cGMP-dependent protein kinase

Overview
NamecGMP-dependent protein kinase
Smed IDSMED30008534
Length (bp)2231
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cGMP-dependent protein kinase (SMED30008534) t-SNE clustered cells

Violin plots show distribution of expression levels for cGMP-dependent protein kinase (SMED30008534) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cGMP-dependent protein kinase (SMED30008534) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cGMP-dependent protein kinase (SMED30008534) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008534

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30008534h1SMcG0004310 dd_Smed_v4_5704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30008534h1SMcG0004310 dd_Smed_v4_5704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008534h1SMcG0004310 dd_Smed_v4_5704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008534h1SMcG0004310 dd_Smed_v4_5704_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008534h1SMcG0004310 dd_Smed_v4_5704_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 321/709 (45.28%), Postives = 446/709 (62.91%), Query Frame = 2
Query:  143 VKQLKNESKIKDEKIKELQSVI-----DKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTK--------MAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKK--------INYGDDERFQ-------DFQKALP----PVEPRVSDF-KPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            + +L  E + K  ++ +LQ V+       L+A  D+  PL  +R+    V  +S      +R  K GVSAE  T T           E     KD + K LI +AL KN  L+ L+ +QI ++VECMY +     S +I++G   N+++V+  G+ +VF+ +  +S I   T FGELA+LYNC RTA+VKA  +   W +DR +F+ IMR+T   R  + + FLR+V +L +L E  LTK+ D LEV+ Y K + I+++GE  + FFI+  G   VTQ     DQ + I+TL  G++FGEKAL+S  +R+A++ A E++   L + R  F + VG    ++K        +N  D++R            KAL      ++ +V+ F   +PF +++ I TLGVGGFGRV LVK+K  E+ +FA+KC++K+HIV  KQQ HV SEK IL EL S FI +L++TFKD KYVY+L+E CLGGELWS+LRDR  FD+ T++FC++CV EAF+YLH   IIYRDLKPENL++  E GYLKL DFGFAK++ +G+KTWTFCGTPEYVAPE+ILNK HD S D WSLGIL YELL G PPFS  D M  Y++ILKG+E +D    +K++ +    I +LC ++P ERLGN +NG  DIK H++  G++WE L+   + SP   ++K   D S FD YP E    PDE SGWD DF
Sbjct:   65 IAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKV-PLEVHRKTSGLVSLHS------RRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKN-ENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAE-GYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFP--RKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 321/709 (45.28%), Postives = 446/709 (62.91%), Query Frame = 2
Query:  143 VKQLKNESKIKDEKIKELQSVI-----DKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTK--------MAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKK--------INYGDDERFQ-------DFQKALP----PVEPRVSDF-KPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            + +L  E + K  ++ +LQ V+       L+A  D+  PL  +R+    V  +S      +R  K GVSAE  T T           E     KD + K LI +AL KN  L+ L+ +QI ++VECMY +     S +I++G   N+++V+  G+ +VF+ +  +S I   T FGELA+LYNC RTA+VKA  +   W +DR +F+ IMR+T   R  + + FLR+V +L +L E  LTK+ D LEV+ Y K + I+++GE  + FFI+  G   VTQ     DQ + I+TL  G++FGEKAL+S  +R+A++ A E++   L + R  F + VG    ++K        +N  D++R            KAL      ++ +V+ F   +PF +++ I TLGVGGFGRV LVK+K  E+ +FA+KC++K+HIV  KQQ HV SEK IL EL S FI +L++TFKD KYVY+L+E CLGGELWS+LRDR  FD+ T++FC++CV EAF+YLH   IIYRDLKPENL++  E GYLKL DFGFAK++ +G+KTWTFCGTPEYVAPE+ILNK HD S D WSLGIL YELL G PPFS  D M  Y++ILKG+E +D    +K++ +    I +LC ++P ERLGN +NG  DIK H++  G++WE L+   + SP   ++K   D S FD YP E    PDE SGWD DF
