Synaptotagmin-1 Synaptotagmin I

Overview
NameSynaptotagmin-1 Synaptotagmin I
Smed IDSMED30008541
Length (bp)1433
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin-1 Synaptotagmin I (SMED30008541) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin-1 Synaptotagmin I (SMED30008541) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin-1 Synaptotagmin I (SMED30008541) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin-1 Synaptotagmin I (SMED30008541) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008541

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30008541h1SMcG0015592 dd_Smed_v4_20033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30008541h1SMcG0015592 dd_Smed_v4_20033_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Human
Match: SYT2 (synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510])

HSP 1 Score: 112.079 bits (279), Expect = 2.463e-26
Identity = 86/284 (30.28%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + F++DY F  N L V V+Q   L +       D YVKV + P+    K  +TK+  +T NP F++ F F++   EL    +++ ++D D     D ++G ++ P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K  T +PYF+E+F + +   +   V ++  V     +G  + +GK+ +GSN+ T +   HW DM+A PR   + WH+L  +E  D
Sbjct:  140 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDK--KKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHD-IIGEVKVPMNTVDLGQPIEEWRDLQGGEK-------EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNA-TGTELRHWSDMLANPRRPIAQWHSLKPEEEVD 412          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Human
Match: SYT2 (synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510])

HSP 1 Score: 112.079 bits (279), Expect = 2.463e-26
Identity = 86/284 (30.28%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + F++DY F  N L V V+Q   L +       D YVKV + P+    K  +TK+  +T NP F++ F F++   EL    +++ ++D D     D ++G ++ P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K  T +PYF+E+F + +   +   V ++  V     +G  + +GK+ +GSN+ T +   HW DM+A PR   + WH+L  +E  D
Sbjct:  140 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDK--KKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHD-IIGEVKVPMNTVDLGQPIEEWRDLQGGEK-------EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNA-TGTELRHWSDMLANPRRPIAQWHSLKPEEEVD 412          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 108.997 bits (271), Expect = 3.383e-25
Identity = 87/284 (30.63%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + +++DY F  N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++  SEL    +++ V+D D     D ++G  + P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS T +   HW DM+A PR   + WH L  +E  D
Sbjct:  140 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHD-IIGEFKVPMNTVDFGHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNS-TGAELRHWSDMLANPRRPIAQWHTLQVEEEVD 412          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 108.612 bits (270), Expect = 3.920e-25
Identity = 87/284 (30.63%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + +++DY F  N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++  SEL    +++ V+D D     D ++G  + P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS T +   HW DM+A PR   + WH L  +E  D
Sbjct:  143 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHD-IIGEFKVPMNTVDFGHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNS-TGAELRHWSDMLANPRRPIAQWHTLQVEEEVD 415          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 108.612 bits (270), Expect = 3.920e-25
Identity = 87/284 (30.63%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + +++DY F  N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++  SEL    +++ V+D D     D ++G  + P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS T +   HW DM+A PR   + WH L  +E  D
Sbjct:  143 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHD-IIGEFKVPMNTVDFGHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNS-TGAELRHWSDMLANPRRPIAQWHTLQVEEEVD 415          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 105.531 bits (262), Expect = 2.401e-25
Identity = 85/279 (30.47%), Postives = 137/279 (49.10%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQV-------FGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            LG + + +DY F KN L V ++Q         G TS      D YVK+ + P+    K  +TK+Q ++ NP F++ F F+I  +E+    ++L VFD D  G  D  +G +  P+  +          E+   ++ P E+  G  E+C+ LR+ P ++ L V V+E K L       +   YV +      + LE K TT K  T +PY++E+F + +   K   V+L   V     +G  + +G++ IG+   T  A   W DM+A PR + + WH L
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTS------DPYVKLFLLPDKK--KKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQ-IGQISIPLGKVDLAA----TLERTDLIESPPENRLG--EVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGT-CATGVALKQWNDMLATPRRSVAQWHTL 278          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 105.531 bits (262), Expect = 2.401e-25
Identity = 85/279 (30.47%), Postives = 137/279 (49.10%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQV-------FGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            LG + + +DY F KN L V ++Q         G TS      D YVK+ + P+    K  +TK+Q ++ NP F++ F F+I  +E+    ++L VFD D  G  D  +G +  P+  +          E+   ++ P E+  G  E+C+ LR+ P ++ L V V+E K L       +   YV +      + LE K TT K  T +PY++E+F + +   K   V+L   V     +G  + +G++ IG+   T  A   W DM+A PR + + WH L
Sbjct:   16 LGRLQYKLDYDFDKNSLTVVIIQAEELPAMDLGGTS------DPYVKLFLLPDKK--KKLQTKVQRKSLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQ-IGQISIPLGKVDLAA----TLERTDLIESPPENRLG--EVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGT-CATGVALKQWNDMLATPRRSVAQWHTL 278          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 98.2117 bits (243), Expect = 2.953e-22
Identity = 79/289 (27.34%), Postives = 141/289 (48.79%), Query Frame = 3
Query:  582 KLGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGN---GEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGS---NSP--TLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            + G+I F ++Y F ++ L V ++    L +   N   D YVKV + PE    +  +T+I   T NPT+++ FQF I  +EL +  ++L V+D+D     D M G +  P+  +   +F  +  + + PL  P +  E     G+IC   R+ P    + +T++E + L           YV +  +   +LL  K T+ KY T +PY++E+F++ ++P     V+L+  V+    +     +G++ +GS   N P  T +    W +M+   R     WH L +   K+
Sbjct:   83 QYGNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVLPE--RKQKFETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKM-GQLSVPLESI---DF-GITTDIERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSKHLNLPQITHACSEQWAEMMTSRRPVVQ-WHTLQERMEKE 363          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 92.8189 bits (229), Expect = 3.982e-20
Identity = 83/283 (29.33%), Postives = 135/283 (47.70%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGN---GEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKN-ELLETKYTTTKYNTRDPYFSETFEYHLKPV-KAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALS 1403
            LG I + +DY F +  L V V+Q   L     +   D YVK+ + PE    K  +TK+  +T NP F++ F F++  +E+    ++  ++D D     D  +G +  P+  +      EE++++         PP +  E     G+IC  LR+ P    L V +LE K L       +   YV +E + ++ + L+ K T  K  T +PYF+E+F +   P+ K   V L+  V     +G    +G+  +G N  T +   HWMDM+A PR   + WH L 
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEK--KKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQ-IGQVLIPLGKIDLGAVIEEWKDIA--------PPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDYDKLGSNDAIGRCLLGCNG-TGAELRHWMDMLASPRRPIAQWHTLG 430          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 90.8929 bits (224), Expect = 1.736e-19
Identity = 79/281 (28.11%), Postives = 131/281 (46.62%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGN---GEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALS 1403
            LG I + +DY F +  L V V+Q   L     +   D YVK+ + PE    K  +TK+  +T NP F++ F F++  +E+    ++  ++D D     D  +G +  P+  +      EE++++         PP +  E     G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K T+ K  T +PY++E+F + +   +   V L+  V     +G    +G+  +G N  T +   HWMDM+A PR   + WH L 
Sbjct:  160 LGRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGTSDPYVKLYLLPEK--KKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQ-IGQVLIPLGKIDLGAVIEEWKDIA--------PPPDDKEAEKSLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKVSLMITVMDYDKLGSNDAIGRCLLGCNG-TGAELRHWMDMLASPRRPIAQWHTLG 428          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0343993)

HSP 1 Score: 95.5153 bits (236), Expect = 8.510e-21
Identity = 84/301 (27.91%), Postives = 139/301 (46.18%), Query Frame = 3
Query:  555 DDVGEYKPSKLGDISFAIDYLFGKNILVVNVMQV-------FGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILK-SELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            D+  +    KLG ++F ++Y F  N L V V+Q         G TS      D YVKV + P+    K  +TK+  +T +P F++ F F+ L  ++  N  ++  +FD D     D  +G ++ P+  +    T EE+++L       +    E  +  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K T+ K  T +PY++E+F + +   +   + L+  V     IG  + +G+  +G    T +   HW DM+A PR   + WH L   E  D
Sbjct:  183 DEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTS------DPYVKVYLLPD--KKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQ-IGEVKVPLCTIDLAQTIEEWRDL-------VSVEGEGGQKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMG-TGTELRHWSDMLASPRRPIAQWHTLKDPEETD 466          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0332218)

HSP 1 Score: 94.7449 bits (234), Expect = 1.453e-20
Identity = 85/302 (28.15%), Postives = 138/302 (45.70%), Query Frame = 3
Query:  555 DDVGEYKPSKLGDISFAIDYLFGKNILVVNVMQV-------FGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILK-SELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGN-GEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            D+  +    KLG ++F ++Y F  N L V V+Q         G TS      D YVKV + P+    K  +TK+  +T +P F++ F F+ L  ++  N  ++  +FD D     D  +G ++ P+  +    T EE+++L            E   G  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K T+ K  T +PY++E+F + +   +   + L+  V     IG  + +G+  +G    T +   HW DM+A PR   + WH L   E  D
Sbjct:  183 DEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTS------DPYVKVYLLPD--KKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQ-IGEVKVPLCTIDLAQTIEEWRDLVS---------VEGEGGQLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMG-TGTELRHWSDMLASPRRPIAQWHTLKDPEETD 465          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077728)

