acc:MGI:1860456])

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 360/611 (58.92%), Postives = 470/611 (76.92%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            +  GD   LP  V+ F+A+ A +C+P  ++ICDG E E T I+  L+E+G +  L K +N ++ RTDP DVARVESKT I T ++  TVP +  G++G LG W++P++    V ER  GCM GR+MY++PFSMGP+GSPLS+IG+QLTDS YVV  MRIMTR+   V   L D  F+KC+HSVG P       +  WPCNPEKTLI H+PD+R I+S+GSGYGGNSLLGKKCFALRIA R+A DEGW+AEHMLI+ +TNP G+++++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWMRFD  G LRAINPE GFFGVAPGT+  TNPNAM T Q N++FTNVAET+DG  YWEG+++ + P + +TSWLG   K GDK   P AHPNSRFC PA QCPI+ P WE P+GVPI AI+FGGRRP+G+PLV +AF+W+HGV +G++++SE+TAAAE KGK IMHDP AMRPF GYNFGRYL+HWL +E + G ++P IFHVNWFR +E G+F+WPGFG+N RV+DW+CRR+ GED A+ +PIGL+PK+G+LD+SGL  V   ++F++PK++  +++++ + +L EQ  +DLP  V+ +L+  E R+  M
Sbjct:   32 VLSGDMSQLPAGVRDFVARSAHLCQPEGIHICDGTEAENTAILALLEEQGLIRKLPKYKNCWLARTDPKDVARVESKTVIVTPSQRDTVPLLAGGARGQLGNWMSPDEFQRAVDERFPGCMQGRIMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFIKCLHSVGQPLTGHGDPVGQWPCNPEKTLIGHVPDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAATNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLPPGVTITSWLGKPWKPGDKE--PCAHPNSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKTIMHDPFAMRPFFGYNFGRYLEHWLSMEGQKGARLPRIFHVNWFRRDEAGRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGLSAVDTSQLFSIPKDFWEQEVRDIRGYLTEQVNQDLPKEVLAELEALEGRVQKM 640          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Match: Pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:MGI Symbol;Acc:MGI:1860456])

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 349/577 (60.49%), Postives = 449/577 (77.82%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAED 1867
            +  GD   LP  V+ F+A+ A +C+P  ++ICDG E E T I+  L+E+G +  L K +N ++ RTDP DVARVESKT I T ++  TVP +  G++G LG W++P++    V ER  GCM GR+MY++PFSMGP+GSPLS+IG+QLTDS YVV  MRIMTR+   V   L D  F+KC+HSVG P       +  WPCNPEKTLI H+PD+R I+S+GSGYGGNSLLGKKCFALRIA R+A DEGW+AEHMLI+ +TNP G+++++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWMRFD  G LRAINPE GFFGVAPGT+  TNPNAM T Q N++FTNVAET+DG  YWEG+++ + P + +TSWLG   K GDK   P AHPNSRFC PA QCPI+ P WE P+GVPI AI+FGGRRP+G+PLV +AF+W+HGV +G++++SE+TAAAE KGK IMHDP AMRPF GYNFGRYL+HWL +E + G ++P IFHVNWFR +E G+F+WPGFG+N RV+DW+CRR+ GED A+ +PIGL+PK+G+LD+SGL  V   ++F++PK++  ++
Sbjct:   32 VLSGDMSQLPAGVRDFVARSAHLCQPEGIHICDGTEAENTAILALLEEQGLIRKLPKYKNCWLARTDPKDVARVESKTVIVTPSQRDTVPLLAGGARGQLGNWMSPDEFQRAVDERFPGCMQGRIMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFIKCLHSVGQPLTGHGDPVGQWPCNPEKTLIGHVPDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAATNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLPPGVTITSWLGKPWKPGDKE--PCAHPNSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKTIMHDPFAMRPFFGYNFGRYLEHWLSMEGQKGARLPRIFHVNWFRRDEAGRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGLSAVDTSQLFSIPKDFWEQE 606          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Match: Pck1 (phosphoenolpyruvate carboxykinase 1, cytosolic [Source:MGI Symbol;Acc:MGI:97501])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 350/611 (57.28%), Postives = 456/611 (74.63%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDL-EKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            + +G    LP+ V+ F+   A +C+P  ++ICDG E+E  +++  ++E G +  L K +N ++  TDP DVAR+ESKT I T+ +  TVP  K G    LG+W++ ED  +    R  GCM GR MY+IPFSMGP+GSPL+KIGI+LTDS YVV  MRIMTR+   V   L D  F+KC+HSVGCP P  + ++N+W CNPE TLIAHLPD R IIS+GSGYGGNSLLGKKCFALRIA R+A +EGW+AEHMLI+ +TNP+G++K++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWM+FD  G LRAINPE GFFGVAPGT+ KTNPNA+KT QKN+IFTNVAET+DG  YWEG+++ + P + +TSW   + +  D    P AHPNSRFC PASQCPII P WE P+GVPI  I+FGGRRPEG+PLV +A  W+HGV +GA+++SEATAAAE KGK IMHDP AMRPF GYNFG+YL HWL +  +P  K+P IFHVNWFR ++ GKF+WPGFG+N RV++WM  R+ GED A+ +PIG +PK+ +L++ GL  V  EE+F + K +  ++++E  ++L +Q   DLP  + ++L   ++RI  M
Sbjct:   15 VIQGSLDSLPQAVRKFVEGNAQLCQPEYIHICDGSEEEYGQLLAHMQEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKTGLSQ-LGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGISVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDAE--PCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGRRPEGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPFAMRPFFGYNFGKYLAHWLSMAHRPAAKLPKIFHVNWFRKDKDGKFLWPGFGENSRVLEWMFGRIEGEDSAKLTPIGYIPKENALNLKGLGGVNVEELFGISKEFWEKEVEEIDRYLEDQVNTDLPYEIERELRALKQRISQM 622          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Match: Pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:MGI Symbol;Acc:MGI:1860456])

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 342/611 (55.97%), Postives = 441/611 (72.18%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            +  GD   LP  V+ F+A+ A +C+P  ++ICDG E E T I+  L+E+G +  L K +N ++ RTDP DVARVESKT I T ++  TVP +  G++G LG W++P++    V ER  GCM GR+MY++PFSMGP+GSPLS+IG+QLTDS YVV  MRIMTR+   V   L D  F+KC+HSVG P       +  WPCNPEKTLI H+PD+R I+S+GSGYGGNSLLGKKCFALRIA R+A DEGW+AEHMLI+ +TNP G+++++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWMRFD  G LRAINPE GFFGVAPGT+  TNPNAM T Q N++FTNVAET+DG  YWEG+++ + P + +TSWLG   K GDK   P AHPNSRFC PA QCPI+ P WE P+GVPI AI+FGGRRP                                KGK IMHDP AMRPF GYNFGRYL+HWL +E + G ++P IFHVNWFR +E G+F+WPGFG+N RV+DW+CRR+ GED A+ +PIGL+PK+G+LD+SGL  V   ++F++PK++  +++++ + +L EQ  +DLP  V+ +L+  E R+  M
Sbjct:   23 VLSGDMSQLPAGVRDFVARSAHLCQPEGIHICDGTEAENTAILALLEEQGLIRKLPKYKNCWLARTDPKDVARVESKTVIVTPSQRDTVPLLAGGARGQLGNWMSPDEFQRAVDERFPGCMQGRIMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFIKCLHSVGQPLTGHGDPVGQWPCNPEKTLIGHVPDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAATNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLPPGVTITSWLGKPWKPGDKE--PCAHPNSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRP--------------------------------KGKTIMHDPFAMRPFFGYNFGRYLEHWLSMEGQKGARLPRIFHVNWFRRDEAGRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGLSAVDTSQLFSIPKDFWEQEVRDIRGYLTEQVNQDLPKEVLAELEALEGRVQKM 599          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Match: sp|P29190|PCKG_HAECO (Phosphoenolpyruvate carboxykinase [GTP] OS=Haemonchus contortus OX=6289 GN=PEPCK PE=2 SV=1)

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 400/615 (65.04%), Postives = 482/615 (78.37%), Query Frame = 2
Query:  128 LGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEV-DPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGE-DIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIH 1963
            LGH+PI KGD+H LP KVQ F+A+ A + +PR +YICDG + EA EII KL ERG L  L   EN++ICRTDP DVARVESKT++ T +K+ TV H  +G + I+G W++P+ L  E+  R  GCM GR+MY+IPFSMGP+G PLSKIG+QLTDSNYVVL MRIMTRV   VW  L DN FV+C+HSVG PRP  ++VINHWPCNPE+ LIAH P ER I S+GSGYGGNSLLGKK  ALRIA  IA DEGWMAEHMLIM VT P G+E FIAAAFPSACGKTN+AMLEP LPGWKV+ VGDDIAWM+F E G L AINPE GFFGVAPGT+ KTNP A+ TFQKNSIFTNV ET +G Y+WEG+E E+ D N+++ +WLG K ++GD   G  AHPNSRF  PASQCPIIHP+WE P+GVPI AI+FGGRRP G+PLV +   W HG+  GA LKSEATAAAE KGK +MHDPMAMRPFMGYNFG YLQHW+DL K GRK+P I+HVNWFR +   KF+WPG+G NIRVIDW+ RR++GE DI   +PIG++PKKG+++ SGL D++W+E+ ++PK Y   D +E +KFL EQ G DLP  +  ++D QE+RI+
Sbjct:    4 LGHVPIHKGDFHLLPPKVQRFVAEKAELMRPRGIYICDGSQHEADEIIDKLIERGMLSPLKAYENNYICRTDPKDVARVESKTWMVTPDKYQTVCHTPDGIEPIMGHWMSPDSLATELDSRFPGCMAGRIMYVIPFSMGPVGGPLSKIGVQLTDSNYVVLSMRIMTRVGHEVWDALGDNDFVRCIHSVGLPRPVKQRVINHWPCNPERVLIAHRPAEREIWSFGSGYGGNSLLGKKMLALRIASNIAKDEGWMAEHMLIMGVTRPDGKEHFIAAAFPSACGKTNLAMLEPALPGWKVRCVGDDIAWMKFGEDGRLYAINPEYGFFGVAPGTSKKTNPMAVATFQKNSIFTNVGETANGEYFWEGLEDEIKDKNVDMINWLGEKWRIGD--PGLCAHPNSRFAAPASQCPIIHPEWESPKGVPIDAIIFGGRRPAGVPLVFETRSWLHGIFTGACLKSEATAAAEHKGKTVMHDPMAMRPFMGYNFGHYLQHWIDLNKDGRKVPKIYHVNWFRRDANNKFLWPGYGQNIRVIDWIVRRLDGEPDIGVDTPIGIVPKKGAINASGLPDIQWDELMSVPKEYWTNDAKEIRKFLEEQVGPDLPKEIRAEMDAQEERIN 616          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Match: sp|Q05893|PCKG_ASCSU (Phosphoenolpyruvate carboxykinase [GTP] OS=Ascaris suum OX=6253 GN=PEPCK PE=2 SV=1)

