Carbonic anhydrase 7

Overview
NameCarbonic anhydrase 7
Smed IDSMED30008552
Length (bp)911
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008552

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30008552h1SMcG0001657 HO005179.1smed_ncbi_20240424PMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30008552h1SMcG0001657 DN309696.1smed_ncbi_20240424PMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Carbonic anhydrase 7 vs. Ensembl Human
Match: CA1 (carbonic anhydrase 1 [Source:HGNC Symbol;Acc:HGNC:1368])

HSP 1 Score: 108.227 bits (269), Expect = 2.200e-34
Identity = 53/164 (32.32%), Postives = 88/164 (53.66%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGY  +NGP  W K Y  A G +QSP++I  S+TK+D +L      I +  +  +++ ++  GH+F +   D +      GGP  +   Y++ Q  FHWGST   GSEH ++  ++  E  +  +N+ +Y    EA +K DGL ++  ++   +  P +
Sbjct:    1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLK----PISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGP--FSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKL 158          

HSP 2 Score: 57.3806 bits (137), Expect = 2.200e-34
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N  L ++L  L +I   K    R      D   LLP  ++ ++TY GSLT PP YE+VTWII + S ++S +QL    +L+  V   +      N RP   L  R +  +F
Sbjct:  151 VGEANPKLQKVLDALQAI---KTKGKRAPFTNFDPSTLLPSSLD-FWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 261          
BLAST of Carbonic anhydrase 7 vs. Ensembl Human
Match: CA1 (carbonic anhydrase 1 [Source:HGNC Symbol;Acc:HGNC:1368])

HSP 1 Score: 108.227 bits (269), Expect = 2.200e-34
Identity = 53/164 (32.32%), Postives = 88/164 (53.66%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGY  +NGP  W K Y  A G +QSP++I  S+TK+D +L      I +  +  +++ ++  GH+F +   D +      GGP  +   Y++ Q  FHWGST   GSEH ++  ++  E  +  +N+ +Y    EA +K DGL ++  ++   +  P +
Sbjct:    1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLK----PISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGP--FSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKL 158          

HSP 2 Score: 57.3806 bits (137), Expect = 2.200e-34
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N  L ++L  L +I   K    R      D   LLP  ++ ++TY GSLT PP YE+VTWII + S ++S +QL    +L+  V   +      N RP   L  R +  +F
Sbjct:  151 VGEANPKLQKVLDALQAI---KTKGKRAPFTNFDPSTLLPSSLD-FWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 261          
BLAST of Carbonic anhydrase 7 vs. Ensembl Human
Match: CA1 (carbonic anhydrase 1 [Source:HGNC Symbol;Acc:HGNC:1368])

HSP 1 Score: 108.227 bits (269), Expect = 2.200e-34
Identity = 53/164 (32.32%), Postives = 88/164 (53.66%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGY  +NGP  W K Y  A G +QSP++I  S+TK+D +L      I +  +  +++ ++  GH+F +   D +      GGP  +   Y++ Q  FHWGST   GSEH ++  ++  E  +  +N+ +Y    EA +K DGL ++  ++   +  P +
Sbjct:    1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLK----PISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGP--FSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKL 158          

HSP 2 Score: 57.3806 bits (137), Expect = 2.200e-34
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N  L ++L  L +I   K    R      D   LLP  ++ ++TY GSLT PP YE+VTWII + S ++S +QL    +L+  V   +      N RP   L  R +  +F
Sbjct:  151 VGEANPKLQKVLDALQAI---KTKGKRAPFTNFDPSTLLPSSLD-FWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 261          
BLAST of Carbonic anhydrase 7 vs. Ensembl Human
Match: CA1 (carbonic anhydrase 1 [Source:HGNC Symbol;Acc:HGNC:1368])

HSP 1 Score: 108.227 bits (269), Expect = 2.200e-34
Identity = 53/164 (32.32%), Postives = 88/164 (53.66%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGY  +NGP  W K Y  A G +QSP++I  S+TK+D +L      I +  +  +++ ++  GH+F +   D +      GGP  +   Y++ Q  FHWGST   GSEH ++  ++  E  +  +N+ +Y    EA +K DGL ++  ++   +  P +
Sbjct:    1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLK----PISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGP--FSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKL 158          

HSP 2 Score: 57.3806 bits (137), Expect = 2.200e-34
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N  L ++L  L +I   K    R      D   LLP  ++ ++TY GSLT PP YE+VTWII + S ++S +QL    +L+  V   +      N RP   L  R +  +F
Sbjct:  151 VGEANPKLQKVLDALQAI---KTKGKRAPFTNFDPSTLLPSSLD-FWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 261          
BLAST of Carbonic anhydrase 7 vs. Ensembl Human
Match: CA1 (carbonic anhydrase 1 [Source:HGNC Symbol;Acc:HGNC:1368])

HSP 1 Score: 108.227 bits (269), Expect = 4.444e-33
Identity = 53/164 (32.32%), Postives = 88/164 (53.66%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGY  +NGP  W K Y  A G +QSP++I  S+TK+D +L      I +  +  +++ ++  GH+F +   D +      GGP  +   Y++ Q  FHWGST   GSEH ++  ++  E  +  +N+ +Y    EA +K DGL ++  ++   +  P +
Sbjct:    1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLK----PISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGP--FSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKL 158          

HSP 2 Score: 53.1434 bits (126), Expect = 4.444e-33
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL 736
            +G  N  L ++L  L +I   K    R      D   LLP  ++ ++TY GSLT PP YE+VTWII + S ++S +QL
Sbjct:  151 VGEANPKLQKVLDALQAI---KTKGKRAPFTNFDPSTLLPSSLD-FWTYPGSLTHPPLYESVTWIICKESISVSSEQL 224          
BLAST of Carbonic anhydrase 7 vs. Ensembl Celegans
Match: cah-5 (Putative carbonic anhydrase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q10462])

HSP 1 Score: 58.151 bits (139), Expect = 5.174e-20
Identity = 42/156 (26.92%), Postives = 61/156 (39.10%), Query Frame = 3
Query:   63 WGYGPENGPHLWHKSYSSAGGC----SQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQT--LVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGT 512
            WGY   NGP  W       G C     QSPI+I      Y +   +H L   +D     S T   +F G       +  +   GG       YK++Q   HWG     GSEH +    +P E  +   +        EA+++ DGL ++   +  T
Sbjct:   28 WGYDENNGPDTWQ------GKCQNHLKQSPIDIRAPDVDYALLHRMHFLNYDMDGKIELSNTGRTLFAGGFESWQHKQPMIQGGG---LKHRYKLAQFHLHWGQNDAVGSEHAMGSLHYPAELHLV--HVREGLTLKEALSRPDGLAVVGVFLAKT 172          

HSP 2 Score: 57.7658 bits (138), Expect = 5.174e-20
Identity = 33/111 (29.73%), Postives = 54/111 (48.65%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTS-IHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSL-GQRIITR 829
            +   N  +     P++  +H  +H   + E +    K +LP     ++ Y GSLTTP C E V W +      IS  QL+L++++H  +      N+RP+  L G+RI  R
Sbjct:  169 LAKTNDPVANKFSPISERLHDLRHSGNKTELKNFRTKYVLPLDTEAFYRYEGSLTTPDCSEAVIWTVLAEPMAISSHQLHLLRQLHNKELVKSDKNYRPLQPLNGRRIQYR 279          
BLAST of Carbonic anhydrase 7 vs. Ensembl Celegans
Match: cah-2 (Putative carbonic anhydrase-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q18932])

HSP 1 Score: 64.3142 bits (155), Expect = 1.029e-19
Identity = 49/150 (32.67%), Postives = 72/150 (48.00%), Query Frame = 3
Query:   84 GPHLW---HKSYSS-AGGCSQSPINIDLSQTKYD---MTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGP-IPYGQMYKISQIVFHWGSTIYG--GSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            GP  W   H  +     G  QSP+NID SQ  YD   M +N+    I       + Q  V T  +  +     +  +GGP +PY   YK+ QI  H+G    G  GSEH ++  +FP E Q+  YN+  Y  F+ A+    GL+ +S ++
Sbjct:   16 GPDFWGLLHGDWRMCTAGQMQSPVNIDPSQLLYDPHLMPINIE-GNIVEAVFENTGQLPVVTVKD--LPNRPTINITGGPTMPY--RYKLHQISVHFGRADEGEKGSEHTVDRVRFPAEIQLLAYNSALYPNFSVAMTSPRGLLAVSVIV 160          

HSP 2 Score: 50.8322 bits (120), Expect = 1.029e-19
Identity = 35/91 (38.46%), Postives = 45/91 (49.45%), Query Frame = 2
Query:  584 QETELLDLK--CLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL---NLMQKVHVADGCNGF--DNFRPVCSLGQRIITRNF 835
            Q T L D +   LLP   + Y TY GSLT P C+ETVTW+I      I+ D L   N MQK         +    +RP+ SL  R++  N 
Sbjct:  185 QTTNLTDFQPSALLPKT-SHYVTYEGSLTFPGCHETVTWVILNNPIYITNDDLQIWNEMQKTETKQPEPSYMTPAYRPLKSLNGRLVRTNI 274          
BLAST of Carbonic anhydrase 7 vs. Ensembl Celegans
Match: cah-3 (Putative carbonic anhydrase 3 [Source:UniProtKB/Swiss-Prot;Acc:Q27504])

HSP 1 Score: 57.7658 bits (138), Expect = 5.723e-17
Identity = 36/107 (33.64%), Postives = 50/107 (46.73%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRII 823
            + N+ + L +L  P T              E + L   LP     ++ Y GSLTTPPC E VTW IF    T++ DQL L ++V   +      N+RP  +L  R I
Sbjct:  144 LSNEERVLGKLCNPETVT----------RVENVRLSEKLPANKRSFWRYEGSLTTPPCSEIVTWTIFTEPVTVTHDQLELFRQVQDIEKRPIKKNYRPTQNLNDRKI 240          

HSP 2 Score: 47.7506 bits (112), Expect = 5.723e-17
Identity = 38/126 (30.16%), Postives = 54/126 (42.86%), Query Frame = 3
Query:   63 WGY--GPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYG----QMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMT 422
            W Y    E GP+ W        G  QSPINIDL + +   T   H     ++        +V  GH+ ++  E     S  P  YG    Q+Y++ Q  FHWG     GSEH +   ++P E  + 
Sbjct:    5 WSYCDDDECGPNRW------PTGQHQSPINIDLGEVERKDT---HDGIKFVNYDHPIQGDIVNNGHSVQMTPE---LRSEHPEIYGGGLDQVYRLVQYHFHWGENDNEGSEHTLGGLRYPAELHLV 118          
BLAST of Carbonic anhydrase 7 vs. Ensembl Celegans
Match: cah-1 (Putative carbonic anhydrase-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20781])

HSP 1 Score: 68.1662 bits (165), Expect = 5.785e-13
Identity = 46/156 (29.49%), Postives = 71/156 (45.51%), Query Frame = 3
Query:   63 WGYGPE--NGPHLW----HKSYSSAGGCSQSPINIDLSQTKYDMTLN---LHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            W Y  +   GPH W       +    G  QSPI+I   +  +D ++    L  L +  +   T     V  G++ +   + ++  + GP+ YG  Y++ +I FH G     GSEH IN  +FP E Q+  YN   Y  F  A     G+ ILS ++
Sbjct:   30 WSYDSDVFGGPHFWGLVEKDWWMCKKGRLQSPIDIQPDRLLFDASVKPVRLDKLPVVSEFVNTGQMVRVRIGYSSK---KPSVNITSGPL-YGYRYRVQRIDFHMGRKNENGSEHTINGRRFPMEVQLVAYNTDLYPNFTSASKSPHGIAILSVLV 181          
BLAST of Carbonic anhydrase 7 vs. Ensembl Celegans
Match: cah-4 (Carbonic AnHydrase [Source:UniProtKB/TrEMBL;Acc:Q21614])

HSP 1 Score: 44.2838 bits (103), Expect = 1.195e-10
Identity = 26/83 (31.33%), Postives = 40/83 (48.19%), Query Frame = 3
Query:  255 NFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            N + +C   L A+  P      + ++Q   HWGS    GSEH ++  Q   E     +N T Y  FN A++K DGL ++   +
Sbjct:   51 NVKRNCGTFLTANHLP---SSKFALAQFHAHWGSNSKEGSEHFLDGKQLSGEVHFVFWN-TSYESFNVALSKPDGLAVVGVFL 129          

HSP 2 Score: 40.0466 bits (92), Expect = 1.195e-10
Identity = 22/48 (45.83%), Postives = 28/48 (58.33%), Query Frame = 2
Query:  614 LLPDCINRYF-TYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKV 754
            LLP    R F TY GSLTTPP  E V W +F     +S  QLN+++ +
Sbjct:  166 LLPSPDKREFVTYLGSLTTPPYNECVIWTLFTEPVEVSFGQLNVLRNI 213          
BLAST of Carbonic anhydrase 7 vs. Ensembl Fly
Match: CAH1 (gene:FBgn0027844 transcript:FBtr0080539)

HSP 1 Score: 100.523 bits (249), Expect = 3.420e-36
Identity = 58/152 (38.16%), Postives = 79/152 (51.97%), Query Frame = 3
Query:   51 ISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCA-SGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            +S  WGY  ENGP  W K Y  A G  QSP++I  S  K    LN+ PLK       T S  LV  G+ +R+D  GA    +GGP+   Q++K+ Q   HWG T   GSEH ++   +  E  +  +N T+Y+ F EA    DGL +L   +
Sbjct:    1 MSHHWGYTEENGPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKS--LVNPGYCWRVDVNGADSELTGGPL-GDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFL 149          