HSP 1 Score: 93.9745 bits (232), Expect = 2.584e-20
Identity = 85/304 (27.96%), Postives = 138/304 (45.39%), Query Frame = 3
Query:  555 DDVGEYKPSKLGDISFAIDYLFGKNILVVNVMQV-------FGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILK-SELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGN---GEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            D+  +    KLG ++F ++Y F  N L V V+Q         G TS      D YVKV + P+    K  +TK+  +T +P F++ F F+ L  ++  N  ++  +FD D     D  +G ++ P+  +    T EE+++L            E   G    G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K T+ K  T +PY++E+F + +   +   + L+  V     IG  + +G+  +G    T +   HW DM+A PR   + WH L   E  D
Sbjct:  181 DEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTS------DPYVKVYLLPD--KKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQ-IGEVKVPLCTIDLAQTIEEWRDLVS---------VEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMG-TGTELRHWSDMLASPRRPIAQWHTLKDPEETD 465          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0345331)

HSP 1 Score: 93.9745 bits (232), Expect = 2.584e-20
Identity = 85/304 (27.96%), Postives = 138/304 (45.39%), Query Frame = 3
Query:  555 DDVGEYKPSKLGDISFAIDYLFGKNILVVNVMQV-------FGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILK-SELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGN---GEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            D+  +    KLG ++F ++Y F  N L V V+Q         G TS      D YVKV + P+    K  +TK+  +T +P F++ F F+ L  ++  N  ++  +FD D     D  +G ++ P+  +    T EE+++L            E   G    G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K T+ K  T +PY++E+F + +   +   + L+  V     IG  + +G+  +G    T +   HW DM+A PR   + WH L   E  D
Sbjct:  181 DEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTS------DPYVKVYLLPD--KKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQ-IGEVKVPLCTIDLAQTIEEWRDLVS---------VEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMG-TGTELRHWSDMLASPRRPIAQWHTLKDPEETD 465          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0077727)

HSP 1 Score: 93.9745 bits (232), Expect = 2.584e-20
Identity = 85/304 (27.96%), Postives = 138/304 (45.39%), Query Frame = 3
Query:  555 DDVGEYKPSKLGDISFAIDYLFGKNILVVNVMQV-------FGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILK-SELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGN---GEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            D+  +    KLG ++F ++Y F  N L V V+Q         G TS      D YVKV + P+    K  +TK+  +T +P F++ F F+ L  ++  N  ++  +FD D     D  +G ++ P+  +    T EE+++L            E   G    G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K T+ K  T +PY++E+F + +   +   + L+  V     IG  + +G+  +G    T +   HW DM+A PR   + WH L   E  D
Sbjct:  181 DEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTS------DPYVKVYLLPD--KKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQ-IGEVKVPLCTIDLAQTIEEWRDLVS---------VEGEGGQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEPIGRCILGCMG-TGTELRHWSDMLASPRRPIAQWHTLKDPEETD 465          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Zebrafish
Match: syt5a (synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-110])

HSP 1 Score: 115.931 bits (289), Expect = 6.224e-28
Identity = 82/281 (29.18%), Postives = 140/281 (49.82%), Query Frame = 3
Query:  594 ISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            + + +DY F +N L+V ++Q   L +       D YVKV + P+    K  +TK+Q +   P F++ F F+I  ++L    ++L+VFD D  G  D ++G ++ P++ +       E+++L   +K       E  E  G+ICI LR+ P    L V ++E K L       +   +V +      + ++ K TT K NT +PYF+E+F + +   +   V +L  V+    +G    +GK  IG  +  +  + HW DM+A PR   + WH L  +E  D
Sbjct:  133 LEYTLDYNFTENQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPDK--KKKFETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHD-VIGEIKIPMNSIDLGQPIHEYKDLVGGEK-------EEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKIVLQHNGKRIKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKVQVLITVYDYDKLGSNDPIGKCWIGFGASGVGLR-HWSDMLANPRRPVAQWHTLQPEEEVD 402          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 111.309 bits (277), Expect = 3.373e-26
Identity = 88/284 (30.99%), Postives = 146/284 (51.41%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM--TH--EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + +++DY F +N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++  +EL    +++ V+D D     D+ +G ++ P++ +  +H  EE+++L   +K       E  E  G+IC  LR+ P    L V VLE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS T +   HW DM+A PR   + WH L  +E  D
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDA-IGDVKVPMNKVDFSHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNS-TGTELRHWSDMLANPRRPIAQWHVLKPEEEVD 411          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Zebrafish
Match: syt1a (synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-165])

HSP 1 Score: 111.309 bits (277), Expect = 3.373e-26
Identity = 88/284 (30.99%), Postives = 146/284 (51.41%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM--TH--EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + +++DY F +N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++  +EL    +++ V+D D     D+ +G ++ P++ +  +H  EE+++L   +K       E  E  G+IC  LR+ P    L V VLE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS T +   HW DM+A PR   + WH L  +E  D
Sbjct:  139 LGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDA-IGDVKVPMNKVDFSHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKNDAIGKVFVGLNS-TGTELRHWSDMLANPRRPIAQWHVLKPEEEVD 411          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 109.768 bits (273), Expect = 1.382e-25
Identity = 86/281 (30.60%), Postives = 138/281 (49.11%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPT-ESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + F++DY F  + L V ++Q   L S  S    D YVKV I P+    K   TK+  +T NP F++ F F+I  +E+    +++ V+D D     D ++G ++ P++ +   +    P E+   LD    E  E  G+ICI LR+ P    L + +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   +  +  V     IG    +GK+ +GS +     + HW DM+A PR   + WH L  +E  D
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPD--KKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHD-VIGEVKIPMNTLDLAQ----PIEQWRDLDSAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELR-HWSDMLANPRRPIAQWHPLKPEEEVD 420          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 109.768 bits (273), Expect = 1.382e-25
Identity = 86/281 (30.60%), Postives = 138/281 (49.11%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPT-ESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + F++DY F  + L V ++Q   L S  S    D YVKV I P+    K   TK+  +T NP F++ F F+I  +E+    +++ V+D D     D ++G ++ P++ +   +    P E+   LD    E  E  G+ICI LR+ P    L + +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   +  +  V     IG    +GK+ +GS +     + HW DM+A PR   + WH L  +E  D
Sbjct:  148 LGKLQFSLDYDFSASQLTVGILQAADLLSMDSGGTSDPYVKVFILPD--KKKKYDTKVHKKTLNPVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHD-VIGEVKIPMNTLDLAQ----PIEQWRDLDSAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELR-HWSDMLANPRRPIAQWHPLKPEEEVD 420          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 117.857 bits (294), Expect = 2.586e-28
Identity = 94/295 (31.86%), Postives = 150/295 (50.85%), Query Frame = 3
Query:  555 DDVGEYKPS-KLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISL--MTH--EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            DDV + KP  KLG + +++DY F    LVV ++Q   L +       D YVKV + P+    K  +TK+  +T NPTF++ F F++  +EL    +++ V+D D     D+ +G +R  ++   + H  EE+Q+L   +K       E  E  G+IC  LR+ P    L V VLE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     +G  + +GK+ +G N+ T +   HW DM+A PR   + WH L  +E  D
Sbjct:  130 DDVKDEKPQEKLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDK--KKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDA-IGEVRVHMNTVDLAHVIEEWQDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNA-TGTELRHWSDMLANPRRPIAQWHTLQPEEEVD 413          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 117.472 bits (293), Expect = 2.971e-28
Identity = 94/295 (31.86%), Postives = 150/295 (50.85%), Query Frame = 3
Query:  555 DDVGEYKPS-KLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISL--MTH--EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            DDV + KP  KLG + +++DY F    LVV ++Q   L +       D YVKV + P+    K  +TK+  +T NPTF++ F F++  +EL    +++ V+D D     D+ +G +R  ++   + H  EE+Q+L   +K       E  E  G+IC  LR+ P    L V VLE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     +G  + +GK+ +G N+ T +   HW DM+A PR   + WH L  +E  D
Sbjct:  125 DDVKDEKPQEKLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDPYVKVYLLPDK--KKKYETKVHRKTLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDA-IGEVRVHMNTVDLAHVIEEWQDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNA-TGTELRHWSDMLANPRRPIAQWHTLQPEEEVD 408          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Xenopus
Match: e2f4 (E2F transcription factor 4 [Source:Xenbase;Acc:XB-GENE-482721])