HSP 1 Score: 788.104 bits (2034), Expect = 0.000e+0
Identity = 390/627 (62.20%), Postives = 491/627 (78.31%), Query Frame = 2
Query:  104 VHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDN--AFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEV-DPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGE-DIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            V EVV     H+P+ KGD+  LPK VQ F+A+ A + KP A++ICDG ++EA E+I +  ERG L  L   +N+++CRTDP DVARVESKT++ T  K+ +V H  EG K ++GQW++P++  +E+ +R  GCM GR MY+IP+SMGP+G PLSKIGI+LTDS+YVVLCMRIMTR+   V   L+ N   FV+CVHSVG P+P   KVINHWPCNPEKT+IAH P ER I S+GSGYGGNSLLGKKCFALRIA  I YDEGWMAEHMLIM VT+PKGEE+F+AAAFPSACGKTN+AMLEP +PGWKV+V+GDDIAWM+F   G L AINPE GFFGVAPGT++KTNP AM +FQ+N+IFTNVAET DG Y+WEG+E EV +P +++ +WLG    +GD+SK  AAHPNSRF  PA QCPIIHP WE P+GVPI AI+FGGRRPEG+PLV ++  W HG+ +GA +KSEATAAAE  GKQ+MHDPMAMRPFMGYNFGRY++HW+ L +P  K+P IFHVNWFR +   KF+WPG+GDNIRVIDW+ RR +G+  IAE +PIG +PKKG++++ GL +V W+E+ ++PK+Y  ED+ ETK F   Q G DLP  + ++L+ Q +RI  +
Sbjct:   17 VSEVVTHKQNHIPVIKGDFVSLPKHVQRFVAEKAELMKPSAIFICDGSQNEADELIARCVERGVLVPLKAYKNNYLCRTDPRDVARVESKTWMITPEKYDSVCHTPEGVKPMMGQWMSPDEFGKELDDRFPGCMAGRTMYVIPYSMGPVGGPLSKIGIELTDSDYVVLCMRIMTRMGEPVLKALAKNNGEFVRCVHSVGQPKPVATKVINHWPCNPEKTIIAHRPAEREIWSFGSGYGGNSLLGKKCFALRIAMNIGYDEGWMAEHMLIMGVTSPKGEERFVAAAFPSACGKTNLAMLEPTIPGWKVRVIGDDIAWMKFGADGRLYAINPEYGFFGVAPGTSHKTNPMAMASFQENTIFTNVAETADGEYFWEGLEHEVKNPKVDMINWLGEPWHIGDESK--AAHPNSRFTAPAGQCPIIHPDWEKPEGVPIDAIIFGGRRPEGVPLVFESRSWVHGIFVGACVKSEATAAAEHTGKQVMHDPMAMRPFMGYNFGRYMRHWMKLGQPPHKVPKIFHVNWFRQSADHKFLWPGYGDNIRVIDWILRRCSGDATIAEETPIGFIPKKGTINLEGLPNVNWDELMSIPKSYWLEDMVETKTFFENQVGSDLPPEIAKELEAQTERIKAL 641          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Match: sp|Q8BH04|PCKGM_MOUSE (Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Mus musculus OX=10090 GN=Pck2 PE=1 SV=1)

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 360/611 (58.92%), Postives = 470/611 (76.92%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            +  GD   LP  V+ F+A+ A +C+P  ++ICDG E E T I+  L+E+G +  L K +N ++ RTDP DVARVESKT I T ++  TVP +  G++G LG W++P++    V ER  GCM GR+MY++PFSMGP+GSPLS+IG+QLTDS YVV  MRIMTR+   V   L D  F+KC+HSVG P       +  WPCNPEKTLI H+PD+R I+S+GSGYGGNSLLGKKCFALRIA R+A DEGW+AEHMLI+ +TNP G+++++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWMRFD  G LRAINPE GFFGVAPGT+  TNPNAM T Q N++FTNVAET+DG  YWEG+++ + P + +TSWLG   K GDK   P AHPNSRFC PA QCPI+ P WE P+GVPI AI+FGGRRP+G+PLV +AF+W+HGV +G++++SE+TAAAE KGK IMHDP AMRPF GYNFGRYL+HWL +E + G ++P IFHVNWFR +E G+F+WPGFG+N RV+DW+CRR+ GED A+ +PIGL+PK+G+LD+SGL  V   ++F++PK++  +++++ + +L EQ  +DLP  V+ +L+  E R+  M
Sbjct:   32 VLSGDMSQLPAGVRDFVARSAHLCQPEGIHICDGTEAENTAILALLEEQGLIRKLPKYKNCWLARTDPKDVARVESKTVIVTPSQRDTVPLLAGGARGQLGNWMSPDEFQRAVDERFPGCMQGRIMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFIKCLHSVGQPLTGHGDPVGQWPCNPEKTLIGHVPDQREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGQLRAINPENGFFGVAPGTSAATNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLPPGVTITSWLGKPWKPGDKE--PCAHPNSRFCVPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKTIMHDPFAMRPFFGYNFGRYLEHWLSMEGQKGARLPRIFHVNWFRRDEAGRFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGLSAVDTSQLFSIPKDFWEQEVRDIRGYLTEQVNQDLPKEVLAELEALEGRVQKM 640          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Match: sp|Q16822|PCKGM_HUMAN (Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=4)

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 361/611 (59.08%), Postives = 465/611 (76.10%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            +  GD   LP  ++ F+   A +C+P  ++ICDG E E T  +T L+++G +  L K  N ++ RTDP DVARVESKT I T ++  TVP    G++G LG W++P D    V ER  GCM GR MY++PFSMGP+GSPLS+IG+QLTDS YVV  MRIMTR+   V   L D  FVKC+HSVG P     + ++ WPCNPEKTLI H+PD+R IIS+GSGYGGNSLLGKKCFALRIA R+A DEGW+AEHMLI+ +T+P G+++++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWMRFD  G LRAINPE GFFGVAPGT+  TNPNAM T Q N+IFTNVAET+DG  YWEG+++ + P + VTSWLG   K GDK   P AHPNSRFC PA QCPI+ P WE P+GVPI AI+FGGRRP+G+PLV +AF+W+HGV +G++++SE+TAAAE KGK IMHDP AMRPF GYNFG YL+HWL +E + G ++P IFHVNWFR +E G F+WPGFG+N RV+DW+CRR+ GED A  +PIGL+PK+G+LD+SGL  +   ++F+LPK++  +++++ + +L EQ  +DLP  V+ +L+  E+R+H M
Sbjct:   32 VLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTVPLPPGGARGQLGNWMSPADFQRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGFFGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKE--PCAHPNSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKGKIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRRDEAGHFLWPGFGENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM 640          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Match: sp|P07379|PCKGC_RAT (Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Rattus norvegicus OX=10116 GN=Pck1 PE=1 SV=1)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 351/611 (57.45%), Postives = 458/611 (74.96%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDL-EKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL-DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            + +G    LP++V+ F+   A +C+P  ++ICDG E+E   ++  ++E G +  L K +N ++  TDP DVAR+ESKT I T+ +  TVP  K G +  LG+W++ ED  +    R  GCM GR MY+IPFSMGP+GSPL+KIGI+LTDS YVV  MRIMTR+   V   L D  F+KC+HSVGCP P  + ++N+W CNPE TLIAHLPD R IIS+GSGYGGNSLLGKKCFALRIA R+A +EGW+AEHMLI+ +TNP+G++K++AAAFPSACGKTN+AM+ P LPGWKV+ VGDDIAWM+FD  G LRAINPE GFFGVAPGT+ KTNPNA+KT QKN+IFTNVAET+DG  YWEG+++ + P + +TSW   + +  D+   P AHPNSRFC PASQCPII P WE P+GVPI  I+FGGRRP G+PLV +A  W+HGV +GA+++SEATAAAE KGK IMHDP AMRPF GYNFG+YL HWL +  +P  K+P IFHVNWFR ++ GKF+WPGFG+N RV++WM  R+ GED A+ +PIG +PK+ +L++ GL DV  EE+F + K +  ++++E  K+L +Q   DLP  + ++L   ++RI  M
Sbjct:   15 VIQGSLDSLPQEVRKFVEGNAQLCQPEYIHICDGSEEEYGRLLAHMQEEGVIRKLKKYDNCWLALTDPRDVARIESKTVIITQEQRDTVPIPKSG-QSQLGRWMSEEDFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLAKIGIELTDSPYVVASMRIMTRMGTSVLEALGDGEFIKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSLLGKKCFALRIASRLAKEEGWLAEHMLILGITNPEGKKKYLAAAFPSACGKTNLAMMNPTLPGWKVECVGDDIAWMKFDAQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAPGVTITSWKNKEWRPQDEE--PCAHPNSRFCTPASQCPIIDPAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPFAMRPFFGYNFGKYLAHWLSMAHRPAAKLPKIFHVNWFRKDKNGKFLWPGFGENSRVLEWMFGRIEGEDSAKLTPIGYVPKEDALNLKGLGDVNVEELFGISKEFWEKEVEEIDKYLEDQVNADLPYEIERELRALKQRISQM 622          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Match: G7Y999 (Phosphoenolpyruvate carboxykinase (GTP) OS=Clonorchis sinensis OX=79923 GN=CLF_103208 PE=3 SV=1)