Sbjct:   65 IAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKV-PLEVHRKTSGLVSLHS------RRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKN-ENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAE-GYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFP--RKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 326/696 (46.84%), Postives = 438/696 (62.93%), Query Frame = 2
Query:  122 INQLIEEVKQ-------LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVH-----HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDN-APDENSGWDADF 2170
            + + IEE++Q       L+ E   KDE I++LQ+ +DK R+V+ +       +Q   T+ G         R+K+  +SAE  T+  + +  H     + K   +K+LIK A+L N  +++LE  QI EIV+CMY  +   +S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATVK  V+  +W IDR  F+TIM +T   +H E   FL++VP    L E  L+KLAD+LE   Y   E I++QG   + FFII  G+  VT++    +    +RTL  GD+FGEKAL    +RTA+V AAE  T  L + R  F  L+G L  +    Y D E    ++          + F     SD   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+    S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  F+D TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE LRK  +  P  P +    D SNFD++PE+ D   PD+NSGWD DF
Sbjct:   11 LQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVI-RPATQQAQKQSASTLQGEP-------RTKRQAISAEP-TAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE-------AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 686          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 306/696 (43.97%), Postives = 429/696 (61.64%), Query Frame = 2
Query:  143 VKQLKNESKIKDEKIKELQSVI-----DKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTK--------MAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYG-------DDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            + +L  E + K  ++ +LQ V+       L+A  D+  PL  +R+    V  +S      +R  K GVSAE  T T           E     KD + K LI +AL KN  L+ L+ +QI ++VECMY +     S +I++G   N+++V+  G+ +VF+ +  +S I   T FGELA+LYNC RTA+VKA  +   W +DR +F+ IMR+T   R  + + FLR+V +L +L E  LTK+ D LEV+ Y K + I+++GE  + FFI+  G   VTQ     DQ + I+TL  G++FGEKAL+S  +R+A++ A E++   L + R  F + VG    ++K   G       DDE+           +  +S++K +    ++ I+            VK+K  E+ +FA+KC++K+HIV  KQQ HV SEK IL EL S FI +L++TFKD KYVY+L+E CLGGELWS+LRDR  FD+ T++FC++CV EAF+YLH   IIYRDLKPENL++  E GYLKL DFGFAK++ +G+KTWTFCGTPEYVAPE+ILNK HD S D WSLGIL YELL G PPFS  D M  Y++ILKG+E +D    +K++ +    I +LC ++P ERLGN +NG  DIK H++  G++WE L+   + SP   ++K   D S FD YP E    PDE SGWD DF
Sbjct:   65 IAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKV-PLEVHRKTSGLVSLHS------RRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRH--------AKRSMSNWKLSKALSLEMIQ--------LKEKVKVKN-ENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAE-GYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFP--RKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 733          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 319/683 (46.71%), Postives = 429/683 (62.81%), Query Frame = 2
Query:  137 EEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHNKDFT----AKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDN-APDENSGWDADF 2170
            E +K+L+     K+E+I+EL+  + K ++VL    P+ +       +G  +        ++  G+SAE  T     +     + FT    +K+LIK A+L N  +++LE  QI EIV+CMY  +   +S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATVK  V+  +W IDR  F+TIM +T   +H E   FL++VP    L E  L+KLAD+LE   Y   E I++QG   + FFII  G+  VT++    +    +RTL  GD+FGEKAL    +RTA+V AAE  T  L + R  F  L+G L  +    Y D E    ++          + F     SD   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+    S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  F+D TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE LRK  +  P  P +    D SNFD++PE+ D   PD+NSGWD DF