HSP 1 Score: 110.538 bits (275), Expect = 1.024e-25
Identity = 92/303 (30.36%), Postives = 152/303 (50.17%), Query Frame = 3
Query:  528 TKITDMHFEDDVGEYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            T +TD   ED     +  KLG + +++DY F  N L+V ++Q   L +       D YVK+ + P+    K  +TK+  +T NP F+++F F++  +EL    ++L V+D D     D ++G ++ P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS T +   HW DM+A PR   + WH L+ +E  D
Sbjct:  129 TGLTDG--EDKEQPKEVEKLGKLQYSLDYDFQNNQLMVGIIQAAELPALDMGGTSDPYVKLFLMPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYAELGGKTLVLTVYDFDRFSKHD-VIGDVKVPMNTVDFGHVTEEWRDLVSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNS-TGAELRHWSDMLANPRRPIAQWHTLTPEEEVD 418          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Xenopus
Match: luzp2 (leucine zipper protein 2 [Source:Xenbase;Acc:XB-GENE-940667])

HSP 1 Score: 102.834 bits (255), Expect = 4.001e-23
Identity = 82/279 (29.39%), Postives = 136/279 (48.75%), Query Frame = 3
Query:  600 FAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            F++DY F  N + V ++Q   L +       D YVKV   P+    K  +TK+  +T NP F++ F F+I   EL    + + ++D D     D ++G ++ P++ +      EE+++L   +K       E  E  G+ICI LR+ P    L V +LE K L       +   YV +      + L+ K TT K  T +PYF+E+F + +   +   V ++  V     +G  + +GK+ +G N+ + +   HW DM+A PR   + WH L  +E  D
Sbjct:  151 FSLDYDFQNNQMQVGIIQATELPALDMGGTSDPYVKVFFLPDK--KKKHETKVHRKTLNPIFNETFTFKIPYQELGGKTLCMSIYDFDRFSKHD-IIGEVKVPMNTVDLGQPIEEWRDLQSAEK-------EEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFVGCNA-SGTELRHWSDMLANPRRPIAQWHPLKPEEEVD 418          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Xenopus
Match: syt8 (synaptotagmin 8 [Source:NCBI gene;Acc:100037878])

HSP 1 Score: 100.908 bits (250), Expect = 1.387e-22
Identity = 77/285 (27.02%), Postives = 133/285 (46.67%), Query Frame = 3
Query:  588 GDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFD------HDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            G + ++++Y F    L V V Q   L +       D Y  V +  ++   K  +TK+  +T NP F++ F F++ + E+     ++++FD      HD+ G     LG +     +   E++++L    K      TE HE  G+IC  LR+ P    L + +LE K L           YV V      +  + K T  K +T  PYF+E+F + +   +   + L+  V+    +G  + +GKL +G  + + +A  HW DM+A+PR   + WH L + +  D
Sbjct:  107 GRVQYSLEYNFQTEELTVGVKQAAALKAMDLGGTSDPYAIVYVTNDT--RKKFETKVNRKTLNPVFNESFVFKVTQEEVPRTTAVVQIFDFNRFLKHDVIGEMVIPLGEVNLQHVI---EDWKDLGPAGK------TE-HEHLGDICFSLRYVPSSGKLTIIILEAKNLKRMDSDGFSDPYVKVHLALNRKKWKRKKTAVKKSTLKPYFNESFTFDVSLEQMKNLDLIISVWDHDKVGKNEQIGKLFLGCRA-SGNALRHWSDMLAHPRRPIAQWHKLQEADEVD 378          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 112.464 bits (280), Expect = 1.252e-26
Identity = 86/284 (30.28%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + F++DY F  N L V V+Q   L +       D YVKV + P+    K  +TK+  +T NP F++ F F++   EL    +++ ++D D     D ++G ++ P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K  T +PYF+E+F + +   +   V ++  V     +G  + +GK+ +GSN+ T +   HW DM+A PR   + WH+L  +E  D
Sbjct:  143 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDK--KKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHD-IIGEVKVPMNTVDLGQPIEEWRDLQGGEK-------EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNA-TGTELRHWSDMLANPRRPIAQWHSLKPEEEVD 415          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 112.464 bits (280), Expect = 1.252e-26
Identity = 86/284 (30.28%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + F++DY F  N L V V+Q   L +       D YVKV + P+    K  +TK+  +T NP F++ F F++   EL    +++ ++D D     D ++G ++ P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K  T +PYF+E+F + +   +   V ++  V     +G  + +GK+ +GSN+ T +   HW DM+A PR   + WH+L  +E  D
Sbjct:  143 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDK--KKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHD-IIGEVKVPMNTVDLGQPIEEWRDLQGGEK-------EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNA-TGTELRHWSDMLANPRRPIAQWHSLKPEEEVD 415          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 108.997 bits (271), Expect = 2.138e-25
Identity = 87/284 (30.63%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + +++DY F  N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++  SEL    +++ V+D D     D ++G  + P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS T +   HW DM+A PR   + WH L  +E  D
Sbjct:  142 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHD-IIGEFKVPMNTVDFGHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNS-TGAELRHWSDMLANPRRPIAQWHTLQVEEEVD 414          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 108.997 bits (271), Expect = 2.138e-25
Identity = 87/284 (30.63%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + +++DY F  N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++  SEL    +++ V+D D     D ++G  + P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS T +   HW DM+A PR   + WH L  +E  D
Sbjct:  142 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHD-IIGEFKVPMNTVDFGHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNS-TGAELRHWSDMLANPRRPIAQWHTLQVEEEVD 414          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Mouse
Match: Syt3 (synaptotagmin III [Source:MGI Symbol;Acc:MGI:99665])