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 460/635 (72.44%), Postives = 542/635 (85.35%), Query Frame = 2
Query:   65 EMIWENDTEIPQEVHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDN-AFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHN 1966
            +M+W  +     E+H++++PHLG +P+ KGD+  LP + Q FI KW  +CKPR LYICDG   EA+EII KL ERGTLH LT  E ++ICRTDPDDVARVES+T+I + NK   VPHV EG KG+LGQW+APE+L+  + +R+ GCM GRMMY+IPFSMGP+GSPLSK+GIQLTDSNYVVLCMRIMTRV P VW  + ++  FVKCVHS+GCPRP  RKVINHWPCNPEKT+I H+PDER+IISYGSGYGGNSLLGKKCFALRIAG +AYDEGWMAEHMLIMSVT+P+G+E FIAAAFPSACGKTNMAMLEP LPGWK+Q VGDDIAWMRFDE+GVL AINPE GFFGVAPGTN KTNPNA+ T  KN+IFTNVAE+ DG ++WEG+E E DP+ E+ +WLG ++K+ DK+  P AHPNSRFCCPASQCPIIHP WE+P+GVPISAIVFGGRRPEGIPLV+QAF+WKHGVMLGASLKSEATAAAEFKGK +MHDPMAMRPF+GYNFG+YLQHWLDLEKPGRKMPLIFHVNWFRLN+QGKF+WPGFGDNIRVI+WM R V GED+  PSPIGLLPK+G++++SGL+  W+ +F+LPK+YL EDIQET K+L +Q G D P  +   L+EQ++RI  
Sbjct:  124 KMLWREEDNPCYEIHQIIVPHLGQVPVAKGDFSSLPPEAQSFIGKWVGICKPRGLYICDGSHWEASEIIQKLCERGTLHRLTAYEENYICRTDPDDVARVESRTWICSPNKFSIVPHVSEGVKGMLGQWMAPEELDAALRDRMPGCMTGRMMYVIPFSMGPVGSPLSKVGIQLTDSNYVVLCMRIMTRVCPDVWEVMVNHHEFVKCVHSMGCPRPSTRKVINHWPCNPEKTIITHIPDERMIISYGSGYGGNSLLGKKCFALRIAGSMAYDEGWMAEHMLIMSVTSPEGKEHFIAAAFPSACGKTNMAMLEPSLPGWKIQCVGDDIAWMRFDENGVLHAINPEYGFFGVAPGTNRKTNPNAIATCMKNTIFTNVAESVDGRFFWEGLEDEFDPDTEIITWLGHRVKLSDKTHDPKAHPNSRFCCPASQCPIIHPAWENPKGVPISAIVFGGRRPEGIPLVLQAFNWKHGVMLGASLKSEATAAAEFKGKVVMHDPMAMRPFVGYNFGKYLQHWLDLEKPGRKMPLIFHVNWFRLNKQGKFLWPGFGDNIRVIEWMLRCVQGEDVTVPSPIGLLPKEGTINMSGLNSDWKAIFDLPKDYLLEDIQETTKYLEDQVGSDTPKEIRHLLEEQKERIRT 758          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Match: A0A074ZKX7 (Phosphoenolpyruvate carboxykinase OS=Opisthorchis viverrini OX=6198 GN=T265_05309 PE=3 SV=1)

HSP 1 Score: 959.133 bits (2478), Expect = 0.000e+0
Identity = 460/632 (72.78%), Postives = 541/632 (85.60%), Query Frame = 2
Query:   68 MIWENDTEIPQEVHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDN-AFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRI 1960
            M+W  +     E+H++++PHLG +P+ KGD+  LP + Q FI KW  +CKPR LYICDG   EA+EII KL ERGTLH L   E ++ICRTDPDDVARVES+T+I + NK   VPHV EG KG+LGQW++PE+L+  + +R+ GCM GRMMY+IPFSMGP+GSPLSK+GIQLTDSNYVVLCMRIMTRV P VW  + ++  FVKCVHS+GCPRP  RKVINHWPCNPEKT+I H+PDER+IISYGSGYGGNSLLGKKCFALRIAG +AYDEGWMAEHMLIMSVT+P+G+E FIAAAFPSACGKTNMAMLEP LPGWK+Q VGDDIAWMRFDE+GVL AINPE GFFGVAPGTN KTNPNA+ T  KN+IFTN+AE+ DG ++WEG+E E DP+ E+ +WLG ++K+ DKS  P AHPNSRFCCPASQCPIIHP WE+P+GVPISAIVFGGRRPEGIPLVMQAF+WKHGVMLGASLKSEATAAAEFKGK +MHDPMAMRPF+GYNFG+YLQHWLDLEKPGRKMPLIFHVNWFRLN+QGKF+WPGFGDNIRVI+WM R V GED+  PSPIGLLPK+G++++SGL+  W+ +F+LPK+YL EDIQET K+L +Q G D P  + Q L+EQ++RI
Sbjct:    1 MLWREEDNPCYEIHQIIVPHLGQVPVAKGDFSSLPPEAQSFIGKWVGICKPRGLYICDGSHWEASEIIQKLCERGTLHRLAAYEENYICRTDPDDVARVESRTWICSPNKFSIVPHVSEGVKGMLGQWMSPEELDVALRDRMPGCMTGRMMYVIPFSMGPVGSPLSKVGIQLTDSNYVVLCMRIMTRVCPDVWEVMVNHHEFVKCVHSMGCPRPSTRKVINHWPCNPEKTIITHIPDERMIISYGSGYGGNSLLGKKCFALRIAGSMAYDEGWMAEHMLIMSVTSPEGKEHFIAAAFPSACGKTNMAMLEPSLPGWKIQCVGDDIAWMRFDENGVLHAINPEYGFFGVAPGTNRKTNPNAIATCMKNTIFTNIAESVDGRFFWEGLEDEFDPDTEIITWLGHRVKLSDKSHDPKAHPNSRFCCPASQCPIIHPAWENPKGVPISAIVFGGRRPEGIPLVMQAFNWKHGVMLGASLKSEATAAAEFKGKVVMHDPMAMRPFVGYNFGKYLQHWLDLEKPGRKMPLIFHVNWFRLNKQGKFLWPGFGDNIRVIEWMLRCVQGEDVTVPSPIGLLPKEGTINMSGLNADWKAIFDLPKDYLLEDIQETTKYLEDQVGSDTPKEIRQLLEEQKERI 632          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Match: A0A4S2LDP2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007902 PE=3 SV=1)

HSP 1 Score: 957.207 bits (2473), Expect = 0.000e+0
Identity = 457/634 (72.08%), Postives = 542/634 (85.49%), Query Frame = 2
Query:   68 MIWENDTEIPQEVHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDN-AFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHN 1966
            M+W  +     E+H++++PHLG +P+ KGD+  LP + Q FI KW  +CKPR LYICDG   EA+EII KL ERGTLH LT  E ++ICRTDPDDVARVES+T+I + NK   VPHV EG KG+LGQW+APE+L+  + +R+ GCM GRMMY+IPFSMGP+GSPLSK+GIQLTDSNYVVLCMRIMTRV P VW  + ++  FVKCVHS+GCPRP  RKVINHWPCNPEKT+I H+PDER+IISYGSGYGGNSLLGKKCFALRIAG +AYDEGWMAEHMLIMSVT+P+G+E FIAAAFPSACGKTNMAMLEP LPGWK+Q VGDDIAWMRFDE+GVL AINPE GFFGVAPGTN KTNPNA+ T  KN+IFTN+AE+ DG ++WEG+E + DP+ E+ +WLG ++K+ DK+  P AHPNSRFCCPASQCPIIHP WE+P+GVPISAIVFGGRRPEGIPLV+QAF+WKHGVMLGASLKSEATAAAEFKGK +MHDPMAMRPF+GYNFG+YLQHWLDLEKPGRKMPLIFHVNWFRLN+QGKF+WPGFGDNIRVI+WM R V GED+  PSPIGLLPK+G++++SG++  W+ +F+LPK+YL EDIQET K+L +Q G D P  + + L+EQ++RI  
Sbjct:    1 MLWREEDNPCYEIHQIIVPHLGQVPVAKGDFSSLPPEAQSFIGKWVGICKPRGLYICDGSHWEASEIIQKLCERGTLHRLTAYEENYICRTDPDDVARVESRTWICSPNKFSIVPHVSEGVKGMLGQWMAPEELDVALRDRMPGCMTGRMMYVIPFSMGPVGSPLSKVGIQLTDSNYVVLCMRIMTRVCPDVWEVMVNHHEFVKCVHSMGCPRPSTRKVINHWPCNPEKTIITHIPDERMIISYGSGYGGNSLLGKKCFALRIAGSMAYDEGWMAEHMLIMSVTSPEGKEHFIAAAFPSACGKTNMAMLEPSLPGWKIQCVGDDIAWMRFDENGVLHAINPEYGFFGVAPGTNRKTNPNAIATCMKNTIFTNIAESVDGRFFWEGLEDDFDPDTEIITWLGNRVKLSDKTHDPKAHPNSRFCCPASQCPIIHPAWENPRGVPISAIVFGGRRPEGIPLVLQAFNWKHGVMLGASLKSEATAAAEFKGKVVMHDPMAMRPFVGYNFGKYLQHWLDLEKPGRKMPLIFHVNWFRLNKQGKFLWPGFGDNIRVIEWMLRCVQGEDVTVPSPIGLLPKEGTINMSGINADWKAIFDLPKDYLLEDIQETTKYLEDQVGSDTPKEIRRLLEEQQERIRT 634          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Match: A0A5J4NVM0 (Phosphoenolpyruvate carboxykinase (GTP) OS=Paragonimus westermani OX=34504 GN=DEA37_0003080 PE=3 SV=1)