Sbjct:   17 ERIKELEKRLSEKEEEIQELKRKLHKCQSVL----PVPSTH-----IGPRT--------TRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE-------AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 312/691 (45.15%), Postives = 448/691 (64.83%), Query Frame = 2
Query:  152 LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVG-------GNSLKEKFF------KRSKKHGVSAEAWT-STKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFK----PAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            +K  S+++ E +  LQ   DKLR+VL+Q    + +               GN L++K        +R+KK  VSAE      K A   H+NK   AK +I++A+ KN  L+ L ++QI E+V CMYE +  A   VI+EG   + L+VV  G+  V RE   + ++   T  GELA+LYNC RTA+V+A  D  +WV+DR +F+ I ++   +RH++L  FL  V I  +L+E  ++K+AD+++   Y     I++QGE  + FF+I SG   VTQ+I    + +EIR L  GDFFGE+ALL   +RTA++ A     E+L L R  F +L+G+L ++KK +YGD ER     +  P     V DF+         +++++ TLGVGGFGRV LV + G + ++FALK +KK+HIV  +QQ H+ +E+NI++E S+ +I +L++TF+D K+VY+L+EVCLGGELW+ LRDR  FDD T RF ++CV+E  EYLH +NI+YRDLKPEN L++   GYLKL DFGFAK+L +G+KTWTFCGTPEYV+PEIILNK HD +AD W+LGI   EL+ G PPF ASDPMK Y++ILKG++++++  N+++   A + + +LC  +P ERLG+G  G  DI+ H++F G+DWE LR   +K P  PK+ +  D +NFD YP + D  PDE SGWD  F
Sbjct:   94 IKRISELEGE-VTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLKK-DYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLA-NTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIP-NRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 780          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 312/691 (45.15%), Postives = 448/691 (64.83%), Query Frame = 2
Query:  152 LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVG-------GNSLKEKFF------KRSKKHGVSAEAWT-STKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFK----PAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            +K  S+++ E +  LQ   DKLR+VL+Q    + +               GN L++K        +R+KK  VSAE      K A   H+NK   AK +I++A+ KN  L+ L ++QI E+V CMYE +  A   VI+EG   + L+VV  G+  V RE   + ++   T  GELA+LYNC RTA+V+A  D  +WV+DR +F+ I ++   +RH++L  FL  V I  +L+E  ++K+AD+++   Y     I++QGE  + FF+I SG   VTQ+I    + +EIR L  GDFFGE+ALL   +RTA++ A     E+L L R  F +L+G+L ++KK +YGD ER     +  P     V DF+         +++++ TLGVGGFGRV LV + G + ++FALK +KK+HIV  +QQ H+ +E+NI++E S+ +I +L++TF+D K+VY+L+EVCLGGELW+ LRDR  FDD T RF ++CV+E  EYLH +NI+YRDLKPEN L++   GYLKL DFGFAK+L +G+KTWTFCGTPEYV+PEIILNK HD +AD W+LGI   EL+ G PPF ASDPMK Y++ILKG++++++  N+++   A + + +LC  +P ERLG+G  G  DI+ H++F G+DWE LR   +K P  PK+ +  D +NFD YP + D  PDE SGWD  F
Sbjct:   94 IKRISELEGE-VTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLKK-DYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLA-NTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIP-NRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 780          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 312/691 (45.15%), Postives = 448/691 (64.83%), Query Frame = 2
Query:  152 LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVG-------GNSLKEKFF------KRSKKHGVSAEAWT-STKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFK----PAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            +K  S+++ E +  LQ   DKLR+VL+Q    + +               GN L++K        +R+KK  VSAE      K A   H+NK   AK +I++A+ KN  L+ L ++QI E+V CMYE +  A   VI+EG   + L+VV  G+  V RE   + ++   T  GELA+LYNC RTA+V+A  D  +WV+DR +F+ I ++   +RH++L  FL  V I  +L+E  ++K+AD+++   Y     I++QGE  + FF+I SG   VTQ+I    + +EIR L  GDFFGE+ALL   +RTA++ A     E+L L R  F +L+G+L ++KK +YGD ER     +  P     V DF+         +++++ TLGVGGFGRV LV + G + ++FALK +KK+HIV  +QQ H+ +E+NI++E S+ +I +L++TF+D K+VY+L+EVCLGGELW+ LRDR  FDD T RF ++CV+E  EYLH +NI+YRDLKPEN L++   GYLKL DFGFAK+L +G+KTWTFCGTPEYV+PEIILNK HD +AD W+LGI   EL+ G PPF ASDPMK Y++ILKG++++++  N+++   A + + +LC  +P ERLG+G  G  DI+ H++F G+DWE LR   +K P  PK+ +  D +NFD YP + D  PDE SGWD  F