HSP 1 Score: 100.138 bits (248), Expect = 5.655e-22
Identity = 77/277 (27.80%), Postives = 130/277 (46.93%), Query Frame = 3
Query:  588 GDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDES 1415
            G ISFA+ YL+G + LVV ++Q   L +  SN   D YVK+ + P+    K  +TK+  +T NP F++ FQF +  +EL    +   V+D D     D ++G +     L   E+  + P  + + L+  +E  +  GE+   L + P    L VT+++   L     T     YV      +   L+ + T+ K NT +P ++E   + + P     V L   V     IG  + +G   +G  +     + HW +M+A PR     WH L ++++
Sbjct:  298 GRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPD--RKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHD-LIGQVVLDNLLELAEQPPDRPLWRDI-LEGGSEKAD-LGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKT 569          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. UniProt/SwissProt
Match: sp|Q5R4J5|SYT1_PONAB (Synaptotagmin-1 OS=Pongo abelii OX=9601 GN=SYT1 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.427e-29
Identity = 87/284 (30.63%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM----THEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + +++DY F  N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++  SEL    +++ V+D D     D ++G  + P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS T +   HW DM+A PR   + WH L  +E  D
Sbjct:  140 LGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHD-IIGEFKVPMNTVDFGHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKETTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNS-TGAELRHWSDMLANPRRPIAQWHTLQVEEEVD 412          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. UniProt/SwissProt
Match: sp|P46097|SYT2_MOUSE (Synaptotagmin-2 OS=Mus musculus OX=10090 GN=Syt2 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 7.159e-26
Identity = 86/284 (30.28%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + F++DY F  N L V V+Q   L +       D YVKV + P+    K  +TK+  +T NP F++ F F++   EL    +++ ++D D     D ++G ++ P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K  T +PYF+E+F + +   +   V ++  V     +G  + +GK+ +GSN+ T +   HW DM+A PR   + WH+L  +E  D
Sbjct:  143 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDK--KKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHD-IIGEVKVPMNTVDLGQPIEEWRDLQGGEK-------EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNA-TGTELRHWSDMLANPRRPIAQWHSLKPEEEVD 415          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. UniProt/SwissProt
Match: sp|P29101|SYT2_RAT (Synaptotagmin-2 OS=Rattus norvegicus OX=10116 GN=Syt2 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 8.590e-26
Identity = 86/284 (30.28%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + F++DY F  N L V V+Q   L +       D YVKV + P+    K  +TK+  +T NP F++ F F++   EL    +++ ++D D     D ++G ++ P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K  T +PYF+E+F + +   +   V ++  V     +G  + +GK+ +GSN+ T +   HW DM+A PR   + WH+L  +E  D
Sbjct:  143 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDK--KKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHD-IIGEVKVPMNTVDLGQPIEEWRDLQGGEK-------EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNA-TGTELRHWSDMLANPRRPIAQWHSLKPEEEVD 415          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. UniProt/SwissProt
Match: sp|Q8N9I0|SYT2_HUMAN (Synaptotagmin-2 OS=Homo sapiens OX=9606 GN=SYT2 PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.183e-25
Identity = 86/284 (30.28%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + F++DY F  N L V V+Q   L +       D YVKV + P+    K  +TK+  +T NP F++ F F++   EL    +++ ++D D     D ++G ++ P++ +      EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K  T +PYF+E+F + +   +   V ++  V     +G  + +GK+ +GSN+ T +   HW DM+A PR   + WH+L  +E  D
Sbjct:  140 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDK--KKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHD-IIGEVKVPMNTVDLGQPIEEWRDLQGGEK-------EEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNA-TGTELRHWSDMLANPRRPIAQWHSLKPEEEVD 412          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. UniProt/SwissProt
Match: sp|A0A075F932|SYT1_ANSCY (Synaptotagmin-1 OS=Anser cygnoid OX=8845 GN=SYT1 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 2.813e-25
Identity = 89/286 (31.12%), Postives = 139/286 (48.60%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFD------HDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG I +++DY F  N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++  SEL    +++ V+D      HDI G     +  + F       EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS T +   HW DM+A PR   + WH L  +E  D
Sbjct:  142 LGKIQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDK--KKKYETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEYKVAMNTVDFG---HVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVVTVLDYDKIGKNDAIGKVFVGYNS-TGAELRHWSDMLANPRRPIAQWHTLQPEEEVD 414          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. TrEMBL
Match: A0A085MJA4 (Uncharacterized protein OS=Trichuris suis OX=68888 GN=M513_01811 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.765e-31
Identity = 92/285 (32.28%), Postives = 147/285 (51.58%), Query Frame = 3
Query:  558 DVGEYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPS---NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLP-CEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            D GE  P  LG +S+ +DY F K  L V V++  G   P+   +   D YVKV + P+    K  +T++  +T NP F++ F F++  +EL +  +   V+D D  G  D  +G ++ P++ +   E   L  C     + PP E+  G  E+C+ LR+ P ++ L V V+E K L       +   YV +     N+ LE K T+ K  T +PY++E+F + + P K   V+L+  V     +G    +G++ IG NS T +A  HW DM+  PR + + WH L
Sbjct:    8 DKGE--PKYLGKLSYVLDYDFEKGQLAVTVVE--GQELPAMDFSGTSDPYVKVYLMPDKK--KRFQTRVHRKTLNPVFNETFIFKVPYNELPSKTLTFSVYDFDRFGRNDQ-IGQLQVPLNSVDLGEVVRLTRC-----IQPPPENRLG--EVCLALRYVPNKNKLNVVVMEAKNLKKMDVIGLSDPYVKIYLMLGNKRLEKKKTSIKMKTLNPYYNESFGFEVSPEKLQRVHLVVTVMDYDRVGSNDPIGRIVIGPNS-TGAALRHWTDMINSPRRSTAQWHQL 277          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. TrEMBL
Match: A0A077YUP4 (Synaptotagmin 1 OS=Trichuris trichiura OX=36087 GN=TTRE_0000006601 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 7.013e-30
Identity = 90/283 (31.80%), Postives = 147/283 (51.94%), Query Frame = 3
Query:  567 EYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPS---NVEIDSYVKVRIEPESWNIKPR-KTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLP-CEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            + +P  LG +S+ +DY F K  L V V++  G   P+   +   D YVKV + P+    K R +T++  +T NP F++ F F++  +EL +  +   V+D D  G  D  +G ++ P++ +   E   L  C     + PP E+  G  E+C+ LR+ P ++ L V V+E K L       +   YV +     N+ LE K T+ K  T +PY++E+F + + P K   V+L+  V     +G    +G++ IG NS T +A  HW DM+  PR + + WH L
Sbjct:    9 QAEPKYLGKLSYVLDYDFEKGQLAVTVVE--GQELPAMDFSGTSDPYVKVYLMPDK---KKRFQTRVHRKTLNPVFNETFVFKVPYNELPSKTLTFSVYDFDRFGKNDQ-IGQLQVPLNSVDLGEVVRLTRC-----IQPPPENRLG--EVCLALRYVPNKNKLNVVVMEAKNLKKMDVIGLSDPYVKIYLMLGNKRLEKKKTSIKMKTLNPYYNESFGFEVSPEK---VHLVITVMDYDRVGSNDPIGRIVIGPNS-TGAALRHWTDMINSPRRSTAQWHQL 274          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. TrEMBL
Match: A0A183BQK0 (Uncharacterized protein OS=Globodera pallida OX=36090 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.465e-29
Identity = 91/279 (32.62%), Postives = 147/279 (52.69%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFP---ISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKD 1409
            LG +S+ ++Y F KN L V +M    L +       D YVK+ + P+    K  +TK+Q ++ NP F++ FQFR+  +E+ +  ++L VFD D  G  D  +G +  P   I L T         EK +P++ P E+  G  ++C+ LR+ P ++ L V V+E K L       +   YV +    +N+ LE K TT K  T +PY++E+F + + P K   V+L   V     +G  + +G + IG+N+  +  + HW DM+A PR + + WH L  D
Sbjct:   38 LGTLSYKLEYDFDKNNLTVLIMSAENLPAMDLGGTSDPYVKLFLLPDKK--KKFQTKVQRKSLNPVFNESFQFRVPYNEINSQTLVLNVFDFDRFGKHDQ-IGQISIPLGKIDLATT-------IEKTVPIEAPPENRLG--DVCLALRYVPNKNKLTVVVMECKNLKKMDVLGLSDPYVKIYLMAQNKRLEKKKTTIKMKTLNPYYNESFSFEVSPEKLQRVHLHVIVSDYDRVGSNERIGHVIIGTNTNGVGLK-HWQDMIATPRRSVAAWHPLQND 303          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. TrEMBL
Match: A0A0V1PA13 (Synaptotagmin-1 OS=Trichinella sp. T8 OX=92180 GN=snt-1 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 4.336e-29
Identity = 90/280 (32.14%), Postives = 145/280 (51.79%), Query Frame = 3
Query:  573 KPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPS---NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPI-SLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            +P  LG +S+ +DY F K  L V V  V G   P+   +   D YVK+ + PE    K  +T++  +T NP F++ F F++  +EL +  ++  ++D D  G  D  +G ++ P+ S+   E  +   C     + PP E+  G  E+C+ LR+ P +  L V V+E K L       +   YV +     N+ LE K TT K  T +PY++E+F + + P K   V+L+  V     +G    +G+++IG NS  L  + HWMDM+  PR + + WH L
Sbjct:   12 EPKYLGKLSYVLDYDFEKGQLSVTV--VDGQELPAMDLSGTSDPYVKLYLMPEKK--KKFQTQVHRKTLNPVFNETFVFKVPYNELPSKTLLFSIYDFDRFGKNDQ-IGQLQVPLNSVDLGEVVRQTRC-----IQPPPENRLG--EVCLALRYVPNKSKLNVVVMEAKNLKKMDVIGLSDPYVKIYLMMGNKRLEKKKTTIKMKTLNPYYNESFGFEVSPEKLQRVHLVITVMDYDRVGSNDAIGRVQIGPNSSGLGLR-HWMDMINSPRRSTAQWHVL 278          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. TrEMBL
Match: A0A0V0VP69 (Synaptotagmin-1 OS=Trichinella sp. T9 OX=181606 GN=snt-1 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 4.336e-29
Identity = 90/280 (32.14%), Postives = 145/280 (51.79%), Query Frame = 3
Query:  573 KPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPS---NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPI-SLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            +P  LG +S+ +DY F K  L V V  V G   P+   +   D YVK+ + PE    K  +T++  +T NP F++ F F++  +EL +  ++  ++D D  G  D  +G ++ P+ S+   E  +   C     + PP E+  G  E+C+ LR+ P +  L V V+E K L       +   YV +     N+ LE K TT K  T +PY++E+F + + P K   V+L+  V     +G    +G+++IG NS  L  + HWMDM+  PR + + WH L
Sbjct:   12 EPKYLGKLSYVLDYDFEKGQLSVTV--VDGQELPAMDLSGTSDPYVKLYLMPEKK--KKFQTQVHRKTLNPVFNETFVFKVPYNELPSKTLLFSIYDFDRFGKNDQ-IGQLQVPLNSVDLGEVVRQTRC-----IQPPPENRLG--EVCLALRYVPNKSKLNVVVMEAKNLKKMDVIGLSDPYVKIYLMMGNKRLEKKKTTIKMKTLNPYYNESFGFEVSPEKLQRVHLVITVMDYDRVGSNDAIGRVQIGPNSSGLGLR-HWMDMINSPRRSTAQWHVL 278          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Cavefish
Match: syt5a (synaptotagmin-2-like [Source:NCBI gene;Acc:103027827])

HSP 1 Score: 118.627 bits (296), Expect = 6.711e-29
Identity = 84/280 (30.00%), Postives = 136/280 (48.57%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
             G + +++DY F  N L+V ++Q   L +       D YVKV + P+    K  +TK+Q +   P F++ F F+I  ++L    ++L+VFD D  G  D    I    I++ + +  Q +   K L +    E  E  G+ICI LR+ P    L V ++E K L       +   +V V      + L+ K TT K NT +PYF+E+F + +   +   + +L  V+    +G    +GK  IG  +  +  + HW DM+A PR   + WH L  +E  D
Sbjct:  129 FGKLEYSLDYNFTDNQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPDK--KKKFETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDV---IGEIKIAMNSIDLGQPIHEWKDL-VGGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKVVLQHNGKRLKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKIQVLITVYDYDKLGSNDAIGKCWIGYGASGVGLR-HWSDMLANPRRPVAQWHTLQPEEEVD 401          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Cavefish
Match: syt5a (synaptotagmin-2-like [Source:NCBI gene;Acc:103027827])