HSP 1 Score: 941.028 bits (2431), Expect = 0.000e+0
Identity = 455/646 (70.43%), Postives = 532/646 (82.35%), Query Frame = 2
Query:   71 IWENDTEIPQEVHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLS-DNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDE-------------HGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHN 1966
            +W  + +   EVH++V+PHLG +P+ KGD+  LPK  Q FI KW  +C+PR LYICDGG+ EA EII KL ERGTLH LT  E ++ICRTDP DVARVES+T+I   NKH  VPH+ +G  G+LGQWI+P +L+  + +RL GCM GRMMY+IPFSMGP+GSPLSK+G+Q+TDSNYVVLCMRIMTRV P VW  +   + FVKCVHS+GCPRP   K+INHWPCNPEKT+I+H+P ER+I+SYGSGYGGNSLLGKKCFALRIAG IA+DEGWMAEHMLIMSVTNP GEE FIAAAFPSACGKTNMAMLEP LPGWK+Q VGDDIAWM+FDE              GVLRAINPEAGFFGVAPGTN KTNPNA+ T  KN+IFTN+AE+ DG ++WEG+E + DP  EV +WLG ++KV D +  P AHPNSRFCCPA QCPIIHP WEDP+GVPISAIVFGGRRPEGIPLV+Q+FDWKHGVMLGASLKSEATAAAEFKGK +MHDPMAMRPF+GYNFG+YL+HWL+LEKPGRKMPLIFHVNWFRL+E GKFVWPGFGDNIRVIDW+ RR  GEDI  PSPIG+LPK+GS+D+SGL+  W+ +F+LPKNYL ED+ ET  +L +Q G DLPA + Q L +Q +RI  
Sbjct:    1 MWSENEQPCMEVHQIVVPHLGTVPVAKGDFAALPKAAQKFIGKWVEICQPRGLYICDGGQKEANEIIQKLTERGTLHRLTAYEGNYICRTDPRDVARVESRTWICAPNKHDIVPHMADGVHGMLGQWISPAELDVALNDRLPGCMAGRMMYVIPFSMGPVGSPLSKVGVQVTDSNYVVLCMRIMTRVCPEVWDVMEKSHEFVKCVHSMGCPRPTDHKIINHWPCNPEKTIISHIPHERMIVSYGSGYGGNSLLGKKCFALRIAGSIAHDEGWMAEHMLIMSVTNPAGEESFIAAAFPSACGKTNMAMLEPSLPGWKIQCVGDDIAWMKFDEELKWPFPLIPFPIQGVLRAINPEAGFFGVAPGTNRKTNPNAIATCMKNTIFTNIAESLDGRFFWEGLEDDFDPETEVVTWLGYRVKVKDTTHDPKAHPNSRFCCPAKQCPIIHPLWEDPKGVPISAIVFGGRRPEGIPLVLQSFDWKHGVMLGASLKSEATAAAEFKGKVVMHDPMAMRPFVGYNFGKYLEHWLNLEKPGRKMPLIFHVNWFRLDEHGKFVWPGFGDNIRVIDWILRRCKGEDIGVPSPIGILPKEGSVDMSGLNANWKSIFSLPKNYLIEDVHETLAYLNDQVGSDLPATIRQLLLDQAERIQT 646          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Match: A0A0X3NYX4 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR167045 PE=3 SV=1)

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 439/624 (70.35%), Postives = 526/624 (84.29%), Query Frame = 2
Query:  101 EVHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNA-FVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            EVH + +PHLG +PI KG++  LP+ VQ F+ KW  VCKP+AL+ICDGG+ EA  I  +L E GT+  LT  EN++ICRTDP DVARVESKTFI TK+K+ TVPHVKEG KGILGQWI+PED++    +R  GCM GR+MY+IP+SMGPIGSPL+K G+QLTDS+YVVLCMRIMTRVSPLV   + +   FV+CVHS+G P P+  K+IN+WPCNPEKT+IAH+PDER+I+S+GSGYGGNSLLGKKCFALRIAGRIAYDEGWMAEHML+MSVTNPK EEKF+ AAFPSACGKTNMAML P LPGWK+Q VGDDIAWMRFD+ GVLRAINPEAGFFGVAPGTN+KTNPNAM +  KNS+FTNVAET DG ++WEG+E+E DPN ++T+WLG K  VG  ++   AHPNSRFCCPASQCPIIHP WEDP+GVP+SA++FGGRRPEGIPLV QAF+W HGVM+GA +KSEATAAAEFKG+Q+MHDPMAMRPFMGYNFG+YL+HWL +EKP RKMP IFHVNWFRL++ G+F WPG+G+NIRVIDW+ RR  GE+ A  S +G LP KGS+++SGL+V W+ +F+LPK YL EDI+ET KFL EQ G DLPA + ++L +Q +RI  M
Sbjct:    3 EVHSIKVPHLGEVPISKGEFRDLPENVQRFVGKWVGVCKPKALFICDGGKAEADSITQQLIEGGTIARLTAYENNYICRTDPKDVARVESKTFICTKDKYKTVPHVKEGVKGILGQWISPEDMDAYSKDRYPGCMAGRIMYVIPYSMGPIGSPLAKYGVQLTDSSYVVLCMRIMTRVSPLVLEIIREQKEFVRCVHSIGLPLPYSGKIINNWPCNPEKTMIAHIPDERIILSFGSGYGGNSLLGKKCFALRIAGRIAYDEGWMAEHMLVMSVTNPKNEEKFVCAAFPSACGKTNMAMLTPSLPGWKIQCVGDDIAWMRFDDEGVLRAINPEAGFFGVAPGTNHKTNPNAMGSCMKNSVFTNVAETEDGRFFWEGLEEEYDPNTKITTWLGEKTTVGATTQTAKAHPNSRFCCPASQCPIIHPHWEDPKGVPVSALIFGGRRPEGIPLVYQAFNWSHGVMIGAQVKSEATAAAEFKGRQVMHDPMAMRPFMGYNFGKYLEHWLSMEKPNRKMPKIFHVNWFRLDKNGRFAWPGYGENIRVIDWILRRCAGENCAVESALGYLPSKGSINMSGLNVDWDAIFHLPKEYLLEDIEETTKFLDEQVGVDLPAAIKKELADQLQRIQKM 626          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Cavefish
Match: pck1 (phosphoenolpyruvate carboxykinase 1 [Source:NCBI gene;Acc:103029368])

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 351/613 (57.26%), Postives = 460/613 (75.04%), Query Frame = 2
Query:  143 ICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKG-PAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE-KPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL--DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            + +GD + L   ++ FI     +C+P AL+ICDG E+E   I+  L+E+G +  LTK EN ++ RTDP DVARVESKT I T+ +  TVP    G    LG+W++ E+ ++ + ER  GCM GR MY+IP+SMGP+GSPLSKIG++LTDS YVVL MR+MTR+   V + L +  FV+C+HSVGCP P  + ++N+WPCNP  TLIAH+PD+R I+S+GSGYGGNSLLGKKCFALRIA RIA +EGW+AEHMLI+ VTNP GE+K+IAAAFPSACGKTN+AML+P LPGWKV+ VGDDIAWM+FD+ G LRAINPE GFFGVAPGT+ K+NPNAM+T  KN+IFTNVAET+DG  YWEGM+ ++   + +TSW   K K      G P AHPNSRFC PASQCPII P WE P+GVPI AI+FGGRRPEG+PLV ++F W HGV +GA+++SEATAAAE   K IMHDP AMRPF GYNFG YL HWL +E +P  K+P IFHVNWFR +  G F+WPG+G+NIRV++W+  R+NGE  A PS +G LP + SL++ GL   V  EE+F++ +++  +++++ +++   +   DLP  +  QL+  + R++++
Sbjct:   15 VLQGDLNSLSPALREFIESSMTLCQPDALHICDGSEEENKAILAHLQEQGMIKRLTKYENCWLARTDPRDVARVESKTVIVTQEQRDTVPSPCGGGISQLGRWMSQEEWDKAMNERFPGCMKGRTMYVIPYSMGPVGSPLSKIGVELTDSPYVVLSMRVMTRMGKAVLNALGNGDFVRCLHSVGCPLPLKKPLVNNWPCNPPLTLIAHIPDQRKIVSFGSGYGGNSLLGKKCFALRIASRIAKEEGWLAEHMLILGVTNPAGEKKYIAAAFPSACGKTNLAMLKPTLPGWKVECVGDDIAWMKFDDEGNLRAINPENGFFGVAPGTSVKSNPNAMETICKNTIFTNVAETSDGGIYWEGMDHKLPEGVTITSW---KNKAWTPEDGEPCAHPNSRFCTPASQCPIIDPNWESPEGVPIEAIIFGGRRPEGVPLVYESFSWAHGVFVGAAMRSEATAAAEHTNKVIMHDPFAMRPFFGYNFGHYLSHWLSMEQRPNSKLPKIFHVNWFRKSPSGGFLWPGYGENIRVLEWIFHRLNGEAGAMPSAVGYLPSERSLNLDGLKDQVNLEELFDISRDFWEKEVEDIQQYFDREVNSDLPVEMKMQLEMLKLRVNHL 624          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Cavefish
Match: pck2 (phosphoenolpyruvate carboxykinase 2 (mitochondrial) [Source:ZFIN;Acc:ZDB-GENE-040426-2266])

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 330/608 (54.28%), Postives = 432/608 (71.05%), Query Frame = 2
Query:  167 LPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNA-FVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE--KPGRKMPLIFHVNWFRLN-EQGKFVWPGFGDNIRVIDWM---CRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWE--EMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIH 1963
            LP  V  F+++ A  CKP  +++  G  +E  E++  +++ G +  LTK +N ++ RTDP DVARVESKT I TK +  T+P  +   K  LG W++  +      +R   CM GR MY+IPFSMGP+ S L+K G+Q+TDS YVV  M IMTR+   V   L+    FV+C HSVG P P    ++N WPCNPEK LIAHLPD R I+S+GSGYGGNSLLGKKCFALRIA RIA DEGW+AEHMLI+ +TNP+G +++IAAAFPSACGKTN+AM++P LPGWKV+ VGDDIAWM+FD  G LRAINPE GFFGVAPGT+ KTNP AM T  KN++FTNV ET+DG  +WEG++     N+ +T W G   K G  +  P AHPNSRFC PA+QCPII P WE  +GVPI AI+FGGRRPEG+PLV ++F+W+HGV +GA+++SE+TAAAE KGK +MHDP AMRPF GYNFG YL HWL +E  K   ++P IFHVNWFR + +   F+WPGFG+N RV++W+   C R   E+ A+ S IG LP++G+++  GL  K +   +F+LPK++  +++QE + +  +Q G DLP  V  +L   E+R+ 
Sbjct:   13 LPHGVSEFVSEAAAECKPAKVHVVTGTPEETAELLAGMEKDGMVKKLTKYQNCWLARTDPKDVARVESKTVIVTKQQRDTIPIPENNVKSQLGNWMSESEFQTAREDRFPSCMTGRTMYVIPFSMGPVNSSLAKYGVQVTDSPYVVASMGIMTRMGTPVMDKLAQGVEFVRCQHSVGRPLPLKAPLVNQWPCNPEKVLIAHLPDSRKIMSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYIAAAFPSACGKTNLAMMKPALPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSGKTNPYAMDTISKNTVFTNVGETSDGGIWWEGLDPP-SSNIGLTDWHGKTWKFGAST--PCAHPNSRFCAPAAQCPIIDPLWESEEGVPIDAIIFGGRRPEGVPLVYESFNWRHGVFVGAAMRSESTAAAEHKGKVVMHDPFAMRPFFGYNFGDYLAHWLSMETRKGPTQLPKIFHVNWFRKDPKSNSFLWPGFGENARVLEWIFGRCGRTREEEAAKKSIIGWLPEEGAINTEGLGAKVDMGALFDLPKHFWQKEVQELQAYFTQQVGADLPEQVAGELRALEERVR 617          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005310.1 (pep scaffold:Pmarinus_7.0:GL478263:992:2267:1 gene:ENSPMAG00000004836.1 transcript:ENSPMAT00000005310.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 1.310e-61
Identity = 92/191 (48.17%), Postives = 132/191 (69.11%), Query Frame = 2
Query: 1409 GGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGR--KMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL--DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            GG    G+PLV +AF W+HGV +GA+++SEATAAAE+KGK IMHDP AMRPF GYNFG YL HWL + +     ++P I+HVNWFR    G F+WPGFGDN RV++W+ RR+ G      + +G++P  G LD+SGL  +V  E +F++P+ +  E+  E + +L E+ G+DLP  ++ ++   E+RI +M
Sbjct:    1 GGVLAAGVPLVFEAFSWQHGVFVGAAMRSEATAAAEYKGKVIMHDPFAMRPFFGYNFGHYLAHWLGMARRSSPAQLPRIYHVNWFRRGPAGNFLWPGFGDNCRVLEWITRRLEGRAEGCRTAVGVVPAPGELDLSGLAEEVDEEALFSVPRAFWEEEAAEIRSYLEEEVGDDLPREILDEMAALEERIRSM 191          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Nematostella
Match: EDO41588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S418])