Sbjct:   57 IKRISELEGE-VTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLKK-DYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLA-NTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIP-NRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 743          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 312/691 (45.15%), Postives = 448/691 (64.83%), Query Frame = 2
Query:  152 LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVG-------GNSLKEKFF------KRSKKHGVSAEAWT-STKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFK----PAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            +K  S+++ E +  LQ   DKLR+VL+Q    + +               GN L++K        +R+KK  VSAE      K A   H+NK   AK +I++A+ KN  L+ L ++QI E+V CMYE +  A   VI+EG   + L+VV  G+  V RE   + ++   T  GELA+LYNC RTA+V+A  D  +WV+DR +F+ I ++   +RH++L  FL  V I  +L+E  ++K+AD+++   Y     I++QGE  + FF+I SG   VTQ+I    + +EIR L  GDFFGE+ALL   +RTA++ A     E+L L R  F +L+G+L ++KK +YGD ER     +  P     V DF+         +++++ TLGVGGFGRV LV + G + ++FALK +KK+HIV  +QQ H+ +E+NI++E S+ +I +L++TF+D K+VY+L+EVCLGGELW+ LRDR  FDD T RF ++CV+E  EYLH +NI+YRDLKPEN L++   GYLKL DFGFAK+L +G+KTWTFCGTPEYV+PEIILNK HD +AD W+LGI   EL+ G PPF ASDPMK Y++ILKG++++++  N+++   A + + +LC  +P ERLG+G  G  DI+ H++F G+DWE LR   +K P  PK+ +  D +NFD YP + D  PDE SGWD  F
Sbjct:   57 IKRISELEGE-VTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLKK-DYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLA-NTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIP-NRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 743          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 319/735 (43.40%), Postives = 460/735 (62.59%), Query Frame = 2
Query:   74 PSIKSDVISNNVNVADINQLIEEVK--------QLKNESKIKDEKIKE----------LQSVIDKLRAVLDQSHPLSNNRQVGFTVG-------GNSLKEKFF------KRSKKHGVSAEAWT-STKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFK----PAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            P I   V +      ++ +LI +++        QL+ +  I +  IK           LQ   DKLR+VL+Q    + +               GN L++K        +R+KK  VSAE      K A   H+NK   AK +I++A+ KN  L+ L ++QI E+V CMYE +  A   VI+EG   + L+VV  G+  V RE   + ++   T  GELA+LYNC RTA+V+A  D  +WV+DR +F+ I ++   +RH++L  FL  V I  +L+E  ++K+AD+++   Y     I++QGE  + FF+I SG   VTQ+I    + +EIR L  GDFFGE+ALL   +RTA++ A     E+L L R  F +L+G+L ++KK +YGD ER     +  P     V DF+         +++++ TLGVGGFGRV LV + G + ++FALK +KK+HIV  +QQ H+ +E+NI++E S+ +I +L++TF+D K+VY+L+EVCLGGELW+ LRDR  FDD T RF ++CV+E  EYLH +NI+YRDLKPEN L++   GYLKL DFGFAK+L +G+KTWTFCGTPEYV+PEIILNK HD +AD W+LGI   EL+ G PPF ASDPMK Y++ILKG++++++  N+++   A + + +LC  +P ERLG+G  G  DI+ H++F G+DWE LR   +K P  PK+ +  D +NFD YP + D  PDE SGWD  F
Sbjct:    6 PRIYVQVGTRTFEAHELQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLKK-DYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLA-NTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIP-NRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 737          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: Pkg21D (gene:FBgn0000442 transcript:FBtr0078042)

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 295/633 (46.60%), Postives = 410/633 (64.77%), Query Frame = 2