HSP 1 Score: 118.242 bits (295), Expect = 8.224e-29
Identity = 84/280 (30.00%), Postives = 136/280 (48.57%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
             G + +++DY F  N L+V ++Q   L +       D YVKV + P+    K  +TK+Q +   P F++ F F+I  ++L    ++L+VFD D  G  D    I    I++ + +  Q +   K L +    E  E  G+ICI LR+ P    L V ++E K L       +   +V V      + L+ K TT K NT +PYF+E+F + +   +   + +L  V+    +G    +GK  IG  +  +  + HW DM+A PR   + WH L  +E  D
Sbjct:  124 FGKLEYSLDYNFTDNQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPDK--KKKFETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDV---IGEIKIAMNSIDLGQPIHEWKDL-VGGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKVVLQHNGKRLKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKIQVLITVYDYDKLGSNDAIGKCWIGYGASGVGLR-HWSDMLANPRRPVAQWHTLQPEEEVD 396          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 114.775 bits (286), Expect = 1.572e-27
Identity = 88/287 (30.66%), Postives = 144/287 (50.17%), Query Frame = 3
Query:  564 GEYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            G  +  KLG + F++DY F    L+V ++Q   L +   +   D YVK+ + P+    K  +TK+  +T NPTF++ F F++  SEL    +++ V+D D     D+ +G +R     M   +F  +  E ++      E  E  G+IC+ LR+ P    L V VLE K L       +   YV +      + L+ K TT K +T +PY++E+F + +   +   V ++  V     IG    +GK+ +G +S + + Q HW DM+A PR   + WHAL  +E  D
Sbjct:  131 GPKEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPD--KKKKFETKVHRKTLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDA-IGDVRVQ---MNKVDFSQVTEEWRVLQKAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHS-SGTEQRHWADMLANPRRPIAQWHALKPEEDVD 410          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 114.775 bits (286), Expect = 1.696e-27
Identity = 88/287 (30.66%), Postives = 144/287 (50.17%), Query Frame = 3
Query:  564 GEYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            G  +  KLG + F++DY F    L+V ++Q   L +   +   D YVK+ + P+    K  +TK+  +T NPTF++ F F++  SEL    +++ V+D D     D+ +G +R     M   +F  +  E ++      E  E  G+IC+ LR+ P    L V VLE K L       +   YV +      + L+ K TT K +T +PY++E+F + +   +   V ++  V     IG    +GK+ +G +S + + Q HW DM+A PR   + WHAL  +E  D
Sbjct:  134 GPKEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDPYVKLYLLPD--KKKKFETKVHRKTLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDA-IGDVRVQ---MNKVDFSQVTEEWRVLQKAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHS-SGTEQRHWADMLANPRRPIAQWHALKPEEDVD 413          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Cavefish
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:103044539])

HSP 1 Score: 111.694 bits (278), Expect = 1.823e-26
Identity = 87/285 (30.53%), Postives = 147/285 (51.58%), Query Frame = 3
Query:  582 KLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM--TH--EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            KLG + +++DY F +N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NPTF+++F F++  +EL    +++ V+D D     D+ +G ++ P++ +  +H  EE+++L   +K       E  E  G+IC  LR+ P    L V +LE K L       +   Y  +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS + +   HW DM+A PR   + WH L  +E  D
Sbjct:  135 KLGKLQYSLDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPDK--KKKFETKVHRKTLNPTFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDA-IGDVKVPMNKVDFSHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYAKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNS-SGTELRHWSDMLANPRRPIAQWHVLKPEEEVD 408          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006908.1 (pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1 gene:ENSPMAG00000006246.1 transcript:ENSPMAT00000006908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.267e-10
Identity = 38/135 (28.15%), Postives = 61/135 (45.19%), Query Frame = 3
Query:  996 GEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            G+IC  LR+ P    L + +LE   L     +     YV ++       L+ K TT K    +PYF+E F + +       + L+F V    ++     +GK+ +G  +   +   HW DM+A PR   + WH L
Sbjct:   11 GDICFSLRYIPSTGKLTIVILEATNLKVMDVSGASDPYVKIQVMEGGIRLKKKKTTVKKKALNPYFNEAFSFDIPFENIEKIQLVFSVMDYDSLSRNDAIGKVYVGCGAAG-AGHRHWSDMLANPRRPITQWHTL 144          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006493.1 (pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1 gene:ENSPMAG00000005868.1 transcript:ENSPMAT00000006493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 7.528e-10
Identity = 37/122 (30.33%), Postives = 58/122 (47.54%), Query Frame = 3
Query:  588 GDISFAIDYLFGKNILVVNVMQVFGLT--SPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPC 947
            GDI+F++ Y +   +L + + Q   L          D YVKV + P+      RKTKI+  T NP F++  ++ I  ++LE   V L V+ HD +   +S LG    P+     E   +  C
Sbjct:    3 GDINFSVSYDYRVGVLSLTLRQCRNLAYGEERTKRCDPYVKVYLLPDKSRQGKRKTKIKKNTINPVFNETLKYAISHTQLEVRCVHLSVWHHD-SFRHNSFLGQASLPLDCCDLERGDDRWC 123          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003267.1 (pep scaffold:Pmarinus_7.0:GL476427:260045:262512:1 gene:ENSPMAG00000002986.1 transcript:ENSPMAT00000003267.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 8.553e-10
Identity = 69/282 (24.47%), Postives = 127/282 (45.04%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTSPSNVEIDSYV-KVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPIS--LMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLE---IKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDE 1412
            LG I+F + Y    NIL V ++Q+  L +    +  S++  V + P+   +   ++++ H T NP F + F F +   EL    V++++FD D   +  +++G +  P+   L+  +  Q+   + K       + H   GE+ I L + P    L +TVL+   I  +   S+   + + VSVE     + ++TK    K       F+E+  +     +     LLF+V Q  +   K  +G++  G +S         + M   P  A++ W+ LS  E
Sbjct:    1 LGSINFCLLYEEELNILTVQIIQMRDLPAKEFGKPASFICTVSLLPD---VSSLQSQVHHNTPNPIFMESFLFSVPLLELHRRTVLIKLFDVD-RFSKKNIVGKIEQPLRDLLLDMKAPQHFLKKTKGKQKSQPDEH---GELSISLGYLPNAEKLTITVLQARNINAIQNGSQGLFVKLTVSVE---NEKYIKTKKIMQKQRDGSIEFNESVAFSYSSEQLAKTNLLFQVIQTSSGKKKVEVGRILFGKDSSEKILARWKVIMSGQP--ARAVWYKLSAPE 270          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Sea Lamprey
Match: syt4 (synaptotagmin IV [Source:ZFIN;Acc:ZDB-GENE-030131-7297])

HSP 1 Score: 58.151 bits (139), Expect = 1.719e-9
Identity = 64/281 (22.78%), Postives = 123/281 (43.77%), Query Frame = 3
Query:  582 KLGDISFAIDYLFGKNILVVNVMQVFGLTSPSNVEI---DSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKS-ELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFK-SKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAK---SCWHAL 1400
            +LG +SF++ +   K  L+V+V +  GL     +     D  VK+ I PE       +T++   T +P F + F F  L + ++E + +   V       + + ++G +  P++ +         C   +P     +   G GE+ + L     +  L V +L+ + LH + + + +    V V  +  +E +  + T  +  +    F+E+FE  L    A  + LL  V      G    LG++ +G+ + +  A+ HW ++ A    A    + WHAL
Sbjct:  134 ELGTLSFSLQHDERKEALLVHVKEARGLPPADELAATTTDPCVKLLILPERRFRG--QTRVLRGTRDPVFDETFAFYGLSAVQMEGSEITFAVLSFGRL-SREEVIGEVTVPLAGIAAGPEVVAFCRHIVPRG--MQKPAGVGELLVSLSFTQADSRLTVVILKARGLHKRDTGSSLGAACVKVSAFAGSERVLKRKTRVRRASSGALFNESFEVALG-GGATSLELLVVVDSADGAGPSP-LGRVVLGAGAASPRARQHWQEVRAGGDAAGRPLARWHAL 407          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Sea Lamprey
Match: syt4 (synaptotagmin IV [Source:ZFIN;Acc:ZDB-GENE-030131-7297])