HSP 2 Score: 70.4774 bits (171), Expect = 3.420e-36
Identity = 47/121 (38.84%), Postives = 68/121 (56.20%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQET--ELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVAD-----GCNGF-----DNFRPVCSLGQR 817
            ++   GN +  LD++    TS+  F  H   + T  +  D   LLPD ++ Y+TY GSLTTPPC E+V WI+F+    +S+DQLN M+ ++  D      CN F     +NFRP   LG+R
Sbjct:  147 VFLKAGNHHAELDKV----TSLLQFVLHKGDRVTLPQGCDPGQLLPD-VHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFRPPLPLGKR 262          
BLAST of Carbonic anhydrase 7 vs. Ensembl Fly
Match: CAH2 (gene:FBgn0027843 transcript:FBtr0076001)

HSP 1 Score: 65.0846 bits (157), Expect = 1.103e-23
Identity = 46/160 (28.75%), Postives = 72/160 (45.00%), Query Frame = 3
Query:   45 FMISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDL--SQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDC----EGALCASGGPI----PYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILS 494
             ++++D+GY   +GP  W + Y+   G  QSPINID   +  K    L     K+  D+ + ++      GH   +      +      GGP+    P G  Y+  Q  FHWG     GSE LIN   +P E  +   N   Y  F  A++K  G+ +++
Sbjct:   22 LVLAQDFGYEGRHGPEHWSEDYARCSGKHQSPINIDQVSAVEKKFPKLEFFNFKVVPDNLQMTN-----NGHTVLVKMSYNEDEIPSVRGGPLAEKTPLG--YQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRN-LEYPDFASALDKDHGIAVMA 173          

HSP 2 Score: 63.929 bits (154), Expect = 1.103e-23
Identity = 34/83 (40.96%), Postives = 48/83 (57.83%), Query Frame = 2
Query:  590 TELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRIITRNFV 838
            T  L L   +   +  YF+YTGSLTTPPC E VTWI F     I+E QLN   ++  A+  +  +NFRP+  L  R + +N++
Sbjct:  206 TNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAF-RLLTANDDHLKNNFRPIQPLNDRTLYKNYI 287          
BLAST of Carbonic anhydrase 7 vs. Ensembl Fly
Match: CARPB (gene:FBgn0052698 transcript:FBtr0346170)

HSP 1 Score: 65.4698 bits (158), Expect = 1.376e-19
Identity = 47/161 (29.19%), Postives = 79/161 (49.07%), Query Frame = 3
Query:   63 WGYGPENGPHLW---HKSYSS-AGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSS------QTLVFTGHNFRID----CEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            W Y   +GP  W   +  +S    G  QSP+N++  +  +D   NL P+ I  D  R S        +++FT  N  +      +  +  SGGP+ Y   Y+  +I  H+G     GSEH +  + FP E Q+  YN+  Y  F++A+N+  G++ +S ++
Sbjct:   30 WTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDP--NLRPMHI--DKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSY--RYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILL 184          

HSP 2 Score: 49.6766 bits (117), Expect = 1.376e-19
Identity = 37/111 (33.33%), Postives = 50/111 (45.05%), Query Frame = 2
Query:  515 NKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLN----LMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            N  L  L   L  I +     F    + L ++ LLPD  + Y TY GS T P C+ETVTW++      I++ QL+    LMQ           +N+RP   L  R I  N 
Sbjct:  191 NAELRMLTDQLERIRYGGDEAF---VKRLSIRGLLPDT-DHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNI 297          
BLAST of Carbonic anhydrase 7 vs. Ensembl Fly
Match: CARPB (gene:FBgn0052698 transcript:FBtr0336923)

HSP 1 Score: 65.4698 bits (158), Expect = 1.376e-19
Identity = 47/161 (29.19%), Postives = 79/161 (49.07%), Query Frame = 3
Query:   63 WGYGPENGPHLW---HKSYSS-AGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSS------QTLVFTGHNFRID----CEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            W Y   +GP  W   +  +S    G  QSP+N++  +  +D   NL P+ I  D  R S        +++FT  N  +      +  +  SGGP+ Y   Y+  +I  H+G     GSEH +  + FP E Q+  YN+  Y  F++A+N+  G++ +S ++
Sbjct:   30 WTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDP--NLRPMHI--DKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSY--RYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILL 184          

HSP 2 Score: 49.6766 bits (117), Expect = 1.376e-19
Identity = 37/111 (33.33%), Postives = 50/111 (45.05%), Query Frame = 2
Query:  515 NKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLN----LMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            N  L  L   L  I +     F    + L ++ LLPD  + Y TY GS T P C+ETVTW++      I++ QL+    LMQ           +N+RP   L  R I  N 
Sbjct:  191 NAELRMLTDQLERIRYGGDEAF---VKRLSIRGLLPDT-DHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNI 297          
BLAST of Carbonic anhydrase 7 vs. Ensembl Fly
Match: CARPB (gene:FBgn0052698 transcript:FBtr0307489)

HSP 1 Score: 65.4698 bits (158), Expect = 1.376e-19
Identity = 47/161 (29.19%), Postives = 79/161 (49.07%), Query Frame = 3
Query:   63 WGYGPENGPHLW---HKSYSS-AGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSS------QTLVFTGHNFRID----CEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            W Y   +GP  W   +  +S    G  QSP+N++  +  +D   NL P+ I  D  R S        +++FT  N  +      +  +  SGGP+ Y   Y+  +I  H+G     GSEH +  + FP E Q+  YN+  Y  F++A+N+  G++ +S ++
Sbjct:   30 WTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDP--NLRPMHI--DKHRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSY--RYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILL 184          

HSP 2 Score: 49.6766 bits (117), Expect = 1.376e-19
Identity = 37/111 (33.33%), Postives = 50/111 (45.05%), Query Frame = 2
Query:  515 NKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLN----LMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            N  L  L   L  I +     F    + L ++ LLPD  + Y TY GS T P C+ETVTW++      I++ QL+    LMQ           +N+RP   L  R I  N 
Sbjct:  191 NAELRMLTDQLERIRYGGDEAF---VKRLSIRGLLPDT-DHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNI 297          
BLAST of Carbonic anhydrase 7 vs. Ensembl Zebrafish
Match: cahz (carbonic anhydrase [Source:NCBI gene;Acc:30331])

HSP 1 Score: 105.531 bits (262), Expect = 5.402e-34
Identity = 58/154 (37.66%), Postives = 90/154 (58.44%), Query Frame = 3
Query:   51 ISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDC---EGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            ++  WGYGP +GP  W +S+  A G  QSPI+I  +Q ++D +L    LK+  D + T S  ++  GH+F++D    + +   +GGPI    +Y++ Q  FHWGS+   GSEH I   +FPCE  +  +N T+Y  F EA +K DGL ++   +
Sbjct:    1 MAHAWGYGPADGPESWAESFPIANGPRQSPIDIVPTQAQHDPSLKH--LKLKYDPATTKS--ILNNGHSFQVDFVDDDNSSTLAGGPI--TGIYRLRQFHFHWGSSDDKGSEHTIAGTKFPCELHLVHWN-TKYPNFGEAASKPDGLAVVGVFL 147          

HSP 2 Score: 58.5362 bits (140), Expect = 5.402e-34
Identity = 41/120 (34.17%), Postives = 59/120 (49.17%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQET-ELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            ++  IG  N  L ++L  L  I        RQ T    D K LLP  ++ Y+TY GSLTTPP  E+VTWI+ +   ++S  Q+    +L+        C   DN+RP   L  R +  +F
Sbjct:  145 VFLKIGAANPRLQKVLDALDDIK----SKGRQTTFANFDPKTLLPASLD-YWTYEGSLTTPPLLESVTWIVLKEPISVSPAQMAKFRSLLFSSEGETPCCMVDNYRPPQPLKGRKVRASF 259          
BLAST of Carbonic anhydrase 7 vs. Ensembl Zebrafish
Match: ca2 (carbonic anhydrase II [Source:ZFIN;Acc:ZDB-GENE-031219-5])

HSP 1 Score: 100.138 bits (248), Expect = 2.635e-32
Identity = 57/154 (37.01%), Postives = 85/154 (55.19%), Query Frame = 3
Query:   51 ISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFR---IDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            +++ WGY   NGP  W +SY  A G  QSPI+I  S T YD  L   PLK+  D S  +S  +   GH+F+   +D + +   +GGP+     +++ Q  FHWGS    GSEH +N   +P E  +  +N T+Y  F +AV+K DGL ++   +
Sbjct:    1 MADHWGYDKHNGPDKWGESYPIANGSRQSPIDIKSSTTTYDEKLT--PLKLKYDPS--TSLDIQNNGHSFQVSFVDDQNSSTLTGGPV--TGTFRLKQFHFHWGSADDKGSEHTVNGKCYPAELHLVHWN-TKYPSFKDAVDKPDGLAVVGVFL 147          

HSP 2 Score: 57.7658 bits (138), Expect = 2.635e-32
Identity = 38/119 (31.93%), Postives = 61/119 (51.26%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQK-VHVADG---CNGFDNFRPVCSLGQRIITRNF 835
            ++  IG  N  L ++L  + +I   K    +      D   LLP  ++ Y+TY GSLTTPP  E+VTWI+ + S ++S  Q+   +  +   DG   C   +N+RP   L  R++  +F
Sbjct:  145 VFLKIGADNPKLQKILDAMDAI---KSKGKQTPFPNFDPSVLLPSSLD-YWTYLGSLTTPPLLESVTWIVCKQSISVSSAQMKRFRSLLFSGDGEKACCMVNNYRPPQPLKGRVVRASF 259          
BLAST of Carbonic anhydrase 7 vs. Ensembl Zebrafish
Match: ca7 (carbonic anhydrase VII [Source:ZFIN;Acc:ZDB-GENE-040426-1786])

HSP 1 Score: 95.5153 bits (236), Expect = 6.164e-32
Identity = 54/155 (34.84%), Postives = 79/155 (50.97%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            M    WGYG +NGP  WHK Y  A G  QSPI+I  S+  +D  L+     I +  +  +S ++   GH+  +   D +     +GGP+    MY++ Q  FHWGS    GSEH +    F  E  +  +NA +Y+ F+EA    DGL +L   +
Sbjct:    1 MTGHHWGYGEDNGPSAWHKDYPIAEGNRQSPIDIVPSEAVFDAKLS----PISLSYNNCTSLSISNNGHSVVVEFVDTDERSVITGGPLE--NMYRLKQFHFHWGSKGCCGSEHTVAGKTFVSELHLVHWNANKYKSFSEAAAAPDGLAVLGIFL 149          

HSP 2 Score: 61.2326 bits (147), Expect = 6.164e-32
Identity = 38/120 (31.67%), Postives = 62/120 (51.67%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLN-----LMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            I+ + G++++ L ++   L  + F        E +  + KCLLP+ +  Y+TY GSLTTPP YE+VTWI+ +    +SE Q+      L       D     +N+RP   L  R++  +F
Sbjct:  147 IFLETGDEHRALHQITDALYMVRF---KGSLAEFKGFNPKCLLPNSL-EYWTYPGSLTTPPLYESVTWIVLKEPIYVSEKQMGKFRTLLFNGEEEEDRNRMENNYRPPQPLKGRMVRASF 262          
BLAST of Carbonic anhydrase 7 vs. Ensembl Zebrafish
Match: ca7 (carbonic anhydrase VII [Source:ZFIN;Acc:ZDB-GENE-040426-1786])

HSP 1 Score: 97.0561 bits (240), Expect = 1.308e-31
Identity = 55/158 (34.81%), Postives = 81/158 (51.27%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGT 512
            M    WGYG +NGP  WHK Y  A G  QSPI+I  S+  +D  L+     I +  +  +S ++   GH+  +   D +     +GGP+    MY++ Q  FHWGS    GSEH +    F  E  +  +NA +Y+ F+EA    DGL +L   + G+
Sbjct:    1 MTGHHWGYGEDNGPSAWHKDYPIAEGNRQSPIDIVPSEAVFDAKLS----PISLSYNNCTSLSISNNGHSVVVEFVDTDERSVITGGPLE--NMYRLKQFHFHWGSKGCCGSEHTVAGKTFVSELHLVHWNANKYKSFSEAAAAPDGLAVLGIFLEGS 152          

HSP 2 Score: 58.5362 bits (140), Expect = 1.308e-31
Identity = 32/81 (39.51%), Postives = 45/81 (55.56%), Query Frame = 2
Query:  608 KCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLN-----LMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            KCLLP+ +  Y+TY GSLTTPP YE+VTWI+ +    +SE Q+      L       D     +N+RP   L  R++  +F
Sbjct:  162 KCLLPNSL-EYWTYPGSLTTPPLYESVTWIVLKEPIYVSEKQMGKFRTLLFNGEEEEDRNRMENNYRPPQPLKGRMVRASF 241          
BLAST of Carbonic anhydrase 7 vs. Ensembl Zebrafish
Match: ca8 (carbonic anhydrase VIII [Source:ZFIN;Acc:ZDB-GENE-050417-26])