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 349/618 (56.47%), Postives = 458/618 (74.11%), Query Frame = 2
Query:  140 PICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQ---WIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDP--NLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDL----EKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-VKWEEMFNLPKNYLAEDIQET-KKFLREQTGEDLPAGVIQQLDEQEKRI 1960
            P+  GD++ LPKKVQ F+ +   +C+P  ++ICDG  +E   ++  L ++GT   LTK ENS++ RTDP DVARVESKTFI T+N+   VP  K+G  G++GQ   W++ E  N+ + ER  GCM GR MY++PFSMGP+GSP++KIGIQLTDS YVV CMRIMTR+   V   L    FVKC+HSVG P     K +  WPC+P++T+I H P +  I S+GSGYGGNSLLGKKCFALRIA  IA  EGW+AEHMLIM++TNP+G++K+IAAAFPSACGKTN+AML+P +PGWKV  VGDDIAWM FD+ G LRAINPE+GFFGVAPGT+ KTNP A+KT  K++IFTN A T+DG ++WEG+    DP   + +TSWLG +     +S   AAHPNSRFC P++ C I+   WE+P+GVPISAI+FGGRRP G+PLV +AF+W+HGV + +SL SE TAAAEFKGK IM DP AMRPF GYN+GRYL+HWL +    + P  K+P IFHVNWFR+NE+G F+WPGFG+N RV++W+ R   GEDI+   P+GL+PK G+L++ GLD + W+E+F++PK+Y  + + E   ++ ++Q G+DLP  +  +L   E R+
Sbjct:    7 PVENGDFNSLPKKVQDFVTENVELCQPDKIHICDGSPEENQSLVDFLVKKGTCFKLTKRENSYVVRTDPGDVARVESKTFICTENERDAVPDFKKGKDGVVGQLGRWLSVEKANQALGERFPGCMKGRTMYVLPFSMGPVGSPIAKIGIQLTDSEYVVCCMRIMTRMGSHVLKALDQGDFVKCLHSVGKPLKEGEKDV-LWPCDPDRTIITHFPADNYIKSFGSGYGGNSLLGKKCFALRIASNIALKEGWLAEHMLIMALTNPEGKKKYIAAAFPSACGKTNLAMLKPTIPGWKVDCVGDDIAWMWFDKTGQLRAINPESGFFGVAPGTSMKTNPEALKTCLKDTIFTNTAMTSDGDFWWEGLP---DPPKGVSITSWLG-EENWSPESGSKAAHPNSRFCTPSANCEIMDKDWENPEGVPISAILFGGRRPRGVPLVYKAFNWQHGVFIASSLSSETTAAAEFKGKAIMRDPFAMRPFFGYNYGRYLEHWLSMADKTKHPNYKLPDIFHVNWFRVNEKGHFLWPGFGENCRVLEWIFRCTEGEDISMECPVGLIPKPGTLNLDGLDKINWDELFSVPKDYWLQIVCENLHQYYKDQVGKDLPKEITNELKALEDRL 619          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Nematostella
Match: EDO41631 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S417])

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 353/617 (57.21%), Postives = 455/617 (73.74%), Query Frame = 2
Query:  140 PICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEV-AERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGV---KMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEK-PGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDV-----KWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRI 1960
            P   GD   LPKKV+ F+ + A + KP  ++ICDG EDE    I  L +RG    L K  N +   TDP DVARVESKTFI TKNKH  VPH K G  G L +W++ E+ ++++  ER  GCM GR MY++PFSMGP+GSP+SKIGI+LTDS YVV CMRIMTR+   V   L D  FV+C+HSVG P  H  K    WPC+PE+TLI H P+ R I SYGSGYGGNSLLGKKCFALRIA  IA DEGW+AEHM+I+ +TNP+G++ +IAAAFPSACGKTN+AML P +PGWK + VGDDIAWM FD+ G LRAINPE GFFGVAPGT++ +NP AM TFQK++IFTNVA+T+DG ++WEG+    D  +++ SWLG    K +V  K++  AAHPNSRFC P+  CPI+   WE+P GVPISAI+FGGRRP G+PLVMQ+F+W+HGV L  SL SE TAAAEFKGK +M DP AMRPF GYNFG+YL+HWL +EK P +K+PLIFHVNWFRL+    F+WPGFG+N RV++W+  RV+  D A+ SP+GL+PK+G+L++  ++        +E+F++PK Y  ++++  +K+ +++ G+DLP  +  +LD  E+RI
Sbjct:   10 PCAYGDLSALPKKVREFVEENARLMKPAQIHICDGSEDENQNNIKILMDRGAAVPLEKHSNCYAVFTDPRDVARVESKTFICTKNKHDAVPHFK-GEVGQLARWMSLEEAHKKLYEERYPGCMEGRTMYVMPFSMGPVGSPISKIGIELTDSEYVVCCMRIMTRMGSHVLKALGDGDFVRCLHSVGGPL-HDGKNNVPWPCDPERTLITHFPETREIKSYGSGYGGNSLLGKKCFALRIASVIARDEGWLAEHMMILGLTNPEGKKIYIAAAFPSACGKTNLAMLTPTIPGWKCECVGDDIAWMWFDKDGTLRAINPECGFFGVAPGTSFLSNPIAMSTFQKDTIFTNVAKTSDGDFWWEGLNPPAD-GIKIRSWLGDPDWKPEVAGKTRKTAAHPNSRFCAPSDHCPIMDKDWENPAGVPISAILFGGRRPYGVPLVMQSFNWQHGVFLATSLSSETTAAAEFKGKAVMRDPFAMRPFFGYNFGKYLEHWLSMEKDPKKKLPLIFHVNWFRLDNTEHFLWPGFGENSRVLEWVFNRVHNVDNADVSPVGLIPKQGALNLEQMETPVTPEAMKELFSIPKEYWLDEVESLRKYFQQEIGDDLPKAISNELDALEQRI 623          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Nematostella
Match: EDO41587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S416])

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 353/617 (57.21%), Postives = 449/617 (72.77%), Query Frame = 2
Query:  140 PICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEV-AERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEK-PGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD-----VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            P+  G++  LPKKVQ F+ + A +  P  ++ICDG + E    I  L  +G    L K EN +   TDP DVARVES+TFI TK K   VPH K G  G L +W++ E+ ++++  ER  GCM GR MY++PFSMGP+GSP+SKIGIQLTDS YVV CMRIMTR+   V   L D  FV+ VHSVG P     K +  WPC+PE+TLI H P  R I SYGSGYGGNSLLGKKCFALRIA  IA+DEGW+AEHM+IM +TNP+G++ +IAAAFPSACGKTN+AML P +PGWK + VGDDI WM FD+ G LRAINPE+GFFGV PGT + +NP AMKTFQK++IFTNVA T+DG ++WEG+    +  +++ SW G       ++   AAHPNSRFC P+  CPI+   WE+P GVPISAI+FGGRRP G+PLVMQ+F+W+HGV L  SL SE TAAAEFKGK +M DP AMRPF GYNFG+YL+HWL+L K P +K+PLIFHVNWFRL++   F+WPGFG+N RV++W+ RRV+GE+IA+PSP+GLLPK GSL++ GL        W EMF++PK+Y  E++ E +K+  ++ G DLP  +  +L+  E R+  M
Sbjct:    5 PVAYGNWDALPKKVQEFVEENAKLMTPAQIHICDGSDAENKANIEVLLNKGAAVPLEKHENCYAVFTDPQDVARVESRTFICTKCKDDAVPHFK-GKVGKLARWMSLEEAHKKLYEERYPGCMTGRTMYVLPFSMGPVGSPISKIGIQLTDSEYVVCCMRIMTRMGSHVLKALGDGDFVRGVHSVGFPLKEGVKEVP-WPCDPERTLITHFPATREIKSYGSGYGGNSLLGKKCFALRIASNIAHDEGWLAEHMMIMGLTNPEGKKIYIAAAFPSACGKTNLAMLTPTIPGWKCECVGDDINWMWFDKDGTLRAINPESGFFGVCPGTTFTSNPIAMKTFQKDTIFTNVAVTSDGDFWWEGLAPPAE-GIKIRSWKGDPDWKPTENGPTAAHPNSRFCAPSDHCPIMDKDWENPAGVPISAILFGGRRPYGVPLVMQSFNWQHGVFLATSLSSETTAAAEFKGKAVMRDPFAMRPFFGYNFGKYLEHWLNLSKDPKKKLPLIFHVNWFRLDKNEHFLWPGFGENSRVLEWVFRRVHGEEIADPSPVGLLPKYGSLNLDGLKDPVTPEAWNEMFSIPKDYWLEELTELRKYFTDEVGIDLPKAIEDELNALENRLKKM 618          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Nematostella
Match: EDO26447 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC03])

HSP 1 Score: 93.5893 bits (231), Expect = 1.707e-23
Identity = 43/64 (67.19%), Postives = 51/64 (79.69%), Query Frame = 2
Query:  509 GRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCP 700
            GR MY++PFSMGP+GSP+SKIGI+LTDS YVV CMRIMTR+   V   L D  FV+C+HSVG P
Sbjct:    1 GRTMYVMPFSMGPVGSPISKIGIELTDSEYVVCCMRIMTRMGSHVLKALGDGDFVRCLHSVGGP 64          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Medaka
Match: pck2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:NCBI gene;Acc:101158145])