HSP 1 Score: 56.6102 bits (135), Expect = 5.824e-9
Identity = 63/281 (22.42%), Postives = 123/281 (43.77%), Query Frame = 3
Query:  582 KLGDISFAIDYLFGKNILVVNVMQVFGLTSPSNVEI---DSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKS-ELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFK-SKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAK---SCWHAL 1400
            +LG +SF++ +   K  L+V+V +  GL     +     D  VK+ I PE       +T++   T +P F + F F  L + ++E + +   V       + + ++G +  P++ +         C   +P     +   G GE+ + L     +  L V +L+ + LH + + + +    V V  +  +E +  + T  +  +    F+E+FE  L    A  + LL  V         + LG++ +G+ + +  A+ HW ++ A    A    + WHAL
Sbjct:  120 ELGTLSFSLQHDERKEALLVHVKEARGLPPADELAATTTDPCVKLLILPERRFRG--QTRVLRGTRDPVFDETFAFYGLSAVQMEGSEITFAVLSFGRL-SREEVIGEVTVPLAGIAAGPEVVAFCRHIVPRG--MQKPAGVGELLVSLSFTQADSRLTVVILKARGLHKRDTGSSLGAACVKVSAFAGSERVLKRKTRVRRASSGALFNESFEVALG-GGATSLELLVVVHAGAG---DEELGRVVLGAGAASPRARQHWQEVRAGGDAAGRPLARWHAL 391          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 105.916 bits (263), Expect = 3.627e-25
Identity = 84/281 (29.89%), Postives = 140/281 (49.82%), Query Frame = 3
Query:  582 KLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFR-ILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGN------GEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            K+G I+F +DY F  N L V +++   + +   +   D YVK+ + P+    K  +TK+  +T NP F+++F F+ I  SE+ N ++++E+FD D     D ++G  R P  L+  +   N+   +   L PP+ S          G+IC  LR+ P    L++T++E K L     T     YV +    +   ++ K TT K  T +PY++ETF + +   K     L+  V     +G  + +GK  +G  S     + HW DM+A PR + + WH L
Sbjct:   83 KIGRINFTLDYSFTDNTLTVGIIRAEDIPAKDFSGSSDPYVKIMLLPD--KKKKYETKVHRKTLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHD-LIGEARLP--LIDVDLASNI--NEWRVLTPPSGSGGAGHSKSDLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFTVAFEKIEQTSLIISVLDYDRVGKSEMIGKCVVGELSSGADLR-HWADMLASPRRSVAQWHTL 355          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Nematostella
Match: EDO31747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX18])

HSP 1 Score: 98.2117 bits (243), Expect = 1.345e-22
Identity = 77/291 (26.46%), Postives = 141/291 (48.45%), Query Frame = 3
Query:  573 KPSKLGDISFAIDYLFGKNILVVNVM---QVFGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFD------HDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLH-----FKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKK-CLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            +PSK G + F + Y    N L++ V+   ++ G     N  +DSYV+++++P+  N+   KT I  +T  P +++ FQF I   +L +A++ L V +      H + G  D  LG +    + M   E + L   K         S  G G++ + L + P    L V +++ + L+     + S+ + +  +V V   F  + ++ K T+T+   ++P ++E+  + + P     V LL  V  KP+   +   +G++ IGS S +  A +HW  M+  PR   + WH L
Sbjct:   78 QPSKKGTLKFTLIYQTEFNNLIIQVINGHEIVGRDFWDNA-VDSYVQLKLDPDPGNVYKGKTSISRKTTEPYYNETFQFSIEMEKLADAILSLLVMEVDRYSRHHVIGQIDLELGDVVLA-NQMVAMEMEILEAYK---------SRLGLGDLLVSLSYMPTAERLSVVIMKARNLNPPFSEWSSQPRDISPFVKVVLLFDGQKVKKKKTSTRKQEKNPVYNESMLFDIPPHFLHRVILLISVADKPSDSRRSDIIGRVVIGSPS-SGEALSHWNQMLVSPRRPIAAWHKL 356          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Nematostella
Match: EDO47762 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKX9])

HSP 1 Score: 80.4925 bits (197), Expect = 8.102e-17
Identity = 68/283 (24.03%), Postives = 128/283 (45.23%), Query Frame = 3
Query:  570 YKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPSNV--EIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLK--KCLGKLEIGSNSPTLSAQ-NHWMDMVAYPRVAKSCWHALS 1403
            Y  S +G + F I Y      LVV +++   L S S      D +VK+ + P+  ++   +++ + +T  PTF++ F   I + EL+++ +   VFD     +  +++G   +P+  M     Q L  + + P++      +  G+I I L ++P    L + +L    L         P +V + F   N++++TK T    +T +P F++ F Y +         LL  V+     G++  K +G++ +G        +  HW +M+  PR     WH L 
Sbjct:   25 YPESHIGRLWFNIQYSTTGQNLVVTLVKARNLPSRSKTVRTCDPFVKIALLPKDKHVS--QSRCKRKTKRPTFNETFYIPIAEDELDSSTLQFTVFD-GYRMSQQAIIGEAMYPLIDMESTGIQELWRDLEKPIEVSQAKRKLLGDIHISLSYYPTLDRLTIIILRAANLRTIGHKGTDP-FVKIAFSIGNKVMKTKKTAVHQDTVNPMFNDAFNYTVTEDDLGTSSLLVSVWHSGG-GVREDKLIGRVLLGGMMYARGKECEHWTEMMTNPRKMIKYWHPLG 302          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 78.5666 bits (192), Expect = 2.112e-16
Identity = 69/284 (24.30%), Postives = 135/284 (47.54%), Query Frame = 3
Query:  582 KLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRIL-KSELENAVVILEVFDHD-------IAGAADSMLGIMRFPISLMTHEEFQNLPCEK-KLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALS 1403
            +LG I F++ Y    ++L + V++  GL +   +   D +VK+ + P+  +    +T+++ +  NP +++ F F     ++L    + ++V D+D       I      +  I   P++L   ++   LPC+K ++PL          G++ + L + P  + + V V++  +L     T     YV +    K+  L+ K TT K  TRDP ++E+F + +   K   +  +F V     I   + +G++ +G  + T S+  HW +M+  PR   + WH L 
Sbjct:    2 QLGKIFFSLTYYSSDSVLTLKVLKAQGLPAKDFSGTSDPFVKIMLLPDKKH--KLETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEIPLENIDLGPVTLTFTKDL--LPCKKDRVPL----------GDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQNELIGQVILGYRT-TGSSLRHWTEMMNNPRKPVAQWHRLQ 270          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Nematostella
Match: EDO31748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX19])

HSP 1 Score: 71.633 bits (174), Expect = 5.256e-14
Identity = 63/272 (23.16%), Postives = 126/272 (46.32%), Query Frame = 3
Query:  600 FAIDYLFGKNILVVNVMQVFGLTSPSNVEIDSYVKVRIEPESWN-IKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEE----FQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
              +DY    ++L+V V+Q  G+   ++V+  + V V+I  E+   +  RK +IQ  T  P ++++  F +    + +  V + +++ D + +   ++G ++ P++  + EE    + +L  E K+  D         GE+ + L +FP    L + VL+ + L   + + +    V V F+     +  K T  +  T +P ++E F + +     P +     V  K + G  + LG + +G N    S  +HW  M+A  R   + WH +
Sbjct:    5 LQLDYSTEDDVLIVGVVQGKGVICKTSVQT-AQVLVQIYDENDRMLDERKIEIQPMTFEPQWNEEVLFALSGRPVTSLNVQVRLYELD-SFSNQHVIGCIKLPLAEQSFEESRADWYDLEDEHKIECDYV-------GEVLLSLNYFPTTQRLTIVVLKARNLKIDNVSGLWGPLVKVFFHVNKRRVGRKRTAMQKKTFNPVYNEAFAFKVSQEAMPKITFRILVVSKTSHGQDEVLGHVTLGQNVIG-SGFSHWSHMLATLRKPVAMWHPI 266          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Medaka
Match: syt5a (synaptotagmin-1 [Source:NCBI gene;Acc:101166053])

HSP 1 Score: 122.479 bits (306), Expect = 2.441e-30
Identity = 87/284 (30.63%), Postives = 142/284 (50.00%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + +++DY F  N L+V ++Q   L +       D YVKV + P+    K  +TK+Q +   P F++ F F+I  SEL    ++L+VFD D  G  D ++G ++ P++ +       E+++L   +K       E  E  G+ICI LR+ P    L V ++E K L       +   +V V      + L+ K T+ K NT +PYF+E+F + +   +   V +L  V+    +G    +GK  IG  +  +  + HW DM+A PR   + WH L  +E  D
Sbjct:  116 LGKLEYSLDYNFTDNQLIVGILQAQDLPAMDMGGTSDPYVKVYMLPDK--KKKFETKVQRKNLCPVFNETFTFKIPYSELGGQTLVLQVFDFDRFGKHD-VIGEIKIPMNSIDLGQPIHEWKDLVGGEK-------EEQEKLGDICISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPFVKVVLQHNGKRLKKKKTSVKQNTLNPYFNESFSFEIPFSQIQKVQVLITVYDYDKLGSNDPIGKCWIGYGASGVGLR-HWSDMLANPRRPVAQWHTLLPEEEVD 388          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 112.079 bits (279), Expect = 1.487e-26
Identity = 88/281 (31.32%), Postives = 139/281 (49.47%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPP-TESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + ++IDY F +N L V ++Q   L S  S    D YVKV + P+    K   TK+  +T NP F++ F F+I   E+    +++ V+D D     D ++G ++ P++ +   +    P E+   LD    E  E  G+ICI LR+ P    L + +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   +  +  V     IG    +GK+ +GS S T +   HW DM+A PR   + WH L  +E  D
Sbjct:  150 LGKLQYSIDYDFQENKLTVGILQAADLLSMDSGGTSDPYVKVFVLPDK--KKKFDTKVHKKTLNPVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSKHD-VIGEIKIPMNTLDLAK----PIEEWRDLDSADQEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKS-TGAGLKHWSDMLANPRRPIAQWHPLQPEEEVD 422          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 112.079 bits (279), Expect = 1.487e-26
Identity = 88/281 (31.32%), Postives = 139/281 (49.47%), Query Frame = 3
Query:  585 LGDISFAIDYLFGKNILVVNVMQVFGLTS-PSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPP-TESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            LG + ++IDY F +N L V ++Q   L S  S    D YVKV + P+    K   TK+  +T NP F++ F F+I   E+    +++ V+D D     D ++G ++ P++ +   +    P E+   LD    E  E  G+ICI LR+ P    L + +LE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   +  +  V     IG    +GK+ +GS S T +   HW DM+A PR   + WH L  +E  D
Sbjct:  150 LGKLQYSIDYDFQENKLTVGILQAADLLSMDSGGTSDPYVKVFVLPDK--KKKFDTKVHKKTLNPVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSKHD-VIGEIKIPMNTLDLAK----PIEEWRDLDSADQEEPEKLGDICISLRYVPTAGKLTICILEAKNLKKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKS-TGAGLKHWSDMLANPRRPIAQWHPLQPEEEVD 422          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 109.768 bits (273), Expect = 1.008e-25
Identity = 88/285 (30.88%), Postives = 145/285 (50.88%), Query Frame = 3
Query:  582 KLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM--TH--EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            KLG + +++DY F +N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++   EL    +++ V+D D     D+ +G ++ P++ +  +H  EE+++L   +K       E  E  G+IC  LR+ P    L V VLE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS     + HW DM+A PR   + WH L  +E  D
Sbjct:  142 KLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDA-IGDIKVPMNKVDFSHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELR-HWSDMLANPRRPIAQWHVLKPEEEVD 415          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Medaka
Match: syt1a (synaptotagmin 1 [Source:NCBI gene;Acc:101166921])