HSP 1 Score: 89.7373 bits (221), Expect = 8.754e-30
Identity = 49/152 (32.24%), Postives = 79/152 (51.97%), Query Frame = 3
Query:   60 DWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYD---MTLNLHP-LKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            DWGY  E G   W   +  A G  QSPIN++  + +YD   + + L+P   +C D        ++  GH  RI  +     +GGP+P    Y++S++ FHWG     GSEH +N   FP E  +  +N+T +    EA+ K+ G++I++  +
Sbjct:   19 DWGY--EEGVE-WGLLFPEANGEYQSPINLNSREARYDPQLLDVGLNPNYVVCRDCE------VINDGHTVRIMLKSKSVVTGGPLPSDHEYELSEVRFHWGKENQRGSEHTVNFKAFPMELHLIHWNSTLFNSVEEAMGKKRGILIIALFV 161          

HSP 2 Score: 60.077 bits (144), Expect = 8.754e-30
Identity = 34/84 (40.48%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  614 LLPDCINR-YFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKV-------HVADGCNGF--DNFRPVCSLGQRIITRNF 835
            LLPD + R Y+ Y GSLTTPPC E VTWI++    TIS+ Q+   +++        + +G +G   DNFRP   L  R++   F
Sbjct:  197 LLPDPLLRDYWVYEGSLTTPPCSENVTWILYRYPLTISQMQIEEFRRLRSHVKGAELPEGNDGMLGDNFRPTQPLSDRVVRAAF 280          
BLAST of Carbonic anhydrase 7 vs. Ensembl Xenopus
Match: ca8 (carbonic anhydrase VIII [Source:NCBI gene;Acc:496646])

HSP 1 Score: 90.5077 bits (223), Expect = 1.467e-31
Identity = 51/152 (33.55%), Postives = 80/152 (52.63%), Query Frame = 3
Query:   54 SEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQ--TLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            +++WGY  E G   W   Y  A G  QSPINI+  +  YD +L    L++ +  S    +   ++  GH  +I  +      GGP+P G  Y+++++ FHWG     GSEH +N   FP E  +  +N+T YR   EA+ K  G++I+S  +
Sbjct:   18 NQEWGY--EEGVE-WGLLYPEANGDYQSPININSREAMYDPSL----LEVRLTPSYVVCRDCEVINDGHVVQILLKSKSVLKGGPLPRGHEYELNEVRFHWGKENQRGSEHTVNFKAFPMELHLIHWNSTLYRSLEEAMGKVHGIVIISLFV 162          

HSP 2 Score: 65.4698 bits (158), Expect = 1.467e-31
Identity = 37/84 (44.05%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  614 LLPDCINR-YFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVH-------VADGCNGF--DNFRPVCSLGQRIITRNF 835
            LLPD + R Y+ Y GSLT PPC E VTWI+F    T+S+ Q+   +++        + DGC+G   DNFRP   L  RII   F
Sbjct:  198 LLPDPLLRDYWVYEGSLTMPPCSEGVTWILFRYPLTVSQTQIEEFRRLRTHIKGADLPDGCDGLMADNFRPTQPLSDRIIRAAF 281          
BLAST of Carbonic anhydrase 7 vs. Ensembl Xenopus
Match: proca1 (protein interacting with cyclin A1 [Source:Xenbase;Acc:XB-GENE-1005546])

HSP 1 Score: 94.3597 bits (233), Expect = 3.190e-31
Identity = 53/150 (35.33%), Postives = 78/150 (52.00%), Query Frame = 3
Query:   63 WGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            WGYG E+GP  WH  +  A G  QSPI+I  +Q  ++ +LN  PL I  D    +S  L   GH+  +   D +     +GGP+     Y++ Q  FHWG+    GSEH ++   +PCE  +  +NA  Y  F EA    DGL+++   +
Sbjct:    7 WGYGEEDGPSEWHHYFPIAEGNRQSPIDIVSNQAVFNPSLN--PLVISYD--HCTSINLSNNGHSVMVEFDDYDDKTVITGGPLE--GSYRLKQFHFHWGTQRNSGSEHTVDGKSYPCELHLVHWNARAYSSFGEAAAAPDGLVVIGVFL 150          

HSP 2 Score: 60.4622 bits (145), Expect = 3.190e-31
Identity = 38/121 (31.40%), Postives = 61/121 (50.41%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADG------CNGFDNFRPVCSLGQRIITRNF 835
            ++ + G ++  L+RL   L  + F      + + +  + KCLLP     Y+TY GSLTTPP  E+VTWI+ +    +SE Q+   +K  +  G       +  +NFRP   L  R +  +F
Sbjct:  148 VFLETGGQHSGLNRLTDALYMVKF---KGTKTQFDDFNPKCLLPSSF-EYWTYPGSLTTPPLNESVTWIVLKEPIKVSEKQMERFRKTLLFSGEEEEQRIHMVNNFRPPQPLKGRKVQASF 264          
BLAST of Carbonic anhydrase 7 vs. Ensembl Xenopus
Match: ca13 (carbonic anhydrase XIII [Source:NCBI gene;Acc:779902])

HSP 1 Score: 91.2781 bits (225), Expect = 3.709e-28
Identity = 51/150 (34.00%), Postives = 76/150 (50.67%), Query Frame = 3
Query:   63 WGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            WGY   NGP +WH  +  A G  QSPINI      YD +L   PL++  D    S++ ++ TGH F +   D +      GGP  +   Y++ Q  FHWGS+   GSEH ++   +  E  +  +N+ ++  F EA    DGL +L   +
Sbjct:    5 WGYEDHNGPEVWHDLFPLANGDRQSPINIITRDAIYDPSLQ--PLQVNYD--HDSAKVVINTGHTFTMEFDDGDDTSVLRGGP--FIGSYRLRQFHFHWGSSDGHGSEHKVDGMDYAAELHIVHWNSEKFSSFVEAACAPDGLAVLGVFL 148          

HSP 2 Score: 53.5286 bits (127), Expect = 3.709e-28
Identity = 33/122 (27.05%), Postives = 58/122 (47.54%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLN------LMQKVHVADGCNGFDNFRPVCSLGQRIITRNFV 838
            ++  +G  N+ ++R+     +I   +    +      D  CLLP  ++ ++TY GSLT PP  E+VTW++ +   +IS +QL         +     + C    N RPV  L  R +  +F+
Sbjct:  146 VFLKVGEPNRYIERITDTFGAI---RSKGKQSPFTNFDPSCLLPASMD-FWTYPGSLTVPPLLESVTWVVLKEPISISHEQLARFRSLLFTKDTAEIEACCMKSNHRPVQPLKNRKVRASFL 263          
BLAST of Carbonic anhydrase 7 vs. Ensembl Xenopus
Match: smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:Xenbase;Acc:XB-GENE-494817])

HSP 1 Score: 98.5969 bits (244), Expect = 7.536e-28
Identity = 56/163 (34.36%), Postives = 86/163 (52.76%), Query Frame = 3
Query:   51 ISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            ++  WGYGP+NGP  WH ++  A G  QSPINI  ++ KYD   +L P+ I  D S  +++ ++  GH F +   D E     SGG +     Y++ Q  FHWGS    GSEH ++  ++  E  +  +N T+Y    EAV   DGL ++   +   +  P +
Sbjct:    1 MAHAWGYGPDNGPATWHHAFPIAHGDHQSPINIVSAEAKYDH--HLKPISIKYDPS--TAKVILNNGHAFNVEFDDSEDKSVLSGGAV--SHPYRLKQFHFHWGSCDGHGSEHTVDGVKYEAELHLVHWN-TKYASMAEAVKHCDGLAVVGVFLKVGEAHPGL 156          

HSP 2 Score: 45.4394 bits (106), Expect = 7.536e-28
Identity = 28/82 (34.15%), Postives = 43/82 (52.44%), Query Frame = 2
Query:  602 DLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHV-ADG---CNGFDNFRPVCSLGQRIITRNF 835
            D   LLP+ ++ ++ Y GSLTTPP  + V W +      +S  QL+ ++ +   A+G   C   DNFRP   L  R +  +F
Sbjct:  179 DPSVLLPNSLD-FWNYKGSLTTPPLLQCVLWHVLREPIAVSNQQLSQLRSLFFNAEGDTPCCMVDNFRPPQPLKSRHVRASF 259          
BLAST of Carbonic anhydrase 7 vs. Ensembl Xenopus
Match: CA1 (carbonic anhydrase I [Source:NCBI gene;Acc:100496485])

HSP 1 Score: 83.9593 bits (206), Expect = 1.093e-27
Identity = 46/143 (32.17%), Postives = 74/143 (51.75%), Query Frame = 3
Query:   84 GPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            GP  WHK Y  A G SQSPI++   + K D +L      + I  +  S ++LV  GH+F++   D E     + GP+     Y+++Q  FHWG++   GSEH ++   +  E  +  +N+ +Y  F EA    DG  +++  I
Sbjct:    1 GPDQWHKLYPIANGDSQSPIDVKSGEAKADESLK----SLSIRYNSDSIKSLVNVGHSFQVLAEDKENPSVVAQGPL--KATYRLNQFHFHWGASNDFGSEHTVDGKGYAAELHLVHWNSDKYSSFAEASKNPDGCAVVTVFI 137          

HSP 2 Score: 59.3066 bits (142), Expect = 1.093e-27
Identity = 41/120 (34.17%), Postives = 61/120 (50.83%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHF-FKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKV-HVADG---CNGFDNFRPVCSLGQRIITRNF 835
            ++  + N +K+L R++  L  I    K   F       D   LLP  ++ Y+TY GSLT PP  E VTWIIF+   + S +Q+NL +++   A+G   C    N RP   L  R +  +F
Sbjct:  135 VFIKVSNPHKSLQRVVEALELIAAKGKQAAFTN----FDASTLLPASMD-YWTYQGSLTHPPLLECVTWIIFKEPISASSEQINLFRRILSSAEGEEACPVLANHRPTQPLKGREVRASF 249          
BLAST of Carbonic anhydrase 7 vs. Ensembl Mouse
Match: Car1 (carbonic anhydrase 1 [Source:MGI Symbol;Acc:MGI:88268])

HSP 1 Score: 109.768 bits (273), Expect = 1.321e-34
Identity = 58/164 (35.37%), Postives = 91/164 (55.49%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGYG ENGP  W K Y  A G +QSPI+I  S+  +D +L   PL I  + +  +++ +V  GH+F +   D        GGP+     Y+++Q  FHWG++   GSEH ++  ++  E  +  +N+ +Y   +EA++K DGL IL  ++      PS+
Sbjct:    1 MASADWGYGSENGPDQWSKLYPIANGNNQSPIDIKTSEANHDSSLK--PLSISYNPA--TAKEIVNVGHSFHVIFDDSSNQSVLKGGPL--ADSYRLTQFHFHWGNSNDHGSEHTVDGTRYSGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPANPSL 158          

HSP 2 Score: 55.8398 bits (133), Expect = 1.321e-34
Identity = 37/115 (32.17%), Postives = 55/115 (47.83%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N +L ++L  L S+   K    R      D   LLP  ++ Y+TY GSLT PP +E+VTW+I + S ++S +QL     L+             N RP   L  R +  +F
Sbjct:  151 VGPANPSLQKVLDALNSV---KTKGKRAPFTNFDPSSLLPSSLD-YWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF 261          
BLAST of Carbonic anhydrase 7 vs. Ensembl Mouse
Match: Car1 (carbonic anhydrase 1 [Source:MGI Symbol;Acc:MGI:88268])

HSP 1 Score: 109.768 bits (273), Expect = 1.321e-34
Identity = 58/164 (35.37%), Postives = 91/164 (55.49%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGYG ENGP  W K Y  A G +QSPI+I  S+  +D +L   PL I  + +  +++ +V  GH+F +   D        GGP+     Y+++Q  FHWG++   GSEH ++  ++  E  +  +N+ +Y   +EA++K DGL IL  ++      PS+
Sbjct:    1 MASADWGYGSENGPDQWSKLYPIANGNNQSPIDIKTSEANHDSSLK--PLSISYNPA--TAKEIVNVGHSFHVIFDDSSNQSVLKGGPL--ADSYRLTQFHFHWGNSNDHGSEHTVDGTRYSGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPANPSL 158          

HSP 2 Score: 55.8398 bits (133), Expect = 1.321e-34
Identity = 37/115 (32.17%), Postives = 55/115 (47.83%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N +L ++L  L S+   K    R      D   LLP  ++ Y+TY GSLT PP +E+VTW+I + S ++S +QL     L+             N RP   L  R +  +F
Sbjct:  151 VGPANPSLQKVLDALNSV---KTKGKRAPFTNFDPSSLLPSSLD-YWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF 261          
BLAST of Carbonic anhydrase 7 vs. Ensembl Mouse
Match: Car13 (carbonic anhydrase 13 [Source:MGI Symbol;Acc:MGI:1931322])

HSP 1 Score: 96.2857 bits (238), Expect = 7.647e-30
Identity = 53/155 (34.19%), Postives = 81/155 (52.26%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRID---CEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            M    WGYG  NGP  W++ +  A G  QSPI I   + KYD +L   PL I  D +  S++ +  +GH+F +D    E      GGP+     Y++ Q   HWGS    GSEH+++  ++  E  +  +N+ +Y  F EA ++ DGL +L   +
Sbjct:    1 MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLR--PLSIKYDPA--SAKIISNSGHSFNVDFDDTEDKSVLRGGPLTGN--YRLRQFHLHWGSADDHGSEHVVDGVRYAAELHVVHWNSDKYPSFVEAAHESDGLAVLGVFL 149          