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 335/608 (55.10%), Postives = 428/608 (70.39%), Query Frame = 2
Query:  167 LPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNA-FVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE--KPGRKMPLIFHVNWFRLN-EQGKFVWPGFGDNIRVIDWM---CRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWE--EMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIH 1963
            LP  V  F+   A  CKP  +++  G  +E   I+  L+  G +  L K EN ++ RTDP DVARVESKT I TKN+  TVP    G K  LG W++  D      +R  G M GR MY+IPFSMGP+GS LSK G+Q+TDS YVV  M IMTR+   V   L++   FV+C HSVG P P    + N WPCNPEK LI+HLPD R I+S+GSGYGGNSLLGKKCFALRIA RIA DEGW+AEHMLI+ +TNP+G ++++AAAFPSACGKTN+AM++P LPGWKV+ VGDDIAWM+FD  G LRAINPE GFFGVAPGT+ KTNP AM T  KN++FTNV ET+DG  +WEG++      + +T W G   K G  S  P AHPNSRFC PA QCPII P+WE  +GVPI AI+FGGRRPEG+PLV ++F+W+HGV +GA+++SEATAAAE KGK IMHDP AMRPF GYNFG YL HWL ++  K   ++P IFHVNWFR +   G F+WPGFG+N RV++W+   C R   ++ A+ S IG LP++G+++  GL  K +   +F++PK++  ++ +E + +  +Q G DLPA +  +L   E R+H
Sbjct:   28 LPPAVADFVKGAADECKPANVHVVTGTPEETANILAGLERDGMVKRLPKYENCWLARTDPKDVARVESKTVIVTKNQRDTVPIPAGGVKSQLGSWMSESDWERARRDRFPGSMAGRTMYVIPFSMGPVGSTLSKYGVQVTDSPYVVASMGIMTRMGSPVLQKLTEGVEFVRCQHSVGRPLPLTAPLNNSWPCNPEKVLISHLPDTRQILSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYVAAAFPSACGKTNLAMMKPSLPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSNKTNPYAMATIVKNTVFTNVGETSDGGVWWEGLDPP-PAGITLTDWHGKSWKPG--SSTPCAHPNSRFCAPAGQCPIIDPQWESEEGVPIDAIIFGGRRPEGVPLVYESFNWQHGVFVGAAMRSEATAAAEHKGKMIMHDPFAMRPFFGYNFGDYLTHWLSMQSRKAPTQLPRIFHVNWFRKDPATGAFLWPGFGENARVLEWIFKRCGREREDEAAKKSIIGWLPQEGAINTEGLGSKVDMGALFDVPKSFWQKETKELQAYFTQQVGADLPAQMKAELKALEDRVH 632          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Medaka
Match: pck2 (phosphoenolpyruvate carboxykinase 2, mitochondrial [Source:NCBI gene;Acc:101158145])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 318/609 (52.22%), Postives = 404/609 (66.34%), Query Frame = 2
Query:  167 LPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNA-FVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEF-KGKQIMHDPMAMRPFMGYNFGRYLQHWLDLE--KPGRKMPLIFHVNWFRLN-EQGKFVWPGFGDNIRVIDWM---CRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWE--EMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIH 1963
            LP  V  F+   A  CKP  +++  G  +E   I+  L+  G +  L K EN ++ RTDP DVARVESKT I TKN+  TVP    G K  LG W++  D      +R  G M GR MY+IPFSMGP+GS LSK G+Q+TDS YVV  M IMTR+   V   L++   FV+C HSVG P P    + N WPCNPEK LI+HLPD R I+S+GSGYGGNSLLGKKCFALRIA RIA DEGW+AEHMLI+ +TNP+G ++++AAAFPSACGKTN+AM++P LPGWKV+ VGDDIAWM+FD  G LRAINPE GFFGVAPGT+ KTNP AM T  KN++FTNV ET+DG  +WEG++      + +T W G   K G  S  P AHPNSRFC PA QCPII P+WE  +GVPI AI+FGGRRPEG                   L + +     F  GK IMHDP AMRPF GYNFG YL HWL ++  K   ++P IFHVNWFR +   G F+WPGFG+N RV++W+   C R   ++ A+ S IG LP++G+++  GL  K +   +F++PK++  ++ +E + +  +Q G DLPA +  +L   E R+H
Sbjct:   53 LPPAVADFVKGAADECKPANVHVVTGTPEETANILAGLERDGMVKRLPKYENCWLARTDPKDVARVESKTVIVTKNQRDTVPIPAGGVKSQLGSWMSESDWERARRDRFPGSMAGRTMYVIPFSMGPVGSTLSKYGVQVTDSPYVVASMGIMTRMGSPVLQKLTEGVEFVRCQHSVGRPLPLTAPLNNSWPCNPEKVLISHLPDTRQILSFGSGYGGNSLLGKKCFALRIASRIAKDEGWLAEHMLILGITNPQGVKRYVAAAFPSACGKTNLAMMKPSLPGWKVECVGDDIAWMKFDSQGKLRAINPENGFFGVAPGTSNKTNPYAMATIVKNTVFTNVGETSDGGVWWEGLDPP-PAGITLTDWHGKSWKPG--SSTPCAHPNSRFCAPAGQCPIIDPQWESEEGVPIDAIIFGGRRPEG----------------AQRLGAHSLRLTSFPPGKMIMHDPFAMRPFFGYNFGDYLTHWLSMQSRKAPTQLPRIFHVNWFRKDPATGAFLWPGFGENARVLEWIFKRCGREREDEAAKKSIIGWLPQEGAINTEGLGSKVDMGALFDVPKSFWQKETKELQAYFTQQVGADLPAQMKAELKALEDRVH 642          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Match: SMESG000062868.1 (SMESG000062868.1)

HSP 1 Score: 1281.93 bits (3316), Expect = 0.000e+0
Identity = 634/634 (100.00%), Postives = 634/634 (100.00%), Query Frame = 2
Query:   68 MIWENDTEIPQEVHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            MIWENDTEIPQEVHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERLIISYGSGYGGNSLLGKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM
Sbjct:    1 MIWENDTEIPQEVHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERLIISYGSGYGGNSLLGKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 634          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Match: SMESG000060914.1 (SMESG000060914.1)