HSP 1 Score: 109.768 bits (273), Expect = 1.008e-25
Identity = 88/285 (30.88%), Postives = 145/285 (50.88%), Query Frame = 3
Query:  582 KLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLM--TH--EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            KLG + +++DY F +N L+V ++Q   L +       D YVKV + P+    K  +TK+  +T NP F+++F F++   EL    +++ V+D D     D+ +G ++ P++ +  +H  EE+++L   +K       E  E  G+IC  LR+ P    L V VLE K L       +   YV +      + L+ K TT K NT +PY++E+F + +   +   V ++  V     IG    +GK+ +G NS     + HW DM+A PR   + WH L  +E  D
Sbjct:  142 KLGKLQYSLDYNFTENTLMVGIIQAAELPAMDMGGTSDPYVKVYLLPDK--KKKFETKVHRKTLNPVFNEQFTFKVPYVELGGKTLVMTVYDFDRFSKHDA-IGDIKVPMNKVDFSHVTEEWRDLQSAEK-------EEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVITVLDYDKIGKNDAIGKVFVGLNSSGTELR-HWSDMLANPRRPIAQWHVLKPEEEVD 415          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Planmine SMEST
Match: SMESG000041533.1 (SMESG000041533.1)

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 3
Query:  339 MKFSSNFTLPKTNSTVLYHLLNVTKSNXXXXXXXXXXXXXXXXXXXKRIHTIRNSKTALKKRFTKITDMHFEDDVGEYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
            MKFSSNFTLPKTNSTVLYHLLNVTKSNGFIAGICLFILFLLGICLLKRIHTIRNSKTALKKRFTKITDMHFEDDVGEYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD
Sbjct:    1 MKFSSNFTLPKTNSTVLYHLLNVTKSNGFIAGICLFILFLLGICLLKRIHTIRNSKTALKKRFTKITDMHFEDDVGEYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 361          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Planmine SMEST
Match: SMESG000011583.1 (SMESG000011583.1)

HSP 1 Score: 125.561 bits (314), Expect = 1.135e-31
Identity = 97/319 (30.41%), Postives = 156/319 (48.90%), Query Frame = 3
Query:  486 HTIRNSKTALKKRFTKITDMHFEDDVGEYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTT-TKYNTRD------PYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHALSKDESKD 1421
             T    K   +K  TK  D  F D++        G I FA+ YL  K +L+V V++V  L +P +  +D YV V+++ +S   + +KTKI+++  +P F++KF F+IL  EL ++ +  +VFD+D  G ADS+LG +      +      N+  E    L    ++ EG G++CI+L       LL VT+LE K L  K       I+V+V+   K+     K+ T +K  T+D      PYF+ETF +           +  K++      +  C+G + +GS     S   HW  M+  PR   + WH L+    K+
Sbjct:   68 QTADKDKYKRRKLETKEIDKIFRDELNLGFNESFGKIYFALKYLLVKELLIVKVIKVENLPTPIDDCLDPYVVVQVKSKSLT-EEKKTKIKYKHIDPVFNEKFTFKILHPELNDSEIFFKVFDYDKFG-ADSLLGQLALNFKDLNPSSIINMLSEFSKDLKEGEDTSEGMGQVCIILNSNGQAGLL-VTILEAKNLRVKENMSYSHIFVTVK--IKSRKHGNKFKTHSKKRTKDAHCGPFPYFNETFLFPKPHGTISDCLVSVKIWISRMFKMPICIGYVSLGSEMNMTSGAIHWQSMLDSPRHPVAKWHVLTNPNVKE 381          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 103.99 bits (258), Expect = 4.991e-24
Identity = 86/294 (29.25%), Postives = 142/294 (48.30%), Query Frame = 3
Query:  540 DMHFEDDVG--EYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            D + ED+ G  + +   LG + +++DY F K  L V V+Q   L +   +   D YVKV + P+    K  +TK+  +  NP F++ F F+I  SE+ +  ++  VFD D     D  +G ++ P+  +      EE++ L      P D   E     G+IC  LR+ P    L + +LE K L       +   YV +      + ++ K TT K  T +PY++E+F + +   +   V L+  V     IG  + +G++ +G N+ T +   HW DM+A PR   + WH L
Sbjct:  113 DANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKK--KKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQ-IGQIQIPLGSVDLCKVIEEWKELG-----PPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNA-TGAELRHWSDMLANPRRPIAQWHTL 397          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 103.99 bits (258), Expect = 5.313e-24
Identity = 86/294 (29.25%), Postives = 142/294 (48.30%), Query Frame = 3
Query:  540 DMHFEDDVG--EYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            D + ED+ G  + +   LG + +++DY F K  L V V+Q   L +   +   D YVKV + P+    K  +TK+  +  NP F++ F F+I  SE+ +  ++  VFD D     D  +G ++ P+  +      EE++ L      P D   E     G+IC  LR+ P    L + +LE K L       +   YV +      + ++ K TT K  T +PY++E+F + +   +   V L+  V     IG  + +G++ +G N+ T +   HW DM+A PR   + WH L
Sbjct:  117 DANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKK--KKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQ-IGQIQIPLGSVDLCKVIEEWKELG-----PPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNA-TGAELRHWSDMLANPRRPIAQWHTL 401          
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Planmine SMEST
Match: SMESG000055143.1 (SMESG000055143.1)