HSP 2 Score: 53.5286 bits (127), Expect = 7.647e-30
Identity = 39/119 (32.77%), Postives = 56/119 (47.06%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVH-VADGCNG---FDNFRPVCSLGQRIITRNF 835
            ++  IG  N  L ++   L SI   K    +      D  CLLP   + Y+TY GSLT PP  E+VTWI+ +   +IS  QL   + +   A+G +      N RP   L  R +  +F
Sbjct:  147 VFLQIGEHNPQLQKITDILDSI---KEKGKQTRFTNFDPLCLLPSSWD-YWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAAFLLSNHRPPQPLKGRRVRASF 261          
BLAST of Carbonic anhydrase 7 vs. Ensembl Mouse
Match: Car8 (carbonic anhydrase 8 [Source:MGI Symbol;Acc:MGI:88253])

HSP 1 Score: 83.1889 bits (204), Expect = 7.127e-29
Identity = 45/140 (32.14%), Postives = 72/140 (51.43%), Query Frame = 3
Query:   96 WHKSYSSAGGCSQSPINIDLSQTKYDMTL---NLHP-LKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            W   +  A G  QSPIN++  + +YD +L    L P   +C D   T+       GH  ++  +     SGGP+P GQ +++ ++ FHWG     GSEH +N   FP E  +  +N+T +   +EAV K  G+ I++  +
Sbjct:   38 WGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTND------GHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFV 171          

HSP 2 Score: 63.5438 bits (153), Expect = 7.127e-29
Identity = 36/84 (42.86%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  614 LLPDCINR-YFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKV-------HVADGCNGF--DNFRPVCSLGQRIITRNF 835
            LLPD + R Y+ Y GSLT PPC E VTWI+F    TIS+ Q+   +++        + +GC+G   DNFRP   L  R+I   F
Sbjct:  207 LLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAF 290          
BLAST of Carbonic anhydrase 7 vs. Ensembl Mouse
Match: Car5a (carbonic anhydrase 5a, mitochondrial [Source:MGI Symbol;Acc:MGI:101946])

HSP 1 Score: 83.5741 bits (205), Expect = 4.901e-28
Identity = 49/141 (34.75%), Postives = 77/141 (54.61%), Query Frame = 3
Query:   93 LWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRID----CEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            LW    SSA G  QSPINI    + YD    L PL++  D++  S + L  TG+ F+++    CE +   SGGP+  G  Y++ Q  FHWG+T   GSEH ++   +P E  +  +N+T+Y  + +A    +GL ++   +
Sbjct:   45 LWTGPVSSAEGTRQSPINIQWKDSVYDP--QLAPLRVSYDAA--SCRYLWNTGYFFQVEFDDSCEDS-GISGGPL--GNHYRLKQFHFHWGATDEWGSEHAVDGHTYPAELHLVHWNSTKYENYKKASVGENGLAVIGVFL 178          

HSP 2 Score: 60.077 bits (144), Expect = 4.901e-28
Identity = 37/119 (31.09%), Postives = 61/119 (51.26%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFD----NFRPVCSLGQRIITRNF 835
            ++  +G  ++ L +L+  L  +   +H D +      D  CLLP C + Y+TY GSLTTPP  E+VTWI+ +    +S  QL+  + +  +      D    N+RP+  L  R +  +F
Sbjct:  176 VFLKLGAHHQALQKLVDVLPEV---RHKDTQVAMGPFDPSCLLPACRD-YWTYPGSLTTPPLAESVTWIVQKTPVEVSPSQLSTFRTLLFSGRGEEEDVMVNNYRPLQPLRDRKLRSSF 290          
BLAST of Carbonic anhydrase 7 vs. UniProt/SwissProt
Match: sp|P48282|CAH1_SHEEP (Carbonic anhydrase 1 OS=Ovis aries OX=9940 GN=CA1 PE=2 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 1.067e-34
Identity = 60/164 (36.59%), Postives = 96/164 (58.54%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCAS---GGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGY  ENGP  W K +  A G +QSPI+I  S+TK D +L   PL I  + +  +++ +V  GH+F ++ E +   S   GGP+P  + Y++ Q  FHWGST   GSEHL++   F  E  +  +N+ +Y  F +A ++ DGL+++  ++   +  P++
Sbjct:    1 MASPDWGYDGENGPEHWCKLHPIANGNNQSPIDIKTSETKRDPSLK--PLSISYNPA--TAKEIVNVGHSFHVNFEDSDNRSVLKGGPLP--ESYRLRQFHFHWGSTDDCGSEHLVDGATFSAELHLVHWNSAKYPSFADAASQADGLVVVGVLMKVGQANPNL 158          

HSP 2 Score: 57.3806 bits (137), Expect = 1.067e-34
Identity = 37/115 (32.17%), Postives = 59/115 (51.30%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHV-ADGCNGF---DNFRPVCSLGQRIITRNF 835
            +G  N  L ++L  L ++   K  + +      D   LLP C + Y+ Y GSLT PP +E+VTWIIF+ + ++S +QL   + +   A+G        N+RP   L  R +  +F
Sbjct:  151 VGQANPNLQKVLDALKTV---KTKNKKAPFTNFDPSVLLPSCPD-YWAYFGSLTHPPLHESVTWIIFKETISVSAEQLAQFRSLLANAEGDKEVCIKQNYRPPQPLKGRTVKASF 261          
BLAST of Carbonic anhydrase 7 vs. UniProt/SwissProt
Match: sp|Q7M316|CAH1_GORGO (Carbonic anhydrase 1 OS=Gorilla gorilla gorilla OX=9595 GN=CA1 PE=3 SV=3)

HSP 1 Score: 110.153 bits (274), Expect = 2.518e-34
Identity = 54/164 (32.93%), Postives = 89/164 (54.27%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGY  +NGP  W K Y  A G +QSP++I  S+TK+D +L      I +  +  +++ ++  GH+F +   D +      GGP+     Y++ Q  FHWGST   GSEH ++  ++  E  +T +N+ +Y    EA +K DGL ++  ++   +  P +
Sbjct:    1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLK----PISVSYNPATAKEIINVGHSFHVTFEDNDNRSVLKGGPL--SDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHLTHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKL 158          

HSP 2 Score: 57.3806 bits (137), Expect = 2.518e-34
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N  L ++L  L +I   K    R      D   LLP  ++ ++TY GSLT PP YE+VTWII + S ++S +QL    +L+  V   +      N RP   L  R +  +F
Sbjct:  151 VGEANPKLQKILDALQAI---KTKGKRAPFTNFDPSTLLPSSLD-FWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 261          
BLAST of Carbonic anhydrase 7 vs. UniProt/SwissProt
Match: sp|P13634|CAH1_MOUSE (Carbonic anhydrase 1 OS=Mus musculus OX=10090 GN=Ca1 PE=1 SV=4)

HSP 1 Score: 109.768 bits (273), Expect = 7.803e-34
Identity = 58/164 (35.37%), Postives = 91/164 (55.49%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGYG ENGP  W K Y  A G +QSPI+I  S+  +D +L   PL I  + +  +++ +V  GH+F +   D        GGP+     Y+++Q  FHWG++   GSEH ++  ++  E  +  +N+ +Y   +EA++K DGL IL  ++      PS+
Sbjct:    1 MASADWGYGSENGPDQWSKLYPIANGNNQSPIDIKTSEANHDSSLK--PLSISYNPA--TAKEIVNVGHSFHVIFDDSSNQSVLKGGPL--ADSYRLTQFHFHWGNSNDHGSEHTVDGTRYSGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPANPSL 158          

HSP 2 Score: 55.8398 bits (133), Expect = 7.803e-34
Identity = 37/115 (32.17%), Postives = 55/115 (47.83%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N +L ++L  L S+   K    R      D   LLP  ++ Y+TY GSLT PP +E+VTW+I + S ++S +QL     L+             N RP   L  R +  +F
Sbjct:  151 VGPANPSLQKVLDALNSV---KTKGKRAPFTNFDPSSLLPSSLD-YWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF 261          
BLAST of Carbonic anhydrase 7 vs. UniProt/SwissProt
Match: sp|P00915|CAH1_HUMAN (Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 9.435e-34
Identity = 53/164 (32.32%), Postives = 88/164 (53.66%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGY  +NGP  W K Y  A G +QSP++I  S+TK+D +L      I +  +  +++ ++  GH+F +   D +      GGP  +   Y++ Q  FHWGST   GSEH ++  ++  E  +  +N+ +Y    EA +K DGL ++  ++   +  P +
Sbjct:    1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLK----PISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGP--FSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKL 158          

HSP 2 Score: 57.3806 bits (137), Expect = 9.435e-34
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N  L ++L  L +I   K    R      D   LLP  ++ ++TY GSLT PP YE+VTWII + S ++S +QL    +L+  V   +      N RP   L  R +  +F
Sbjct:  151 VGEANPKLQKVLDALQAI---KTKGKRAPFTNFDPSTLLPSSLD-FWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 261          
BLAST of Carbonic anhydrase 7 vs. UniProt/SwissProt
Match: sp|Q7M317|CAH1_PANTR (Carbonic anhydrase 1 OS=Pan troglodytes OX=9598 GN=CA1 PE=3 SV=3)

HSP 1 Score: 107.457 bits (267), Expect = 1.414e-33
Identity = 53/164 (32.32%), Postives = 88/164 (53.66%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMILGTKIKPSI 530
            M S DWGY  +NGP  W K Y  A G +QSP++I  S+TK+D +L      I +  +  +++ ++  GH+F +   D +      GGP  +   Y++ Q  FHWGST   GSEH ++  ++  E  +  +N+ +Y    EA +K DGL ++  ++   +  P +
Sbjct:    1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLK----PISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGP--FSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHIAHWNSAKYSNLAEAASKADGLAVIGVLMKVGEANPKL 158          

HSP 2 Score: 57.3806 bits (137), Expect = 1.414e-33
Identity = 39/115 (33.91%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N  L ++L  L +I   K    R      D   LLP  ++ ++TY GSLT PP YE+VTWII + S ++S +QL    +L+  V   +      N RP   L  R +  +F
Sbjct:  151 VGEANPKLQKVLDALQAI---KTKGKRAPFTNFDPSTLLPSSLD-FWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF 261          
BLAST of Carbonic anhydrase 7 vs. TrEMBL
Match: A0A267H9N6 (Alpha-carbonic anhydrase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016298g1 PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 3.912e-36
Identity = 57/149 (38.26%), Postives = 81/149 (54.36%), Query Frame = 3
Query:   60 DWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALC-ASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            DWGY  E GPH W + Y  A G SQSPINID ++ ++   L   PL       + S+ +L  TG +F +  +  L    GGP+P    Y+ +Q   HWGS+   GSEH +N   +P E  +  +NA +Y  F  A ++RDGL +L  M+
Sbjct:    2 DWGYDNEIGPHTWSRRYPDAAGSSQSPINIDTNRAEFSSALEAKPL--SFQHPQLSNCSLTNTGASFLVAVDAELAEVEGGPLP--GPYRFAQFHMHWGSSDAFGSEHALNGKFYPAELHLVHWNAKKYDKFEAAASQRDGLAVLGVMV 146          

HSP 2 Score: 70.4774 bits (171), Expect = 3.912e-36
Identity = 44/119 (36.97%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  500 DIGNKNKTLDRLLGPLTSIHFFKHHDFR-QETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNG------FDNFRPVCSLGQRIITRNF 835
            +IG  N  LD+++    +I   K    R Q +E + L  LLP   ++YFTY GSLTTPPC+E+V WI+F    TIS +QL  ++ +     C+G       +N+R +  LG+R +  +F
Sbjct:  147 EIGAPNAELDKVMRQFDNI---KTAGARTQLSEPVCLNNLLPQDTSKYFTYPGSLTTPPCFESVCWILFASQITISREQLESLRSL---KSCHGEPPEPLVNNYRHLIPLGKRSLLASF 259          
BLAST of Carbonic anhydrase 7 vs. TrEMBL
Match: A0A1I8GEW9 (Alpha-carbonic anhydrase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 5.183e-36
Identity = 58/149 (38.93%), Postives = 81/149 (54.36%), Query Frame = 3
Query:   60 DWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALC-ASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            DWGY  E GPH W + Y  A G SQSPINID ++ ++   L   PL       + S+ +L  TG +F +  +  L    GGP+P    Y+ +Q   HWGS+   GSEH +N   +P E  +  +NA +Y  F  A ++RDGL +L  MI
Sbjct:    2 DWGYDNEIGPHTWSRRYPDAAGSSQSPINIDTNRAEFSSALEAKPL--SFQHPQLSNCSLTNTGASFLVAVDAELAEVEGGPLP--GPYRFAQFHMHWGSSDAFGSEHALNGKFYPAELHLVHWNAKKYDKFEAAASQRDGLAVLGVMI 146          