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 343/610 (56.23%), Postives = 451/610 (73.93%), Query Frame = 2
Query:  161 HYLPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYL-SDNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPN-LEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDL-EKPGRKMPLIFHVNWFRLNEQ-GKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLD---VKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            ++L   ++ ++ K A +C+P ++YICDG E+E  ++I  L + G +  L K EN ++ RTDP DVARVESKTFIST+ K  T+P V  G  G LG W++P+ L +E+ +R  GCM GR MY+I FSMGPIG  LSKIGI+LTDS YVV+ M+IMTR+   V   L   N FV+ +HSVG P P  +K+IN WPCNPEKT+IAH+P+E  I S+GSGYGGNSLLGKKCFALR+   + + EGW AEHMLI+ +T+    +++IAAAFPSACGKTN+AML+  LPG+K++ VGDDIAWM+FD +G LRAINPE+GFFGVAPGT++KTNPNAM   QKN+IFTNVAET+DG ++WEGME E+D N + +T W G K     K+K  AAHPNSRFC PASQCPII   WE   GV ISAIVFGGRRPEG+PL+ ++F+W+HGV +GAS++SE+TAAA+ K   IMHDP AMRPF GYNFG YLQHWL    K   K+P I+HVNWFR ++  G+F+WPGFGDN RV++W+ +R++G      + IG LP    +++ GLD   +  EE+F++P  Y  E+++E K++  EQ G+ LP  +I+Q++E EKR+ N+
Sbjct:    9 NHLSDPIKHYVLKNADICQPDSIYICDGSEEENQKMIDILLKEGAIKKLNKYENCWLVRTDPADVARVESKTFISTERKEETIPVVNNGVSGCLGNWMSPDVLRDELNQRFTGCMKGRTMYVIGFSMGPIGGELSKIGIELTDSPYVVMSMKIMTRIGKEVLMTLGQSNDFVRSIHSVGVPLPTTKKIINGWPCNPEKTIIAHIPNENEICSFGSGYGGNSLLGKKCFALRLGSILGHREGWFAEHMLIVGITDKNNVKRYIAAAFPSACGKTNLAMLQSTLPGYKIECVGDDIAWMKFDGNGELRAINPESGFFGVAPGTSFKTNPNAMLCIQKNTIFTNVAETSDGGFFWEGMENEIDFNSVTITDWQGNKWDKSQKTK--AAHPNSRFCTPASQCPIIDRDWESTNGVVISAIVFGGRRPEGVPLIYESFNWEHGVFIGASMRSESTAAAKHKSNIIMHDPFAMRPFFGYNFGDYLQHWLSFRSKENLKLPRIYHVNWFRKSKSTGEFIWPGFGDNCRVLEWILKRLDGTVGCRMTAIGKLPNPTDINMEGLDQSKINIEELFSVPSQYWREEVKEIKRYFEEQVGDYLPTKIIEQVNELEKRLENI 616          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Match: SMESG000011426.1 (SMESG000011426.1)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 347/608 (57.07%), Postives = 454/608 (74.67%), Query Frame = 2
Query:  167 LPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGS-KGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDN-AFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPN-LEVTSWLGVKMKVGDKSKG-PAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDL-EKPGRKMPLIFHVNWFRLN-EQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL---DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIH 1963
            LPK V+ ++ + A  C P  + +CDG E+E+  +I  L + G++  L K EN ++ RTDPDDVARVESKTFISTK K  T+P    G  KG LG W++ +++ +E+ ER  GCM GR M++IPFSMGP+G PLSKIGIQLTDS YVV  M+IMTR+  +V + ++D+ +FVK +HSVG P P  RK+IN WPCNPEKTLIAHLP+   I S+GSGYGGNSLLGKKCFALR+   +A DE  +AEHMLI+ +T   G++ +I AAFPSACGKTN+AML+P +PG+KV+ VGDDIAWM+FD  G+LRAINPE+GFFGVAPGT+  TNPNAM   QKN+IFTNVAET+DG  +WEG+E EV+ N +E+  W G   K   K  G PAAHPNSRFCCPA QCPII P WE P GVPISA++FGGRRPEG+PL+ +A +W+HGV +GASL+SEATAAAE+KGK IM+DP AMRPF GYNFG YL+HW+   +K   K+P IFHVNWFR + E G F+WPG+G+N RV+DW+ +R+ G+     + +G+LPK   +++ GL    V+++E+F+LPK +   + +E +K+  EQ G DLP  +  +L+  +KR++
Sbjct:    8 LPKAVREYVIEQANKCLPNDIKVCDGSEEESQILIQNLVDEGSMKKLAKYENCWLVRTDPDDVARVESKTFISTKLKRTTIPETNNGEIKGKLGNWMSVDEMEKELNERFPGCMKGRTMFVIPFSMGPVGGPLSKIGIQLTDSPYVVCSMKIMTRMGQIVINSMTDSTSFVKALHSVGVPLPTDRKIINGWPCNPEKTLIAHLPETNEICSFGSGYGGNSLLGKKCFALRLGSILARDEERLAEHMLILGITPEFGKKIYITAAFPSACGKTNLAMLKPTIPGYKVECVGDDIAWMKFDSEGILRAINPESGFFGVAPGTSNTTNPNAMACIQKNTIFTNVAETSDGGVFWEGLEDEVNFNEIEILDWQG---KPWAKDCGRPAAHPNSRFCCPAFQCPIIDPDWESPNGVPISAVIFGGRRPEGVPLIYEALNWQHGVFIGASLRSEATAAAEYKGKVIMNDPFAMRPFFGYNFGDYLKHWISFADKNSLKLPSIFHVNWFRKSKENGLFLWPGYGENSRVLDWIVKRIYGKVSGTKTAVGILPKYDEMNLDGLKLNKVQYDELFSLPKRFWINECEELEKYFVEQVGSDLPEQIKMELENFKKRLN 612          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Match: SMESG000062650.1 (SMESG000062650.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 338/606 (55.78%), Postives = 439/606 (72.44%), Query Frame = 2
Query:  167 LPKKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNA-FVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVD-PNLEVTSWLGVKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDVK---WEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM 1969
            LP  V+ F+   A +C+P  ++ICDG + E  E++  L   G +  L+K +N ++  TDP DVAR ESKT I TK++  TVP  K G  G+LG W+  E+  + V     GCM GR+MY+IPFSMGP+G P+SK G++LTDS YVV  MRIMTR+   V   L+    FVK  H+VGCP P  + +IN+WPCNPEK LIAH+PDE  I+S+GSGYGGNSLLGKKCFALRI   +  +EGW+AEHMLI+ +TNPK ++K+I AAFPSACGKTN+AMLEP L  +KV+ VGDDIAWM+F++ G LRAINPE GFFGVAPGT+ +TNPNAMK  Q N+IFTNVA T+DG Y+WEG+EK++D   + VT WL         SK P++H NSRFC PA QCPII PKWE P+GV + AI+FGGRRPEG+PLV ++  W HGV +G +++SEATAAAEFKGKQIMHDP AMRPF GYNFG Y++HW++L K   K+P I+HVNWFR + +G+F+WPGFG+N RV+DW+ RR+N E  A  SP+GLLPK   ++I+GL +     EE  ++ K +   + +E +K+  EQ G+DLP  + ++L   E+RI  M
Sbjct:   11 LPDDVKSFVLSKAEMCQPDKIHICDGSDKENDELLKLLVSTGMIKPLSKYKNCWLALTDPQDVARNESKTVICTKDRRATVPIPKSGVTGLLGNWMDIEEFKKTVQLIYPGCMKGRIMYVIPFSMGPVGGPISKCGVELTDSAYVVASMRIMTRIGEPVLKLLAKKTPFVKGTHTVGCPLPLTKALINNWPCNPEKLLIAHIPDENEIMSFGSGYGGNSLLGKKCFALRIGSILGRNEGWLAEHMLILGITNPKKQKKYITAAFPSACGKTNLAMLEPTLKDYKVECVGDDIAWMKFNDKGELRAINPENGFFGVAPGTSNQTNPNAMKCLQSNTIFTNVAMTSDGGYFWEGLEKDIDLSKVTVTDWLNKPWT--KDSKTPSSHANSRFCTPAKQCPIIDPKWEAPEGVHVEAIIFGGRRPEGVPLVYESLSWNHGVFIGGTVRSEATAAAEFKGKQIMHDPFAMRPFFGYNFGHYMKHWIELGKKYPKVPKIYHVNWFRKSAKGEFLWPGFGENCRVLDWIFRRLNNEVTAVESPVGLLPKSDDINITGLSMTKADLEEALSISKAFWQTEAKEIRKYFEEQVGDDLPPEIAKELKSLEERIEKM 614          
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Match: SMESG000003144.1 (SMESG000003144.1)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 324/604 (53.64%), Postives = 437/604 (72.35%), Query Frame = 2
Query:  173 KKVQGFIAKWALVCKPRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVESKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRMMYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLS-DNAFVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERXXXXXXXXXXXXXXXXKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSACGKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPGTNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVD-PNLEVTSWLGVKMKVGDKSKG-PAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGRRPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFMGYNFGRYLQHWLDLEKP-GRKMPLIFHVNWFRLNEQ-GKFVWPGFGDNIRVIDWMCRRVNGEDIAEPSPIGLLPKKGSLDISGL---DVKWEEMFNLPKNYLAEDIQETKKFLREQTGEDLPAGVIQQLDEQEKRI 1960
            K +  +I   A +C+P ++++CDG E+E  ++I  L  +G +  L+K EN ++ RTDP DVARVESKTFIST  K MT+P +  G +G LG W++P  +  E+  R  GCM GR+MY+IPFSMGP+G  +SK+G+++TDS YVV  MRIMTR+   V   +  +  FVKC+HSVG P P  RK+IN WPC+PEKT+IAHLP    I S+GSGYGGNSLLGKKC ALR+   + + + W+AEHMLI+ +T+    +++I AAFPSACGKTN+AMLE  LPG+K++ VGDDIAWM+FD  G+L+AINPE GFFGVAPGT++KTNPNAM+  QKN+IFTNVAET+DG ++WEG+E EVD  ++ +T W G      DK+KG  AAHPNSRFC PASQCPII   WE P GVPISAI+FGGRRPEG+PLV +A DW HGV +GAS++SE+TAAAE+K   IMHDP AMRPF GYNFG YL+HWL   K    ++P I+HVNWFR + + GKF+WPGFG+N RV++W+ +R++     + S IG LP    ++++G    D+  EE+F++   +  ++  E +K+  EQ G+ LP  +  ++ + ++ +
Sbjct:   15 KSLIDYILLKATICQPDSIHVCDGSEEENQKMIDILLSQGAIKKLSKYENCWLVRTDPADVARVESKTFISTPKKEMTIPDLNNGIRGSLGNWMSPAVMENELNTRFPGCMKGRVMYVIPFSMGPVGGSISKLGVEITDSPYVVASMRIMTRMGSGVLKEIEKEKCFVKCIHSVGVPLPTTRKIINGWPCDPEKTIIAHLPARNEICSFGSGYGGNSLLGKKCLALRLGSIMGHKQHWLAEHMLILGITDANNNKRYITAAFPSACGKTNLAMLESSLPGYKIECVGDDIAWMKFDNKGILKAINPEYGFFGVAPGTSFKTNPNAMRCIQKNTIFTNVAETSDGGFFWEGLEDEVDLDSVSITDWEG---NPWDKNKGKKAAHPNSRFCTPASQCPIIDGDWESPDGVPISAIIFGGRRPEGVPLVYEARDWVHGVFVGASMRSESTAAAEYKANIIMHDPFAMRPFFGYNFGHYLEHWLSFSKDRALQLPRIYHVNWFRKSSKTGKFLWPGFGENCRVLEWILKRIDQRVDCKSSAIGNLPVLSDINVTGFDKSDIDLEELFSVDSAFWKKEADEIEKYFDEQVGKYLPNQIKNEITKLKENL 615          
The following BLAST results are available for this feature:
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCK20.000e+059.08phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
PCK20.000e+059.08phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
PCK10.000e+056.30phosphoenolpyruvate carboxykinase 1 [Source:HGNC S... [more]
PCK20.000e+062.40phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
PCK20.000e+062.40phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pck-20.000e+066.40Phosphoenolypyruvate CarboxyKinase [Source:UniPro... [more]
pck-20.000e+066.40Phosphoenolypyruvate CarboxyKinase [Source:UniPro... [more]
pck-20.000e+066.61Phosphoenolypyruvate CarboxyKinase [Source:UniPro... [more]
pck-20.000e+066.61Phosphoenolypyruvate CarboxyKinase [Source:UniPro... [more]
pck-20.000e+066.61Phosphoenolypyruvate CarboxyKinase [Source:UniPro... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pepck10.000e+056.96gene:FBgn0003067 transcript:FBtr0086701[more]
Pepck20.000e+057.40gene:FBgn0034356 transcript:FBtr0086699[more]
Pepck20.000e+059.89gene:FBgn0034356 transcript:FBtr0113093[more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pck10.000e+057.07phosphoenolpyruvate carboxykinase 1 (soluble) [Sou... [more]
pck20.000e+054.84phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
pck20.000e+054.84phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gca0.000e+060.53grancalcin [Source:Xenbase;Acc:XB-GENE-983090][more]
slc5a60.000e+057.77solute carrier family 5 (sodium/multivitamin and i... [more]
gca0.000e+057.71grancalcin [Source:Xenbase;Acc:XB-GENE-983090][more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pck20.000e+058.92phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
Pck20.000e+058.92phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
Pck20.000e+060.49phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
Pck10.000e+057.28phosphoenolpyruvate carboxykinase 1, cytosolic [So... [more]
Pck20.000e+055.97phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P29190|PCKG_HAECO0.000e+065.04Phosphoenolpyruvate carboxykinase [GTP] OS=Haemonc... [more]
sp|Q05893|PCKG_ASCSU0.000e+062.20Phosphoenolpyruvate carboxykinase [GTP] OS=Ascaris... [more]
sp|Q8BH04|PCKGM_MOUSE0.000e+058.92Phosphoenolpyruvate carboxykinase [GTP], mitochond... [more]
sp|Q16822|PCKGM_HUMAN0.000e+059.08Phosphoenolpyruvate carboxykinase [GTP], mitochond... [more]
sp|P07379|PCKGC_RAT0.000e+057.45Phosphoenolpyruvate carboxykinase, cytosolic [GTP]... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y9990.000e+072.44Phosphoenolpyruvate carboxykinase (GTP) OS=Clonorc... [more]
A0A074ZKX70.000e+072.78Phosphoenolpyruvate carboxykinase OS=Opisthorchis ... [more]
A0A4S2LDP20.000e+072.08Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4NVM00.000e+070.43Phosphoenolpyruvate carboxykinase (GTP) OS=Paragon... [more]
A0A0X3NYX40.000e+070.35Uncharacterized protein (Fragment) OS=Schistocepha... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pck10.000e+057.26phosphoenolpyruvate carboxykinase 1 [Source:NCBI g... [more]
pck20.000e+054.28phosphoenolpyruvate carboxykinase 2 (mitochondrial... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005310.11.310e-6148.17pep scaffold:Pmarinus_7.0:GL478263:992:2267:1 gene... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO415880.000e+056.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416310.000e+057.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415870.000e+057.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264471.707e-2367.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pck20.000e+055.10phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
pck20.000e+052.22phosphoenolpyruvate carboxykinase 2, mitochondrial... [more]
back to top
BLAST of Phosphoenolpyruvate carboxykinase [GTP] vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062868.10.000e+0100.00SMESG000062868.1[more]
SMESG000060914.10.000e+056.23SMESG000060914.1[more]
SMESG000011426.10.000e+057.07SMESG000011426.1[more]
SMESG000062650.10.000e+055.78SMESG000062650.1[more]
SMESG000003144.10.000e+053.64SMESG000003144.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008553 ID=SMED30008553|Name=Phosphoenolpyruvate carboxykinase [GTP]|organism=Schmidtea mediterranea sexual|type=transcript|length=2105bp
TAATATAACCTTCGAAATTATAATTTATAATCATTATTTTTAGTCACGTA
ATAAATTTTATATAGAAATGATTTGGGAGAACGATACTGAAATACCTCAA
GAAGTTCATGAAGTGGTAATACCACATTTAGGCCACATGCCTATATGTAA
GGGTGATTATCATTATTTACCAAAAAAAGTCCAAGGCTTTATTGCTAAAT
GGGCACTCGTTTGCAAACCAAGAGCACTTTACATTTGTGATGGTGGTGAA
GATGAAGCAACGGAAATTATCACGAAATTGAAAGAAAGAGGCACTCTTCA
CTCTTTAACTAAATTAGAAAATTCCTTTATCTGTCGAACTGATCCAGATG
ATGTTGCAAGAGTTGAATCTAAAACATTTATTTCCACGAAAAATAAACAC
ATGACAGTTCCTCACGTAAAGGAAGGTTCTAAAGGAATTCTTGGTCAATG
GATTGCACCAGAGGACCTCAATGAAGAAGTTGCTGAACGTTTAAGAGGAT
GCATGGGCGGAAGAATGATGTATATCATTCCTTTTAGCATGGGCCCAATC
GGATCTCCTCTGAGCAAAATCGGTATCCAATTAACTGACAGCAACTATGT
CGTATTGTGCATGAGAATTATGACTCGAGTTAGTCCGCTTGTTTGGCACT
ATTTGAGTGACAATGCATTTGTAAAATGTGTTCATTCGGTTGGATGTCCT
CGACCACATCCAAGAAAAGTTATTAATCACTGGCCATGCAACCCTGAAAA
AACGTTGATTGCTCATTTACCAGATGAAAGATTAATTATTAGTTATGGCT
CTGGCTACGGAGGAAATTCTTTACTCGGCAAAAAATGTTTTGCTTTAAGA
ATAGCTGGCAGGATTGCTTATGATGAAGGGTGGATGGCTGAACATATGCT
TATTATGTCAGTTACCAATCCTAAGGGAGAAGAAAAGTTCATCGCCGCTG
CTTTCCCTAGTGCTTGTGGTAAGACTAACATGGCTATGTTGGAGCCAGGG
TTACCGGGATGGAAAGTGCAAGTTGTTGGTGATGACATTGCTTGGATGAG
ATTTGATGAACACGGTGTATTGCGTGCTATTAATCCTGAAGCTGGTTTCT
TTGGAGTTGCCCCGGGTACAAATTATAAGACAAATCCAAATGCCATGAAG
ACTTTCCAGAAGAATAGTATCTTTACAAATGTGGCTGAAACTAATGATGG
AAGTTATTATTGGGAAGGAATGGAAAAGGAAGTTGATCCAAATCTTGAAG
TTACATCTTGGCTCGGTGTTAAAATGAAAGTTGGAGATAAATCAAAGGGC
CCTGCAGCTCATCCTAACTCGCGTTTCTGTTGTCCTGCTAGTCAGTGTCC
TATTATCCACCCTAAATGGGAGGATCCACAGGGTGTACCTATTTCAGCAA
TTGTTTTTGGAGGTCGAAGACCAGAAGGAATTCCTTTGGTGATGCAAGCT
TTTGATTGGAAACATGGTGTGATGCTTGGTGCATCTCTTAAATCCGAGGC
CACAGCAGCTGCGGAATTTAAAGGCAAGCAGATTATGCATGATCCAATGG
CTATGCGACCGTTTATGGGATATAATTTCGGTAGATATCTTCAACATTGG
CTTGACCTGGAAAAGCCAGGTCGTAAAATGCCTTTGATATTCCATGTAAA
TTGGTTCCGTCTCAATGAGCAAGGCAAATTTGTGTGGCCTGGATTTGGTG
ATAATATTAGAGTTATTGATTGGATGTGCCGAAGAGTAAATGGAGAAGAC
ATTGCTGAACCAAGTCCCATCGGATTATTACCTAAAAAAGGAAGTCTTGA
TATCTCTGGCCTAGATGTTAAATGGGAAGAAATGTTCAATTTACCTAAAA
ACTATTTAGCCGAAGATATTCAAGAAACGAAAAAATTCCTTCGTGAGCAA
ACAGGAGAAGATCTACCGGCTGGAGTTATCCAACAATTGGATGAACAGGA
AAAGAGAATACATAATATGTAGTAACTATATAAATTATGGCTATAGCTTA
AAAATAGTTGGCACTTAGTGAACTAGTTTTATCATTTAATTTACATGGCG
TGCGACATTTGTATAACATTTAGAGAATAAATTGTTATAATTGTCTATAA
AAAAA
back to top