HSP 1 Score: 103.99 bits (258), Expect = 6.017e-24
Identity = 86/294 (29.25%), Postives = 142/294 (48.30%), Query Frame = 3
Query:  540 DMHFEDDVG--EYKPSKLGDISFAIDYLFGKNILVVNVMQVFGLTSPS-NVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTH----EEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSCWHAL 1400
            D + ED+ G  + +   LG + +++DY F K  L V V+Q   L +   +   D YVKV + P+    K  +TK+  +  NP F++ F F+I  SE+ +  ++  VFD D     D  +G ++ P+  +      EE++ L      P D   E     G+IC  LR+ P    L + +LE K L       +   YV +      + ++ K TT K  T +PY++E+F + +   +   V L+  V     IG  + +G++ +G N+ T +   HW DM+A PR   + WH L
Sbjct:  129 DANMEDNEGAQDKEAVNLGKLQYSLDYDFTKGELTVGVVQATDLPAMDMSGTSDPYVKVFLLPDKK--KKFETKVHRKILNPVFNETFVFKIPYSEVGSKTLVFNVFDFDRFSKHDQ-IGQIQIPLGSVDLCKVIEEWKELG-----PPDSDNEKENRLGDICFSLRYVPTSGKLNIVILEAKNLKKMDVGGLSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEPIGRVVLGCNA-TGAELRHWSDMLANPRRPIAQWHTL 413          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT22.463e-2630.28synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510... [more]
SYT22.463e-2630.28synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510... [more]
SYT13.383e-2530.63synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT13.920e-2530.63synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT13.920e-2530.63synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-32.401e-2530.47SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-32.401e-2530.47SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-22.953e-2227.34Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-13.982e-2029.33Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-11.736e-1928.11Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt18.510e-2127.91gene:FBgn0004242 transcript:FBtr0343993[more]
Syt11.453e-2028.15gene:FBgn0004242 transcript:FBtr0332218[more]
Syt12.584e-2027.96gene:FBgn0004242 transcript:FBtr0077728[more]
Syt12.584e-2027.96gene:FBgn0004242 transcript:FBtr0345331[more]
Syt12.584e-2027.96gene:FBgn0004242 transcript:FBtr0077727[more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt5a6.224e-2829.18synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt1a3.373e-2630.99synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt1a3.373e-2630.99synaptotagmin Ia [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt2a1.382e-2530.60synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt2a1.382e-2530.60synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT52.586e-2831.86synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
SYT52.971e-2831.86synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
e2f41.024e-2530.36E2F transcription factor 4 [Source:Xenbase;Acc:XB-... [more]
luzp24.001e-2329.39leucine zipper protein 2 [Source:Xenbase;Acc:XB-GE... [more]
syt81.387e-2227.02synaptotagmin 8 [Source:NCBI gene;Acc:100037878][more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt21.252e-2630.28synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt21.252e-2630.28synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt12.138e-2530.63synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt12.138e-2530.63synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt35.655e-2227.80synaptotagmin III [Source:MGI Symbol;Acc:MGI:99665... [more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R4J5|SYT1_PONAB1.427e-2930.63Synaptotagmin-1 OS=Pongo abelii OX=9601 GN=SYT1 PE... [more]
sp|P46097|SYT2_MOUSE7.159e-2630.28Synaptotagmin-2 OS=Mus musculus OX=10090 GN=Syt2 P... [more]
sp|P29101|SYT2_RAT8.590e-2630.28Synaptotagmin-2 OS=Rattus norvegicus OX=10116 GN=S... [more]
sp|Q8N9I0|SYT2_HUMAN1.183e-2530.28Synaptotagmin-2 OS=Homo sapiens OX=9606 GN=SYT2 PE... [more]
sp|A0A075F932|SYT1_ANSCY2.813e-2531.12Synaptotagmin-1 OS=Anser cygnoid OX=8845 GN=SYT1 P... [more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A085MJA43.765e-3132.28Uncharacterized protein OS=Trichuris suis OX=68888... [more]
A0A077YUP47.013e-3031.80Synaptotagmin 1 OS=Trichuris trichiura OX=36087 GN... [more]
A0A183BQK02.465e-2932.62Uncharacterized protein OS=Globodera pallida OX=36... [more]
A0A0V1PA134.336e-2932.14Synaptotagmin-1 OS=Trichinella sp. T8 OX=92180 GN=... [more]
A0A0V0VP694.336e-2932.14Synaptotagmin-1 OS=Trichinella sp. T9 OX=181606 GN... [more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt5a6.711e-2930.00synaptotagmin-2-like [Source:NCBI gene;Acc:1030278... [more]
syt5a8.224e-2930.00synaptotagmin-2-like [Source:NCBI gene;Acc:1030278... [more]
syt1b1.572e-2730.66synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt1b1.696e-2730.66synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt1a1.823e-2630.53synaptotagmin 1 [Source:NCBI gene;Acc:103044539][more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006908.11.267e-1028.15pep scaffold:Pmarinus_7.0:GL476344:649897:653668:1... [more]
ENSPMAT00000006493.17.528e-1030.33pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1... [more]
ENSPMAT00000003267.18.553e-1024.47pep scaffold:Pmarinus_7.0:GL476427:260045:262512:1... [more]
syt41.719e-922.78synaptotagmin IV [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
syt45.824e-922.42synaptotagmin IV [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO317463.627e-2529.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317471.345e-2226.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477628.102e-1724.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437042.112e-1624.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317485.256e-1423.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt5a2.441e-3030.63synaptotagmin-1 [Source:NCBI gene;Acc:101166053][more]
syt2a1.487e-2631.32synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
syt2a1.487e-2631.32synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
syt1a1.008e-2530.88synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
syt1a1.008e-2530.88synaptotagmin 1 [Source:NCBI gene;Acc:101166921][more]
back to top
BLAST of Synaptotagmin-1 Synaptotagmin I vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041533.10.000e+0100.00SMESG000041533.1[more]
SMESG000011583.11.135e-3130.41SMESG000011583.1[more]
SMESG000055143.14.991e-2429.25SMESG000055143.1[more]
SMESG000055143.15.313e-2429.25SMESG000055143.1[more]
SMESG000055143.16.017e-2429.25SMESG000055143.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008541 ID=SMED30008541|Name=Synaptotagmin-1 Synaptotagmin I|organism=Schmidtea mediterranea sexual|type=transcript|length=1433bp
TTATTTTATTTATATGATAGTCATACTAACACTAAATAAATTTACGATCA
CGAAATGATGCAGATAAATTTTACCACGTAAATTTAATGAAAACCAGCAA
ATCAAAATGAAAAAATGTTAGTCAAGTAATATTTAATTTTTGTATTAATT
ATTCTTATTTTAAAAAAATTATTTTTAAACTTATAAATTTTTCGGTCAAA
TATATCCAAATATAATGCTGTAGAAGAAAAGTGCAATTTCACAATAAAAA
TCGAATTTCAATCGATAAAATTTTGGTGTTCATTCAACCGAAACCTCGCT
TGAAAATAGAAATAATTTATTTTAGTTTGTCAATAAAAATGAAATTCTCA
TCAAATTTCACATTACCAAAGACAAATTCTACAGTACTTTACCATTTATT
GAACGTAACAAAAAGTAATGGATTTATCGCTGGAATATGCCTCTTTATTC
TATTCCTTCTCGGCATTTGCCTATTGAAAAGAATTCACACGATTCGAAAT
TCGAAAACTGCTTTGAAAAAACGATTCACAAAGATCACTGATATGCATTT
TGAAGACGACGTTGGAGAGTATAAACCTTCAAAATTAGGGGACATAAGTT
TTGCAATCGACTATTTATTTGGGAAAAACATTTTAGTTGTTAACGTAATG
CAGGTTTTTGGTTTGACTTCACCATCGAACGTTGAAATAGATTCATATGT
CAAAGTTCGCATCGAACCTGAATCATGGAATATTAAACCGCGTAAAACAA
AGATACAACACCAAACAAACAATCCAACTTTTTCCAAGAAGTTTCAATTT
AGAATTCTCAAATCTGAACTCGAAAATGCAGTTGTCATTCTTGAGGTTTT
TGATCATGATATTGCTGGGGCCGCTGACAGCATGCTGGGAATAATGCGGT
TTCCAATTTCTTTAATGACACATGAAGAATTTCAAAATTTACCTTGTGAG
AAAAAACTGCCACTTGATCCTCCGACTGAGAGCCATGAAGGCAATGGAGA
AATTTGTATTGTTCTAAGACATTTCCCAATTGAACATTTATTAAAAGTAA
CCGTGTTAGAAATAAAGCGACTTCATTTCAAATCAAAAACTAAAATCCTC
CCGATTTACGTCTCCGTAGAATTTTACTTTAAAAACGAATTATTAGAAAC
AAAATACACAACTACAAAATACAATACTAGAGATCCTTATTTTTCTGAAA
CATTCGAATATCATTTAAAACCAGTCAAAGCTCCATATGTTTATCTTTTA
TTTAAGGTTTTCCAAAAACCAACAATAGGTCTGAAAAAGTGTCTTGGAAA
GCTTGAAATAGGAAGTAACAGTCCAACATTATCAGCTCAGAACCATTGGA
TGGACATGGTTGCCTATCCAAGAGTAGCTAAATCATGTTGGCACGCTTTA
TCAAAAGATGAATCTAAAGATTAATAAATAAAC
back to top

protein sequence of SMED30008541-orf-1

>SMED30008541-orf-1 ID=SMED30008541-orf-1|Name=SMED30008541-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=362bp
MKFSSNFTLPKTNSTVLYHLLNVTKSNGFIAGICLFILFLLGICLLKRIH
TIRNSKTALKKRFTKITDMHFEDDVGEYKPSKLGDISFAIDYLFGKNILV
VNVMQVFGLTSPSNVEIDSYVKVRIEPESWNIKPRKTKIQHQTNNPTFSK
KFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQN
LPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSK
TKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPY
VYLLFKVFQKPTIGLKKCLGKLEIGSNSPTLSAQNHWMDMVAYPRVAKSC
WHALSKDESKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005544calcium-dependent phospholipid binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007269neurotransmitter secretion
Vocabulary: cellular component
TermDefinition
GO:0008021synaptic vesicle
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030672synaptic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 234..349
e-value: 1.1E-6
score: 38.2
coord: 98..202
e-value: 1.3E-9
score: 47.9
IPR000008C2 domainPFAMPF00168C2coord: 98..194
e-value: 1.2E-10
score: 41.5
coord: 234..339
e-value: 1.7E-7
score: 31.4
IPR000008C2 domainPROSITEPS50004C2coord: 99..187
score: 12.336
IPR000008C2 domainPROSITEPS50004C2coord: 235..323
score: 9.154
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 76..207
e-value: 8.6E-22
score: 79.3
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 210..356
e-value: 2.5E-22
score: 81.0
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 30..356
NoneNo IPR availablePANTHERPTHR10024:SF227SYNAPTOTAGMIN 1coord: 30..356
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 79..192
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 220..354
NoneNo IPR availableTMHMMTMhelixcoord: 28..46