HSP 2 Score: 69.707 bits (169), Expect = 5.183e-36
Identity = 44/118 (37.29%), Postives = 66/118 (55.93%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFR-QETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNG------FDNFRPVCSLGQRIITRNF 835
            IG  N  LD+++    +I   K    R Q +E + L  LLP   ++YFTY GSLTTPPC+E+V WI+F    TIS +QL  ++ +     C+G       +N+R +  LG+R +  +F
Sbjct:  146 IGAPNAELDKVMRQFDNI---KTAGARTQLSEPVCLNNLLPQDTSKYFTYPGSLTTPPCFESVCWILFASQITISREQLESLRSL---KSCHGEPPEPLVNNYRHLIPLGKRSLLASF 257          
BLAST of Carbonic anhydrase 7 vs. TrEMBL
Match: A0A267EQF4 (Alpha-carbonic anhydrase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026784g1 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 8.097e-36
Identity = 56/149 (37.58%), Postives = 81/149 (54.36%), Query Frame = 3
Query:   60 DWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALC-ASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            DWGY  E GPH W + Y  A G SQSPINID ++ ++   L   PL       + S+ +L  TG +F +  +  +    GGP+P    Y+ +Q   HWGS+   GSEH +N   +P E  +  +NA +Y  F  A ++RDGL +L  M+
Sbjct:    2 DWGYDNEIGPHTWSRRYPDAAGSSQSPINIDTNRAEFSSALEAKPL--SFQHPQLSNCSLTNTGASFLVAVDAEVAEVEGGPLP--GPYRFAQFHMHWGSSDAFGSEHALNGKFYPAELHLVHWNAKKYDKFEAAASQRDGLAVLGVMV 146          

HSP 2 Score: 70.8626 bits (172), Expect = 8.097e-36
Identity = 44/119 (36.97%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  500 DIGNKNKTLDRLLGPLTSIHFFKHHDFR-QETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNG------FDNFRPVCSLGQRIITRNF 835
            +IG  N  LD+++    +I   K    R Q +E + L  LLP   ++YFTY GSLTTPPC+E+V WI+F    TIS +QL  ++ +     C+G       +N+R +  LG+R +  +F
Sbjct:  147 EIGAPNAELDKVMRQFDNI---KTAGARTQLSEPVCLNNLLPQDTSKYFTYPGSLTTPPCFESVCWILFASQITISREQLESLRSL---KSCHGEPPEPLVNNYRHLIPLGKRSLLASF 259          
BLAST of Carbonic anhydrase 7 vs. TrEMBL
Match: V4AHB6 (Alpha-carbonic anhydrase domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_205401 PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 5.602e-35
Identity = 57/147 (38.78%), Postives = 78/147 (53.06%), Query Frame = 3
Query:   63 WGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            WGYG +NGP  W KS+  A G  QSPI+I  +  K D  L  +PL   ++ S   +  L   G + + + +      GGP+  G+ YK+ Q   HWGS    GSEH +N   FP E  +  YNAT+Y  F EAV+K DGL +    +
Sbjct:    4 WGYGNDNGPATWVKSFPVAAGTRQSPIDIVPTAAKCDTKLTENPL--TVNYSPEPAMELCNPGLSVKANIKSKSVIKGGPL-EGE-YKLEQFHLHWGSADKQGSEHTLNGKMFPAELHLVHYNATKYSSFGEAVDKPDGLAVFGIFL 146          

HSP 2 Score: 73.1738 bits (178), Expect = 5.602e-35
Identity = 36/77 (46.75%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  611 CLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNG--FDNFRPVCSLGQRIITRNF 835
            CLLPD IN+Y+TY GSLTTPP  E+VTWI+FE    +SEDQ+   + +   +  +    DN+RP   LG R +  +F
Sbjct:  183 CLLPDNINKYWTYLGSLTTPPLCESVTWIVFEEPIEVSEDQMKAFRALCCGECGSAPIVDNYRPPLPLGNRQLRASF 259          
BLAST of Carbonic anhydrase 7 vs. TrEMBL
Match: G4VP62 (Putative carbonic anhydrase II (Carbonate dehydratase II) OS=Schistosoma mansoni OX=6183 GN=Smp_028670.1 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 6.239e-35
Identity = 52/143 (36.36%), Postives = 74/143 (51.75%), Query Frame = 3
Query:   63 WGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIIL 491
            + YG +NGPH W   + +AGG  QSPIN++    + D +L      I +D +   +QTL    HNF ++ +G    SGGP+     YK++Q   HWGS    GSEH+IN    P E      N T+Y     A+   DGL ++
Sbjct:    3 YDYGEKNGPHTWVLRFPNAGGTKQSPINLNTMSMRLDESLT----PINVDFNELQNQTLHVKDHNFSVEVKGNAVLSGGPL--TSEYKLTQFHLHWGSGNNWGSEHMINGISCPAELHCVFIN-TKYATMETAITYSDGLSVV 138          

HSP 2 Score: 84.7297 bits (208), Expect = 6.239e-35
Identity = 45/110 (40.91%), Postives = 65/110 (59.09%), Query Frame = 2
Query:  509 NKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHV-ADGCNGFDNFRPVCSLGQRIITRNF 835
            N N  L RL   L S    +  D +    +LDL  LLP+ ++RY+TY+GSLTTPPC E VTWI+ +    ++ DQL  ++++H     C   DNFRP+C +G R +  +F
Sbjct:  149 NNNNALKRLCTLLKSTKKGESKDIQ---PMLDLNTLLPNDLSRYYTYSGSLTTPPCNECVTWIVLDEPVVMTIDQLETLRQMHANCVTCGQTDNFRPICPIGSRSVRCSF 255          
BLAST of Carbonic anhydrase 7 vs. Ensembl Cavefish
Match: ca7 (carbonic anhydrase 7 [Source:NCBI gene;Acc:103041882])

HSP 1 Score: 92.0485 bits (227), Expect = 2.774e-31
Identity = 54/155 (34.84%), Postives = 75/155 (48.39%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            M    WGYG ++GP  W K Y  A G  QSPINI   +  YD   NL P+ +  D+   +S  +   GH+  +   D +      GGP+     Y++ Q  FHWG     GSEH ++   +  E  +  +NA RY  F EAV   DGL +L   +
Sbjct:    1 MTGHQWGYGEDDGPSAWSKDYPIAEGPRQSPINIVPDEAVYDA--NLPPISLNYDN--CTSINISNNGHSVVVEFDDADDRSVIQGGPL--NNAYRLKQFHFHWGGKGCHGSEHTVSGKTYTSELHLVHWNAARYGSFGEAVAASDGLAVLGVFL 149          

HSP 2 Score: 62.3882 bits (150), Expect = 2.774e-31
Identity = 40/121 (33.06%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKH-HDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGF-----DNFRPVCSLGQRIITRNF 835
            ++ +IG++++ L ++   L  + F     DFR      + KCLLP  +  Y+TY GSLTTPP YE+VTWI+      +SE Q+   + +  +           +NFRP   L  R +  NF
Sbjct:  147 VFLEIGDEHRGLHKITDALYMVKFKGTVADFRD----FNPKCLLPRSLG-YWTYPGSLTTPPLYESVTWIVLAEPIEVSEKQMGKFRTLLFSGEEEEVRKRMENNFRPPQPLNGRAVRSNF 262          
BLAST of Carbonic anhydrase 7 vs. Ensembl Cavefish
Match: ca2 (carbonic anhydrase 1-like [Source:NCBI gene;Acc:103021731])

HSP 1 Score: 92.4337 bits (228), Expect = 1.374e-30
Identity = 55/154 (35.71%), Postives = 81/154 (52.60%), Query Frame = 3
Query:   51 ISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            +S  WGY  +NGP  W +S+  A G  QSPI+I   + ++D  L   PL    D S  +S  L+  GH+ ++   D   +   +GGPI     Y++ Q  FHWGS    GSEH ++   +P E  +  +N T Y  F EAV+K DGL ++   +
Sbjct:    1 MSHGWGYAADNGPDKWVESFPVADGPRQSPIDIVTGEAEHDSALA--PLAPHYDPS--TSLDLLNNGHSVQVTFADDTDSSSLTGGPI--SGTYRLKQFHFHWGSQDDKGSEHTVDGKTYPAELHLVHWNTT-YPSFGEAVDKPDGLAVIGVFL 147          

HSP 2 Score: 59.6918 bits (143), Expect = 1.374e-30
Identity = 39/119 (32.77%), Postives = 62/119 (52.10%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQL----NLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            ++ +IG++N  L +LL  + +I   K    +      D   LLP  ++ Y+TY GSLTTPP  E+VTWI+ + S ++S  Q+    +L+        C   DN+RP   L  R +  +F
Sbjct:  145 VFLEIGDENPQLQKLLDAMEAI---KSKGTQTSFADFDPTILLPGSLD-YWTYDGSLTTPPLLESVTWIVCKQSISVSSTQMEKFRSLLFSGEGEPECCMMDNYRPPQPLKGRKVRASF 259          
BLAST of Carbonic anhydrase 7 vs. Ensembl Cavefish
Match: ca7 (carbonic anhydrase 7 [Source:NCBI gene;Acc:103041882])

HSP 1 Score: 79.337 bits (194), Expect = 1.444e-27
Identity = 50/143 (34.97%), Postives = 70/143 (48.95%), Query Frame = 3
Query:   84 GPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCAS---GGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            GP  W K Y  A G  QSPINI   +  YD   NL P+ +  D+   +S  +   GH+  ++ + A   S   GGP+     Y++ Q  FHWG     GSEH ++   +  E  +  +NA RY  F EAV   DGL +L   +
Sbjct:   17 GPSAWSKDYPIAEGPRQSPINIVPDEAVYDA--NLPPISLNYDN--CTSINISNNGHSVVVEFDDADDRSVIQGGPL--NNAYRLKQFHFHWGGKGCHGSEHTVSGKTYTSELHLVHWNAARYGSFGEAVAASDGLAVLGVFL 153          

HSP 2 Score: 62.3882 bits (150), Expect = 1.444e-27
Identity = 40/121 (33.06%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKH-HDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGF-----DNFRPVCSLGQRIITRNF 835
            ++ +IG++++ L ++   L  + F     DFR      + KCLLP  +  Y+TY GSLTTPP YE+VTWI+      +SE Q+   + +  +           +NFRP   L  R +  NF
Sbjct:  151 VFLEIGDEHRGLHKITDALYMVKFKGTVADFRD----FNPKCLLPRSLG-YWTYPGSLTTPPLYESVTWIVLAEPIEVSEKQMGKFRTLLFSGEEEEVRKRMENNFRPPQPLNGRAVRSNF 266          
BLAST of Carbonic anhydrase 7 vs. Ensembl Cavefish
Match: ca5a (carbonic anhydrase 5B, mitochondrial [Source:NCBI gene;Acc:103039663])

HSP 1 Score: 73.559 bits (179), Expect = 2.707e-26
Identity = 40/140 (28.57%), Postives = 71/140 (50.71%), Query Frame = 3
Query:   93 LWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCAS---GGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            +W +  +  GG  QSPI+I + ++ +D  L   PL +  D    + Q +   G++F ++ +     S   GGP+     +++ Q  FHWG     G+EH ++   +P E  +  +NA RY  F EAV + +GL ++   +
Sbjct:   19 MWQEPLAIPGGERQSPIDISVRKSMFDPQLK--PLVMKYDPR--TCQQIWNNGYSFLVEYDDTTDKSTLQGGPL--EDQFRLCQFHFHWGENNKWGAEHTVDHLLYPAELHLVHWNADRYSLFEEAVMEDNGLAVIGVFL 152          

HSP 2 Score: 64.3142 bits (155), Expect = 2.707e-26
Identity = 38/121 (31.40%), Postives = 60/121 (49.59%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADG-----CNGFDNFRPVCSLGQRIITRNFV 838
            ++  +G +++ L +L+  L ++   +H D   E    D   LLP+    Y+TY GSLTTPP  E VTWII +    +S DQL + + +           +  +NFR    L  R +  +FV
Sbjct:  150 VFLKVGKRHEGLQKLVDALPAV---RHKDSVVEFTRFDASGLLPENTQDYWTYAGSLTTPPLTEAVTWIIMKQPIEVSHDQLAVFRSLLFTSAEEDVQKSMVNNFRVQQPLKGRTVRSSFV 267          
BLAST of Carbonic anhydrase 7 vs. Ensembl Cavefish
Match: ca5a (carbonic anhydrase 5B, mitochondrial [Source:NCBI gene;Acc:103039663])

HSP 1 Score: 73.1738 bits (178), Expect = 3.184e-26
Identity = 40/140 (28.57%), Postives = 71/140 (50.71%), Query Frame = 3
Query:   93 LWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCAS---GGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            +W +  +  GG  QSPI+I + ++ +D  L   PL +  D    + Q +   G++F ++ +     S   GGP+     +++ Q  FHWG     G+EH ++   +P E  +  +NA RY  F EAV + +GL ++   +
Sbjct:   52 MWQEPLAIPGGERQSPIDISVRKSMFDPQLK--PLVMKYDPR--TCQQIWNNGYSFLVEYDDTTDKSTLQGGPL--EDQFRLCQFHFHWGENNKWGAEHTVDHLLYPAELHLVHWNADRYSLFEEAVMEDNGLAVIGVFL 185          

HSP 2 Score: 64.3142 bits (155), Expect = 3.184e-26
Identity = 38/121 (31.40%), Postives = 60/121 (49.59%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADG-----CNGFDNFRPVCSLGQRIITRNFV 838
            ++  +G +++ L +L+  L ++   +H D   E    D   LLP+    Y+TY GSLTTPP  E VTWII +    +S DQL + + +           +  +NFR    L  R +  +FV
Sbjct:  183 VFLKVGKRHEGLQKLVDALPAV---RHKDSVVEFTRFDASGLLPENTQDYWTYAGSLTTPPLTEAVTWIIMKQPIEVSHDQLAVFRSLLFTSAEEDVQKSMVNNFRVQQPLKGRTVRSSFV 300          
BLAST of Carbonic anhydrase 7 vs. Ensembl Sea Lamprey
Match: ca8 (carbonic anhydrase VIII [Source:ZFIN;Acc:ZDB-GENE-050417-26])