protein sequence of SMED30008553-orf-1

>SMED30008553-orf-1 ID=SMED30008553-orf-1|Name=SMED30008553-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=635bp
MIWENDTEIPQEVHEVVIPHLGHMPICKGDYHYLPKKVQGFIAKWALVCK
PRALYICDGGEDEATEIITKLKERGTLHSLTKLENSFICRTDPDDVARVE
SKTFISTKNKHMTVPHVKEGSKGILGQWIAPEDLNEEVAERLRGCMGGRM
MYIIPFSMGPIGSPLSKIGIQLTDSNYVVLCMRIMTRVSPLVWHYLSDNA
FVKCVHSVGCPRPHPRKVINHWPCNPEKTLIAHLPDERLIISYGSGYGGN
SLLGKKCFALRIAGRIAYDEGWMAEHMLIMSVTNPKGEEKFIAAAFPSAC
GKTNMAMLEPGLPGWKVQVVGDDIAWMRFDEHGVLRAINPEAGFFGVAPG
TNYKTNPNAMKTFQKNSIFTNVAETNDGSYYWEGMEKEVDPNLEVTSWLG
VKMKVGDKSKGPAAHPNSRFCCPASQCPIIHPKWEDPQGVPISAIVFGGR
RPEGIPLVMQAFDWKHGVMLGASLKSEATAAAEFKGKQIMHDPMAMRPFM
GYNFGRYLQHWLDLEKPGRKMPLIFHVNWFRLNEQGKFVWPGFGDNIRVI
DWMCRRVNGEDIAEPSPIGLLPKKGSLDISGLDVKWEEMFNLPKNYLAED
IQETKKFLREQTGEDLPAGVIQQLDEQEKRIHNM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000067goblet cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000418head
PLANA:0000428musculature system
PLANA:0000463cholinergic neuron
PLANA:0000478pharynx musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035077PEP_carboxykinase_GTP_C
IPR035078PEP_carboxykinase_GTP_N
IPR008210PEP_carboxykinase_N
IPR008209PEP_carboxykinase_GTP
IPR013035PEP_carboxykinase_C
IPR018091PEP_carboxykin_GTP_CS
Vocabulary: molecular function
TermDefinition
GO:0004611phosphoenolpyruvate carboxykinase activity
GO:0017076purine nucleotide binding
GO:0005525GTP binding
GO:0004613phosphoenolpyruvate carboxykinase (GTP) activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006094gluconeogenesis
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR035077Phosphoenolpyruvate carboxykinase, C-terminal P-loop domainPFAMPF00821PEPCK_GTPcoord: 272..631
e-value: 5.4E-162
score: 538.6
NoneNo IPR availableGENE3DG3DSA:2.170.8.10coord: 76..431
e-value: 1.1E-257
score: 857.7
NoneNo IPR availablePANTHERPTHR11561:SF13PHOSPHOENOLYPYRUVATE CARBOXYKINASEcoord: 11..633
NoneNo IPR availableSUPERFAMILYSSF53795PEP carboxykinase-likecoord: 272..633
IPR035078Phosphoenolpyruvate carboxykinase, GTP-utilising, N-terminalPFAMPF17297PEPCK_Ncoord: 41..267
e-value: 3.8E-88
score: 294.8
IPR008210Phosphoenolpyruvate carboxykinase, N-terminalGENE3DG3DSA:3.40.449.10coord: 37..274
e-value: 1.1E-257
score: 857.7
IPR008210Phosphoenolpyruvate carboxykinase, N-terminalSUPERFAMILYSSF68923PEP carboxykinase N-terminal domaincoord: 23..271
IPR008209Phosphoenolpyruvate carboxykinase, GTP-utilisingPIRSFPIRSF001348PEP_carboxykin_GTPcoord: 17..634
e-value: 2.3E-265
score: 879.0
IPR008209Phosphoenolpyruvate carboxykinase, GTP-utilisingPANTHERPTHR11561PHOSPHOENOLPYRUVATE CARBOXYKINASEcoord: 11..633
IPR008209Phosphoenolpyruvate carboxykinase, GTP-utilisingCDDcd00819PEPCK_GTPcoord: 38..627
e-value: 0.0
score: 957.849
IPR013035Phosphoenolpyruvate carboxykinase, C-terminalGENE3DG3DSA:3.90.228.20coord: 275..630
e-value: 1.1E-257
score: 857.7
IPR018091Phosphoenolpyruvate carboxykinase, GTP-utilising, conserved sitePROSITEPS00505PEPCK_GTPcoord: 296..304