HSP 1 Score: 92.0485 bits (227), Expect = 7.060e-32
Identity = 46/136 (33.82%), Postives = 71/136 (52.21%), Query Frame = 3
Query:   96 WHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            W   +  A G +QSPINI+  +  +D +L   PL  C+         ++  GH+  I        +GGP P GQ +++S I FHWG     GSEH +N   FP EC +  +NAT Y+   +A+ K +G+ I++  +
Sbjct:    5 WGLLFPDANGENQSPININSREATFDPSLLTAPL--CLSYLTCRECEVLNDGHSLHIHIRSKSVTTGGPFPIGQEFELSHICFHWGKEDQRGSEHTVNFKAFPMECHLIHWNATLYKNIEDAMGKENGIAIIALFV 138          

HSP 2 Score: 62.003 bits (149), Expect = 7.060e-32
Identity = 37/89 (41.57%), Postives = 50/89 (56.18%), Query Frame = 2
Query:  599 LDLKCLLPDCINR-YFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQK-------VHVADGCNG--FDNFRPVCSLGQRIITRNF 835
            L+   LLPD + R Y+ Y GSLTTPPC E V W++F    T+S  Q+   ++       V  +DGC+G   DNFRP   L  R+I  +F
Sbjct:  169 LNPNTLLPDPLLRDYWVYEGSLTTPPCCENVLWLLFRYPLTLSHAQIEEFRRLRTHSKGVAPSDGCDGQLGDNFRPTQQLNDRVIRASF 257          
BLAST of Carbonic anhydrase 7 vs. Ensembl Sea Lamprey
Match: CA2 (carbonic anhydrase 2 [Source:HGNC Symbol;Acc:HGNC:1373])

HSP 1 Score: 94.7449 bits (234), Expect = 7.603e-32
Identity = 45/144 (31.25%), Postives = 77/144 (53.47%), Query Frame = 3
Query:   84 GPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRID----CEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            GP +W K + +A G  QSPI+I+ +   Y+  L      + +  S   ++++  +GH+F +D     + +   SGGP+     YK+ Q  FHWG++   GSEH ++   +  E  +  +NA +Y  F+EA +K DGL +L   +
Sbjct:   16 GPEVWGKHFKNADGSRQSPIDIEPASAVYEAALGA----LSVSYSGADAKSISNSGHSFSVDYDDSGDSSAVLSGGPL--ANPYKLKQFHFHWGASDAKGSEHTVDGKSYSAELHLVHWNAAKYASFDEAKDKSDGLAVLGAFV 153          

HSP 2 Score: 59.3066 bits (142), Expect = 7.603e-32
Identity = 32/111 (28.83%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            +G  N  L ++   L +I        + + +  D   LLP  ++ +++Y GSLTTPP  E+  WI+ +   + S++QL   + +  +DG     NFRP   L  R++  +F
Sbjct:  155 VGANNAGLQKVTDALNAI---ADKGAKADFKNYDPSVLLPKSLD-FWSYLGSLTTPPLNESAIWIVLKDPISASKEQLAAFRSLKASDGSKLVCNFRPTQPLKGRVVQASF 261          
BLAST of Carbonic anhydrase 7 vs. Ensembl Sea Lamprey
Match: ca4b (carbonic anhydrase IV b [Source:ZFIN;Acc:ZDB-GENE-080815-5])

HSP 1 Score: 87.0409 bits (214), Expect = 1.090e-28
Identity = 53/138 (38.41%), Postives = 76/138 (55.07%), Query Frame = 3
Query:   84 GPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLK-ICIDSSRTS-SQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIIL 491
            GP  W+K+  +  G SQSPI+I     K + TL    LK I  DS+    + ++   GH  ++D +G +  SGG +P    +   Q+ FHWG+    GSEH IN  QFP E  +  YN T+Y  F+ A N++DGL +L
Sbjct:   37 GPRTWYKNSPACSGTSQSPIDIHTGSVKRNATL--QKLKFIGYDSTPAGVTWSIQNNGHTVQVDLQGEIAVSGGGLP--GTFNAVQMHFHWGNPHGPGSEHTINGKQFPVELHIVHYN-TKYLTFDGAKNEKDGLAVL 169          

HSP 2 Score: 56.6102 bits (135), Expect = 1.090e-28
Identity = 31/83 (37.35%), Postives = 45/83 (54.22%), Query Frame = 2
Query:  596 LLDLKCLLPDCIN--RYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNG-----FDNFRPVCSLGQRII 823
            + +L  LLP  +N  +Y+ Y+GSLTTP C E VTW +FE    + E+Q+     V  +   +       +NFRPV  L  RI+
Sbjct:  203 MFNLDNLLPSYVNMSKYYRYSGSLTTPGCGEVVTWTVFEEPIIMDENQIKKFSSVFFSTKEDPQQILMVNNFRPVQKLNSRIV 285          
BLAST of Carbonic anhydrase 7 vs. Ensembl Sea Lamprey
Match: ca5a (carbonic anhydrase Va [Source:ZFIN;Acc:ZDB-GENE-080220-57])

HSP 1 Score: 66.6254 bits (161), Expect = 3.318e-13
Identity = 40/119 (33.61%), Postives = 62/119 (52.10%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVAD----GCNGFDNFRPVCSLGQRIITRNF 835
            ++ ++G  +  L  L+  L +I    H     E    D   LLP C++ ++TY GSLTTPP YETVTW I + S +IS +QL   ++++V+          DNFR    +  R +  +F
Sbjct:  132 VFVEVGETHARLQELVEALPNI---THKGMMHEVGTFDPSGLLPPCLD-FWTYPGSLTTPPPYETVTWFILKRSMSISGEQLASFRRLYVSAAGERAVRMVDNFRMPQPIMDRSVRSSF 246          
BLAST of Carbonic anhydrase 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006943.1 (pep scaffold:Pmarinus_7.0:GL476401:102791:181294:1 gene:ENSPMAG00000006261.1 transcript:ENSPMAT00000006943.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 3.324e-12
Identity = 25/69 (36.23%), Postives = 36/69 (52.17%), Query Frame = 2
Query:  614 LLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGF--------DNFRP 796
            LLP+  + +F Y+G+ TTPPC + V W +F  +  IS  QL  +  V +     G+        DNFRP
Sbjct:  171 LLPESTDEFFRYSGTTTTPPCAQGVEWTVFPRTVHISAHQLEALYGVLIMVRA-GYAMLLEYLQDNFRP 238          

HSP 2 Score: 40.0466 bits (92), Expect = 3.324e-12
Identity = 34/136 (25.00%), Postives = 59/136 (43.38%), Query Frame = 3
Query:   96 WHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWG-STIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTM 500
            W + Y    G  QSPI+I  S+ + ++      L+       +++ T+   G    +   G     GG +     Y+++ + FHWG S    GSEH ++   FP E Q+  Y+   +  F  A+     +  LS +
Sbjct:    1 WPELYEGCRGERQSPIDI-ASEVQAEVLSPADGLEFEGWDVPSTTTTIKHDGKTVIVHLSGDYHLRGGGLQ--GRYRMAWLTFHWGHSNGTEGSEHRLSGRSFPLEVQIYGYSQEHHSSFAAAMKAGGNMAALSIL 133          
BLAST of Carbonic anhydrase 7 vs. Ensembl Nematostella
Match: EDO46081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR00])

HSP 1 Score: 71.2478 bits (173), Expect = 2.314e-27
Identity = 48/150 (32.00%), Postives = 70/150 (46.67%), Query Frame = 3
Query:   60 DWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLV-FTGHNFRIDCEGA--LCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTM 500
            DW Y    GP  W   +   GG  QSPINI+  + KYD +L      + I    T+   LV   GH    D   +    A+G  +     Y+++Q  FH GS+   GSEH I+  ++P E  +  YN  +Y   + A    DGL ++S +
Sbjct:    3 DWSYDEATGPSTWPNHFPHCGGKMQSPININTEEAKYDGSLT----DLDIKYPNTTDVLLVNHHGHAIEADILSSEPFVATGADL--SSRYRLAQFHFHVGSSDIQGSEHHIHGVKYPLEMHLVHYN-DKYPNASSAQGLLDGLAVISVL 145          

HSP 2 Score: 68.5514 bits (166), Expect = 2.314e-27
Identity = 35/79 (44.30%), Postives = 47/79 (59.49%), Query Frame = 2
Query:  614 LLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKV----HVADGCNGF-DNFRPVCSLGQRIITRNF 835
            ++P    +++ Y GSLTTPPC+ETV WI+ + + +ISE QL   + V      A   N   DNFRP  SL  RII +NF
Sbjct:  183 IIPTDTEKFYRYNGSLTTPPCFETVKWIVLKKTASISEKQLRQFRSVFSTSRQATKPNSLVDNFRPTQSLNGRIIRKNF 261          
BLAST of Carbonic anhydrase 7 vs. Ensembl Nematostella
Match: EDO35860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKA8])

HSP 1 Score: 77.411 bits (189), Expect = 4.630e-27
Identity = 52/148 (35.14%), Postives = 75/148 (50.68%), Query Frame = 3
Query:   84 GPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQ-TLVFTGHNFRID--CEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI-LGTK 515
            GP  W  S+S   G SQSPI+I  S   +D +L      +  D+  T S+ +L   GH F+++    G    SGG +  G  Y   Q   HWGS    GSEHLI+   F     +  YN T+Y   + AV+K DGL ++  ++ +GT+
Sbjct:    1 GPSKWSSSFSQCNGSSQSPIDIITSSVAFDQSLGELQF-VNFDTIPTGSKISLKNNGHAFQVNMLSAGTFTVSGGGL--GATYSTVQFHLHWGSKNEQGSEHLIDGKAFAGAIHIVSYN-TKYPNISAAVDKSDGLAVVGILLKVGTE 144          

HSP 2 Score: 61.2326 bits (147), Expect = 4.630e-27
Identity = 39/113 (34.51%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHD-FRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGF-DNFRPVCSLGQRIITRNF 835
            +G ++  L + +  + S+      D F Q  +L DL   LP   N ++ Y GSLTTP C E+VTW +     T+SE QL +++ +   DG     DNFR    L  R +  NF
Sbjct:  141 VGTESAALKKFMENIGSVTKVNTSDEFAQPAKLGDL---LPSNKN-FYRYQGSLTTPGCQESVTWSVMANPITVSEAQLAILRGLKQKDGVAVIQDNFRNTMPLNGRAVKSNF 249          
BLAST of Carbonic anhydrase 7 vs. Ensembl Nematostella
Match: EDO40438 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S762])

HSP 1 Score: 63.929 bits (154), Expect = 1.413e-23
Identity = 44/143 (30.77%), Postives = 65/143 (45.45%), Query Frame = 3
Query:   84 GPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTL-----NLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIY-GGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILS 494
            GP  WHK Y  A    QSPI+I       D +L        P+     ++   +  L F  +N  +        SGGP+     Y+++ I FHW +T    GSEH+I+      E Q+  +N T+YR   EA+    G+ IL+
Sbjct:    1 GPLRWHKCYIGAEPGHQSPIDIVTKDVTQDSSLGSLWNTYEPVANSTLTNDGRTLQLTFANNNNVL--------SGGPLT--DEYQLAMIKFHWAATEESAGSEHMIDSQGHAIEVQLVHWNKTKYRNIGEAITGEQGICILA 133          

HSP 2 Score: 63.1586 bits (152), Expect = 1.413e-23
Identity = 32/75 (42.67%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  599 LDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRII 823
            +D K   P   + Y+TY GSLTTPP  E VTW+I + S  +SEDQ+N+ + +  + G     N RPVC +  R I
Sbjct:  165 IDPKIFFP-AESEYWTYEGSLTTPPLTENVTWVICQSSLILSEDQMNVFRNIRNSHGDIMAKNSRPVCPINGRTI 238          
BLAST of Carbonic anhydrase 7 vs. Ensembl Nematostella
Match: EDO45955 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRH8])

HSP 1 Score: 65.4698 bits (158), Expect = 1.662e-21
Identity = 41/115 (35.65%), Postives = 62/115 (53.91%), Query Frame = 2
Query:  500 DIGNKNKTLDRLLGPLTSIHFFKH-HDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGF-DNFRPVCS-LGQRIITRNF 835
            ++G +N  L ++L  + ++    +  D  QE     L  LLP   + +F Y GSLTTPPCYE+VTW + +   TIS DQL  ++ +   DG +   DN+R +   L  R +  NF
Sbjct:  140 EVGAENAGLAKVLKYVENVTKVGNVSDLAQE---FSLGSLLPSNTD-FFRYKGSLTTPPCYESVTWTVMKTKTTISHDQLMKLRSIMEKDGVHKITDNYRHILQPLNGRTVKSNF 250          

HSP 2 Score: 54.299 bits (129), Expect = 1.662e-21
Identity = 42/143 (29.37%), Postives = 64/143 (44.76%), Query Frame = 3
Query:   84 GPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVF-TGHNFRID--CEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            GP  W   Y +  G SQSPINI  S   YD +L         D   + ++ +V   GH F+++          GG +  G  +  +Q   H G     G+EHLI+  +      +  YN T+Y   + A NK DGL ++  ++
Sbjct:    1 GPDHWANRYPACNGSSQSPINIVTSSVMYDSSLGKLQFN-NFDRIPSGAKIMVRNNGHAFQVNFMTPNLFYVHGGGL--GANFTTAQFHMHLGEDDTRGAEHLIDGQRNAACIHIVNYN-TKYPDISTAANKSDGLAVIGVIL 139          
BLAST of Carbonic anhydrase 7 vs. Ensembl Nematostella
Match: EDO42126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2D8])

HSP 1 Score: 64.3142 bits (155), Expect = 3.175e-12
Identity = 42/135 (31.11%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  114 SAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPI---PYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAV--NKRDGLIILSTMI 503
            +A G  QSPI+I  ++TK+D T+   P+K+  D    +   L  TGH+     E         I   P    YK +Q  FHWG     GSEH ++   +P E  +  YN+  Y+    A+  + +DGL +L   +
Sbjct:   12 AASGKRQSPIDIVSNETKFDSTIP--PVKVHYDP--FTKGKLTNTGHSVSFSGESDASVPTPDITSGPLSHKYKFAQFHFHWGKDEKEGSEHRVDGKMYPSEMHIVHYNSDLYKDAASAMSSDNKDGLCVLGVFL 142          

HSP 2 Score: 56.225 bits (134), Expect = 2.426e-9
Identity = 28/70 (40.00%), Postives = 37/70 (52.86%), Query Frame = 2
Query:  626 CINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            C+   +TY GSLTTPP  E V WI+ + +  IS  QL L   +  A G     N+RP C L  R++   F
Sbjct:  164 CVLECWTYPGSLTTPPLSEIVNWIVLKNTIEISHHQLKLFHGLQNAKGECITHNYRPPCPLHGRVVKATF 233          
BLAST of Carbonic anhydrase 7 vs. Ensembl Medaka
Match: cahz (carbonic anhydrase [Source:NCBI gene;Acc:101161087])

HSP 1 Score: 110.538 bits (275), Expect = 6.116e-37
Identity = 59/154 (38.31%), Postives = 88/154 (57.14%), Query Frame = 3
Query:   51 ISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCAS---GGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            +S  WGYGP +GP  W +++  A G  QSPINI   + ++D +L   PLKI  D+    ++ ++  GH+F++D      +S   GGPI     Y++ Q  FHWG++   GSEH IN   FPCE  +  +N T+Y  F EA +K DGL ++   +
Sbjct:    1 MSHAWGYGPSDGPETWAENFPLASGPRQSPINIVPKEAQFDPSLK--PLKIRYDAR--DAKGILNNGHSFQVDFVDDTDSSTLTGGPI--SGTYRLKQFHFHWGASDERGSEHTINGITFPCELHLVHWN-TKYASFGEAADKPDGLAVVGVFL 147          

HSP 2 Score: 63.1586 bits (152), Expect = 6.116e-37
Identity = 42/119 (35.29%), Postives = 61/119 (51.26%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQK-VHVADG---CNGFDNFRPVCSLGQRIITRNF 835
            ++  IG  N  L ++L  L +I   K    +      D K LLP  ++ Y+TY GSLTTPP  E+VTWI+ +   ++S  Q+   +  +   DG   CN  DNFRP   L  R +  +F
Sbjct:  145 VFLKIGAANPKLQKVLDALDAI---KTKGKQNVFANFDPKTLLPGSLD-YWTYDGSLTTPPLLESVTWIVLKEQISVSPAQMAKFRSLLFTGDGEPLCNMVDNFRPPQLLKGRRVRASF 259          
BLAST of Carbonic anhydrase 7 vs. Ensembl Medaka
Match: ca8 (carbonic anhydrase 8 [Source:NCBI gene;Acc:101174864])

HSP 1 Score: 87.0409 bits (214), Expect = 1.487e-28
Identity = 48/152 (31.58%), Postives = 79/152 (51.97%), Query Frame = 3
Query:   60 DWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTL---NLHP-LKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            DWGY  E G   W   + +A G  QSPIN++  + +YD +L    L P   +C D        +V  GH  RI  +     +GGP+P    Y++ ++ FHWG     GSEH +N   FP E  +  +N+T +    +A+ +++G++I++  +
Sbjct:   19 DWGY--EEGVE-WGLHFPAANGEYQSPINLNSREAQYDPSLLDVGLSPNYVVCRDCE------VVNDGHTVRILLKSKSVVTGGPLPSDHEYELHEVRFHWGKENQRGSEHTVNFKAFPMELHLIHWNSTLFNSLEDALGRKNGVLIIALFV 161          

HSP 2 Score: 58.5362 bits (140), Expect = 1.487e-28
Identity = 36/84 (42.86%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  614 LLPDCINR-YFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKV--HVA-----DGCNGF--DNFRPVCSLGQRIITRNF 835
            LLPD + R Y+ Y GSLTTPPC E VTWI++    TIS+ Q+   +++  HV      +G +G   DNFRP   L  R +   F
Sbjct:  197 LLPDPLLRDYWVYDGSLTTPPCSENVTWILYRYPLTISQMQIEEFRRLRSHVKGAELLEGNDGMLGDNFRPTQPLSDRTVRAAF 280          
BLAST of Carbonic anhydrase 7 vs. Ensembl Medaka
Match: ca8 (carbonic anhydrase 8 [Source:NCBI gene;Acc:101174864])

HSP 1 Score: 82.4185 bits (202), Expect = 4.579e-27
Identity = 42/140 (30.00%), Postives = 73/140 (52.14%), Query Frame = 3
Query:   96 WHKSYSSAGGCSQSPINIDLSQTKYDMTL---NLHP-LKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            W   + +A G  QSPIN++  + +YD +L    L P   +C D        +V  GH  RI  +     +GGP+P    Y++ ++ FHWG     GSEH +N   FP E  +  +N+T +    +A+ +++G++I++  +
Sbjct:   29 WGLHFPAANGEYQSPINLNSREAQYDPSLLDVGLSPNYVVCRDCE------VVNDGHTVRILLKSKSVVTGGPLPSDHEYELHEVRFHWGKENQRGSEHTVNFKAFPMELHLIHWNSTLFNSLEDALGRKNGVLIIALFV 162          

HSP 2 Score: 58.151 bits (139), Expect = 4.579e-27
Identity = 36/84 (42.86%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  614 LLPDCINR-YFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKV--HVA-----DGCNGF--DNFRPVCSLGQRIITRNF 835
            LLPD + R Y+ Y GSLTTPPC E VTWI++    TIS+ Q+   +++  HV      +G +G   DNFRP   L  R +   F
Sbjct:  198 LLPDPLLRDYWVYDGSLTTPPCSENVTWILYRYPLTISQMQIEEFRRLRSHVKGAELLEGNDGMLGDNFRPTQPLSDRTVRAAF 281          
BLAST of Carbonic anhydrase 7 vs. Ensembl Medaka
Match: ca7 (carbonic anhydrase 7 [Source:NCBI gene;Acc:101170576])

HSP 1 Score: 86.2705 bits (212), Expect = 4.001e-26
Identity = 50/155 (32.26%), Postives = 73/155 (47.10%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRI---DCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            M    WGYG  +GP  WHK+Y  A G  QSPI+I   Q   D +L      I ++    +S  +   GH+  +   D +      GGP+     Y++ Q  FHWG     GSEH ++ + +  E  +  +NA +Y  F EA    DGL +L   +
Sbjct:    1 MTGHHWGYGEGDGPSAWHKNYPVAQGSRQSPIDIIPHQALQDRSLG----PIVLNYDHCTSINISNNGHSVVVEFDDSDDRSVIQGGPL--DNPYRLKQFHFHWGGKGCEGSEHTVDGYGYASELHLVHWNAVKYCSFGEASTAPDGLAVLGIFL 149          

HSP 2 Score: 50.8322 bits (120), Expect = 4.001e-26
Identity = 32/88 (36.36%), Postives = 47/88 (53.41%), Query Frame = 2
Query:  587 ETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLN-----LMQKVHVADGCNGFDNFRPVCSL-GQRIITRN 832
            E +  + KCLLP  ++ Y+TY GSLTTPP +E+V WI+ +    +SE QL      L             +NFRP   L G+++ + N
Sbjct:  176 EFKGFNPKCLLPSSLH-YWTYLGSLTTPPLHESVIWIVLKEPIAVSEKQLGKFRLLLFTGEEEDQRTRMENNFRPPQPLKGRKVRSSN 262          
BLAST of Carbonic anhydrase 7 vs. Ensembl Medaka
Match: ptprz1a (protein tyrosine phosphatase receptor type Z1 [Source:NCBI gene;Acc:101160456])

HSP 1 Score: 72.0182 bits (175), Expect = 5.927e-26
Identity = 46/153 (30.07%), Postives = 76/153 (49.67%), Query Frame = 3
Query:   60 DWGYGPENGPHLWHKSYSSAGGCSQSPINID--LSQTKYDMTLNLHPLKICIDSSRTSSQTLVFT-GHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWG--STIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            DW Y      + W K + S     QSPIN+D  LSQ K    +    L++      T  +T++   G    I+ +G    SGG +     +K+ +I FHWG  +T   GSEH ++  ++P E Q+  Y+ T++R  +E++  R  +  L+ +I
Sbjct:   15 DWSYAGTLNQNNWAKKFPSCSNAKQSPINMDESLSQVKQQFQM----LELDGWEGLTGDRTIIKNDGKTVAINVDGDFYLSGGGLR--SKFKVGRITFHWGRCNTSSEGSEHSLDGVKYPLEMQIYSYDETQFRSLDESIKTRGRITALAVLI 161          

HSP 2 Score: 64.3142 bits (155), Expect = 5.927e-26
Identity = 28/56 (50.00%), Postives = 37/56 (66.07%), Query Frame = 2
Query:  587 ETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKV 754
            E     L+ LLP+   +YFTY GSLTTPPC +TV WI+F+ +  ISE QL +  +V
Sbjct:  189 EMSPFSLQGLLPNSTEKYFTYNGSLTTPPCLDTVEWIVFKNAVAISEQQLEVFCEV 244          
BLAST of Carbonic anhydrase 7 vs. Planmine SMEST
Match: SMESG000022420.1 (SMESG000022420.1)

HSP 1 Score: 322.013 bits (824), Expect = 5.025e-152
Identity = 154/159 (96.86%), Postives = 156/159 (98.11%), Query Frame = 3
Query:   48 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI-LGTKIK 521
            MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTM+ +G K K
Sbjct:    1 MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMMHIGNKNK 159          

HSP 2 Score: 235.343 bits (599), Expect = 5.025e-152
Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRIITRNFV 838
            IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRIITRNFV
Sbjct:  154 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRIITRNFV 265          
BLAST of Carbonic anhydrase 7 vs. Planmine SMEST
Match: SMESG000072395.1 (SMESG000072395.1)

HSP 1 Score: 194.512 bits (493), Expect = 1.260e-88
Identity = 88/152 (57.89%), Postives = 111/152 (73.03%), Query Frame = 3
Query:   63 WGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI-LGTK 515
            WGYG ++GPH WH S+ SAGGC QSPINI+L + KYD+TLN+ PL +  +  R  SQTLV+TGHNFRID  G  C SGGP+P GQ   +S   FHWGST Y GSEHLIN  QFP E    CYNA++YRCF EA+ + DGL+I++ ++ +G+K
Sbjct:    4 WGYGADDGPHTWHASFPSAGGCRQSPINIELDKLKYDITLNIRPLAVAFEPERQLSQTLVYTGHNFRIDVAGGSCVSGGPVPTGQTCILSHFSFHWGSTDYSGSEHLINGHQFPGELHFVCYNASKYRCFEEAMGQPDGLLIVAVLLHIGSK 155          

HSP 2 Score: 151.369 bits (381), Expect = 1.260e-88
Identity = 67/111 (60.36%), Postives = 88/111 (79.28%), Query Frame = 2
Query:  503 IGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            IG+KN T++RL+GPLTSI FF+ HDFRQET LLDL  +LP  + RY+TY GSLTTPPCYE+VTW++FE +  I  DQL + +K+H+ D C G DNFRP+C +G+RI+ +NF
Sbjct:  152 IGSKNTTIERLVGPLTSIQFFRQHDFRQETSLLDLTEILPRNLCRYYTYPGSLTTPPCYESVTWLLFEETVGIDSDQLCMFRKIHMGDSCCGPDNFRPICPIGERIVCKNF 262          
BLAST of Carbonic anhydrase 7 vs. Planmine SMEST
Match: SMESG000078341.1 (SMESG000078341.1)

HSP 1 Score: 117.857 bits (294), Expect = 4.839e-51
Identity = 61/149 (40.94%), Postives = 87/149 (58.39%), Query Frame = 3
Query:   63 WGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCE-GALCASGGPIPYGQMYKISQIVFHWGST-IYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            WGYG  NGP  W  SY +A G SQSPINI +++T+++  L    L I I+S  ++ Q L  TGH+F+++    ++  +  P     ++K+ Q  FHWGS     GSEH IN   +P E  +  YN+T+Y  F EA NK DGL++L   I
Sbjct:    4 WGYGKLNGPETWKMSYPAAKGDSQSPINIIVNKTEFESELFQKKLNIKINSDYSAEQILNHTGHSFKVETSVDSMTVTNAPGFNNDVFKLVQFHFHWGSIGNDNGSEHQINGKSWPSELHLVHYNSTKYSNFTEAANKPDGLLVLGVFI 152          

HSP 2 Score: 102.449 bits (254), Expect = 4.839e-51
Identity = 49/115 (42.61%), Postives = 69/115 (60.00%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            ++  I  KN      +  L +I      + + +   ++LK LLP   +RYFTY+GSLTTPPCYE+VTWI+FE   T+S +Q+   +KVH  DGC    NFRPVC +  R + R+F
Sbjct:  150 VFIQIAGKNLEFQNFIQCLETIQADLKVNLKDKNSKINLKYLLPINTDRYFTYSGSLTTPPCYESVTWIVFEYPITMSREQIERFRKVHSEDGCETAANFRPVCPINDRKVKRSF 264          
BLAST of Carbonic anhydrase 7 vs. Planmine SMEST
Match: SMESG000078341.1 (SMESG000078341.1)

HSP 1 Score: 102.449 bits (254), Expect = 2.053e-46
Identity = 56/149 (37.58%), Postives = 80/149 (53.69%), Query Frame = 3
Query:   63 WGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCE-GALCASGGPIPYGQMYKISQIVFHWGST-IYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILSTMI 503
            WGYG  NGP  W  SY +A G SQSPINI +++T+++                 + Q L  TGH+F+++    ++  +  P     ++K+ Q  FHWGS     GSEH IN   +P E  +  YN+T+Y  F EA NK DGL++L   I
Sbjct:    4 WGYGKLNGPETWKMSYPAAKGDSQSPINIIVNKTEFE-----------------TEQILNHTGHSFKVETSVDSMTVTNAPGFNNDVFKLVQFHFHWGSIGNDNGSEHQINGKSWPSELHLVHYNSTKYSNFTEAANKPDGLLVLGVFI 135          

HSP 2 Score: 102.064 bits (253), Expect = 2.053e-46
Identity = 49/115 (42.61%), Postives = 69/115 (60.00%), Query Frame = 2
Query:  491 IYNDIGNKNKTLDRLLGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNGFDNFRPVCSLGQRIITRNF 835
            ++  I  KN      +  L +I      + + +   ++LK LLP   +RYFTY+GSLTTPPCYE+VTWI+FE   T+S +Q+   +KVH  DGC    NFRPVC +  R + R+F
Sbjct:  133 VFIQIAGKNLEFQNFIQCLETIQADLKVNLKDKNSKINLKYLLPINTDRYFTYSGSLTTPPCYESVTWIVFEYPITMSREQIERFRKVHSEDGCETAANFRPVCPINDRKVKRSF 247          
BLAST of Carbonic anhydrase 7 vs. Planmine SMEST
Match: SMESG000016838.1 (SMESG000016838.1)

HSP 1 Score: 68.9366 bits (167), Expect = 6.370e-25
Identity = 41/117 (35.04%), Postives = 64/117 (54.70%), Query Frame = 2
Query:  503 IGNKNKTLDRL---LGPLTSIHFFKHHDFRQETELLDLKCLLPDCINRYFTYTGSLTTPPCYETVTWIIFEGSNTISEDQLNLMQKVHVADGCNG--FDNFRPVC-SLGQRIITRNF 835
            +G KN  L+++   +GP+ +    K       TE+  +  ++P+ I +Y+ Y GSLTTPPC E V WII +   T+S  QLN+ +++       G   DNFRPV  +   R+I  +F
Sbjct:  172 LGKKNAALEKIFSGIGPILA----KKESIVNVTEV-GIDLIIPNNIEKYYVYDGSLTTPPCIENVKWIIIKDELTLSSYQLNIFRELEFESPLTGPMLDNFRPVFQNKNNRVIYASF 283          

HSP 2 Score: 63.5438 bits (153), Expect = 6.370e-25
Identity = 44/153 (28.76%), Postives = 66/153 (43.14%), Query Frame = 3
Query:   42 VFMISEDWGYGPENG---PHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPLKICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFHWGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIIL 491
            +F  ++ WGY    G   P  W   + + GG  QSP+NI  +Q KY    NL P+ I       S + L     +  +   G    + G     +  K   I +HWGS    G+EH IN + +P E  +  YN   Y     A +  +GL ++
Sbjct:   19 IFGKTDVWGYKASRGIKDPSGWKDLFPTCGGSYQSPLNIQTNQVKYSQ--NLKPILIRKGVPIRSLKPLEKLARSLYLSFNGYWLITLGT---DKCMKPVSIHWHWGSVNKQGAEHTINNYSYPVEGHIVSYNCELYNSMKAAESAPNGLYVI 166          
The following BLAST results are available for this feature:
BLAST of Carbonic anhydrase 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CA12.200e-3432.32carbonic anhydrase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
CA12.200e-3432.32carbonic anhydrase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
CA12.200e-3432.32carbonic anhydrase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
CA12.200e-3432.32carbonic anhydrase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
CA14.444e-3332.32carbonic anhydrase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cah-55.174e-2026.92Putative carbonic anhydrase 5 [Source:UniProtKB/S... [more]
cah-21.029e-1932.67Putative carbonic anhydrase-like protein 2 [Sourc... [more]
cah-35.723e-1733.64Putative carbonic anhydrase 3 [Source:UniProtKB/S... [more]
cah-15.785e-1329.49Putative carbonic anhydrase-like protein 1 [Sourc... [more]
cah-41.195e-1031.33Carbonic AnHydrase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAH13.420e-3638.16gene:FBgn0027844 transcript:FBtr0080539[more]
CAH21.103e-2328.75gene:FBgn0027843 transcript:FBtr0076001[more]
CARPB1.376e-1929.19gene:FBgn0052698 transcript:FBtr0346170[more]
CARPB1.376e-1929.19gene:FBgn0052698 transcript:FBtr0336923[more]
CARPB1.376e-1929.19gene:FBgn0052698 transcript:FBtr0307489[more]
back to top
BLAST of Carbonic anhydrase 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cahz5.402e-3437.66carbonic anhydrase [Source:NCBI gene;Acc:30331][more]
ca22.635e-3237.01carbonic anhydrase II [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ca76.164e-3234.84carbonic anhydrase VII [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ca71.308e-3134.81carbonic anhydrase VII [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ca88.754e-3032.24carbonic anhydrase VIII [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca81.467e-3133.55carbonic anhydrase VIII [Source:NCBI gene;Acc:4966... [more]
proca13.190e-3135.33protein interacting with cyclin A1 [Source:Xenbase... [more]
ca133.709e-2834.00carbonic anhydrase XIII [Source:NCBI gene;Acc:7799... [more]
smarca57.536e-2834.36SWI/SNF related, matrix associated, actin dependen... [more]
CA11.093e-2732.17carbonic anhydrase I [Source:NCBI gene;Acc:1004964... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Car11.321e-3435.37carbonic anhydrase 1 [Source:MGI Symbol;Acc:MGI:88... [more]
Car11.321e-3435.37carbonic anhydrase 1 [Source:MGI Symbol;Acc:MGI:88... [more]
Car137.647e-3034.19carbonic anhydrase 13 [Source:MGI Symbol;Acc:MGI:1... [more]
Car87.127e-2932.14carbonic anhydrase 8 [Source:MGI Symbol;Acc:MGI:88... [more]
Car5a4.901e-2834.75carbonic anhydrase 5a, mitochondrial [Source:MGI S... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48282|CAH1_SHEEP1.067e-3436.59Carbonic anhydrase 1 OS=Ovis aries OX=9940 GN=CA1 ... [more]
sp|Q7M316|CAH1_GORGO2.518e-3432.93Carbonic anhydrase 1 OS=Gorilla gorilla gorilla OX... [more]
sp|P13634|CAH1_MOUSE7.803e-3435.37Carbonic anhydrase 1 OS=Mus musculus OX=10090 GN=C... [more]
sp|P00915|CAH1_HUMAN9.435e-3432.32Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA... [more]
sp|Q7M317|CAH1_PANTR1.414e-3332.32Carbonic anhydrase 1 OS=Pan troglodytes OX=9598 GN... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H9N63.912e-3638.26Alpha-carbonic anhydrase domain-containing protein... [more]
A0A1I8GEW95.183e-3638.93Alpha-carbonic anhydrase domain-containing protein... [more]
A0A267EQF48.097e-3637.58Alpha-carbonic anhydrase domain-containing protein... [more]
V4AHB65.602e-3538.78Alpha-carbonic anhydrase domain-containing protein... [more]
G4VP626.239e-3536.36Putative carbonic anhydrase II (Carbonate dehydrat... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca72.774e-3134.84carbonic anhydrase 7 [Source:NCBI gene;Acc:1030418... [more]
ca21.374e-3035.71carbonic anhydrase 1-like [Source:NCBI gene;Acc:10... [more]
ca71.444e-2734.97carbonic anhydrase 7 [Source:NCBI gene;Acc:1030418... [more]
ca5a2.707e-2628.57carbonic anhydrase 5B, mitochondrial [Source:NCBI ... [more]
ca5a3.184e-2628.57carbonic anhydrase 5B, mitochondrial [Source:NCBI ... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ca87.060e-3233.82carbonic anhydrase VIII [Source:ZFIN;Acc:ZDB-GENE-... [more]
CA27.603e-3231.25carbonic anhydrase 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
ca4b1.090e-2838.41carbonic anhydrase IV b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ca5a3.318e-1333.61carbonic anhydrase Va [Source:ZFIN;Acc:ZDB-GENE-08... [more]
ENSPMAT00000006943.13.324e-1236.23pep scaffold:Pmarinus_7.0:GL476401:102791:181294:1... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carbonic anhydrase 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460812.314e-2732.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358604.630e-2735.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404381.413e-2330.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459551.662e-2135.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421263.175e-1231.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cahz6.116e-3738.31carbonic anhydrase [Source:NCBI gene;Acc:101161087... [more]
ca81.487e-2831.58carbonic anhydrase 8 [Source:NCBI gene;Acc:1011748... [more]
ca84.579e-2730.00carbonic anhydrase 8 [Source:NCBI gene;Acc:1011748... [more]
ca74.001e-2632.26carbonic anhydrase 7 [Source:NCBI gene;Acc:1011705... [more]
ptprz1a5.927e-2630.07protein tyrosine phosphatase receptor type Z1 [Sou... [more]
back to top
BLAST of Carbonic anhydrase 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022420.15.025e-15296.86SMESG000022420.1[more]
SMESG000072395.11.260e-8857.89SMESG000072395.1[more]
SMESG000078341.14.839e-5140.94SMESG000078341.1[more]
SMESG000078341.12.053e-4637.58SMESG000078341.1[more]
SMESG000016838.16.370e-2535.04SMESG000016838.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008552 ID=SMED30008552|Name=Carbonic anhydrase 7|organism=Schmidtea mediterranea sexual|type=transcript|length=911bp
CCGATCTAAATAATTTAATTCAATAAATAATTTCAACTAAAGTTTTTATG
ATTTCTGAAGATTGGGGATATGGACCTGAGAACGGTCCACATTTATGGCA
CAAATCGTATTCCAGTGCGGGAGGATGTTCCCAATCTCCTATCAATATAG
ATCTTTCACAGACAAAATACGATATGACTTTAAATTTACATCCTTTAAAA
ATATGCATTGATAGTTCGAGGACATCAAGTCAGACTTTGGTATTTACAGG
ACATAATTTCCGAATCGACTGTGAAGGAGCACTATGCGCATCGGGAGGCC
CAATTCCCTATGGTCAAATGTACAAAATTTCCCAAATTGTGTTTCATTGG
GGCAGTACAATTTATGGAGGATCTGAACATTTGATAAATTGTTTTCAATT
CCCATGTGAATGCCAAATGACCTGCTACAATGCCACTCGTTATAGGTGCT
TCAATGAGGCGGTAAATAAAAGAGATGGGCTAATTATCCTATCTACAATG
ATATTGGGAACAAAAATAAAACCCTCGATCGTTTATTGGGTCCTTTGACG
TCGATTCACTTTTTCAAACACCATGACTTCCGGCAAGAAACCGAACTGTT
AGATTTGAAATGTCTTTTACCAGATTGCATCAATCGATACTTCACCTACA
CTGGGTCATTGACTACCCCACCTTGCTATGAAACTGTTACGTGGATCATA
TTCGAAGGATCCAACACAATCAGTGAGGATCAACTAAATCTCATGCAGAA
AGTTCACGTAGCCGACGGCTGTAATGGCTTTGACAACTTCAGACCGGTTT
GCTCACTCGGCCAAAGAATCATTACCAGAAATTTTGTTTGAGCCTTTTTT
GAACTTGATTTATTTAAATTTTATTTTTTTAATTGCTACTGTAGTGGATG
TTATGGGGAAT
back to top

protein sequence of SMED30008552-orf-1

>SMED30008552-orf-1 ID=SMED30008552-orf-1|Name=SMED30008552-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=167bp
MISEDWGYGPENGPHLWHKSYSSAGGCSQSPINIDLSQTKYDMTLNLHPL
KICIDSSRTSSQTLVFTGHNFRIDCEGALCASGGPIPYGQMYKISQIVFH
WGSTIYGGSEHLINCFQFPCECQMTCYNATRYRCFNEAVNKRDGLIILST
MILGTKIKPSIVYWVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
Vocabulary: INTERPRO
TermDefinition
IPR001148CA_dom
Vocabulary: molecular function
TermDefinition
GO:0004089carbonate dehydratase activity
GO:0008270zinc ion binding
GO:0016829lyase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006730one-carbon metabolic process