Query:  317 KKHGVSAEAWTSTKMAE---PV-HHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSV-VWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKI-PNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALP-----PVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQS----FALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            KK GVSAE+   +       P+  + KDF+ K  IK+A++ N  L++++  Q+ E+V+ MY K I A   VI EG    +LYV  +G+F V ++   + ++    AFGELA+LYNC RTA+++   ++  VWV+DR +F+ IM  T  +R      FLR+VP+LM+L+E  L K+AD+LE++ Y+    I++QG   + FF+I  G+  VTQK+ P   +E E+RTL  GD+FGE+AL++   RTA++ A     E L L R  F  L+G+L  +K+ +YGD+ R    ++A       P E    +F     +D++ + TLG+GGFGRV LVK     HQ     FALKC+KK HIV  KQ+ H+ SE++I+L   S FICRL++TF+D KYVY+L+E C+GGE+W++LRDR  F+D   +F + CV++AFEYLH R IIYRDLKPENL++  E GY+K+ DFGFAK++    KTWTFCGTPEYVAPEIILNK HD + D W+LGIL +ELLNG PPFSA DPM+ Y++ILKG++ I     K +S  A+  I +LC   P ERLG    G QDIK HK+F G+DW+ L    +  PF   I    D   FD +P +++  PDE SGWDADF
Sbjct:  142 KKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNCTRTASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRKLAMKQAQESCRDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVK---AHHQDRVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLD-ERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPDPMQTYNLILKGIDMI--AFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNEPPDELSGWDADF 768          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0446099)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 307/700 (43.86%), Postives = 436/700 (62.29%), Query Frame = 2
Query:  140 EVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFT-----------------VGGNSLKEKFFKRSKKHGVSAEAWT-STKMAEPVH---HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYA-AEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDEN-SGWDADF 2170
            ++++++   + KD +I EL+S +DK ++V   S   +                          G      + F+R +  G+SAE  + S+ + E V    ++KD  ++ LIK A+L N  +++L+  QI EIV+CMY  K  A + +I+EG   + +YV+  G+ +V RE   +S ++     GELA+LYNC+RTAT+ A  +  +W I+R  F+TIM +T   R AE   FL++VPI  DL E  L K++D+LE   Y + + I++QG   + FFII  G   VT K  +  +EK IR L  GDFFGEKAL    LRTA++   +      L + R  F +L+  L  IK  +  DDE   + +K          +F+    +D++ I TLGVGGFGRV LV+  G   +SFALK MKK  IV+ +QQ H++SEK I+ E +  FI +LF+TFKD KY+Y+LME CLGGELW++LRD+  FDD TTRF  +CVVEAF+YLH RNIIYRDLKPENLL++ E GY+KL DFGFAK+L+ G+KTWTFCGTPEYVAPE+ILN+ HD SAD WSLG+L +ELL G PPF+ SDPM+ Y++ILKG+++I+   N  ++  A + I +LC  +P ERLG  R G  +I+ HK+F G+ W  L+   ++ P  P +K   D +NFD YP + +  P ++ +GWD DF
Sbjct:   55 KIQEMQRALQFKDNEIAELKSHLDKFQSVFPFSRGSAAGCAGTGGASGSGAGGSGGSGPGTATGATRKSGQNFQRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIK--HRYDDEGAMERRKI-------NEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLN-ERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRN--ITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 742          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089310)

HSP 1 Score: 535.028 bits (1377), Expect = 1.829e-176
Identity = 307/700 (43.86%), Postives = 436/700 (62.29%), Query Frame = 2
Query:  140 EVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFT-----------------VGGNSLKEKFFKRSKKHGVSAEAWT-STKMAEPVH---HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYA-AEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDEN-SGWDADF 2170
            ++++++   + KD +I EL+S +DK ++V   S   +                          G      + F+R +  G+SAE  + S+ + E V    ++KD  ++ LIK A+L N  +++L+  QI EIV+CMY  K  A + +I+EG   + +YV+  G+ +V RE   +S ++     GELA+LYNC+RTAT+ A  +  +W I+R  F+TIM +T   R AE   FL++VPI  DL E  L K++D+LE   Y + + I++QG   + FFII  G   VT K  +  +EK IR L  GDFFGEKAL    LRTA++   +      L + R  F +L+  L  IK  +  DDE   + +K          +F+    +D++ I TLGVGGFGRV LV+  G   +SFALK MKK  IV+ +QQ H++SEK I+ E +  FI +LF+TFKD KY+Y+LME CLGGELW++LRD+  FDD TTRF  +CVVEAF+YLH RNIIYRDLKPENLL++ E GY+KL DFGFAK+L+ G+KTWTFCGTPEYVAPE+ILN+ HD SAD WSLG+L +ELL G PPF+ SDPM+ Y++ILKG+++I+   N  ++  A + I +LC  +P ERLG  R G  +I+ HK+F G+ W  L+   ++ P  P +K   D +NFD YP + +  P ++ +GWD DF
Sbjct:  401 KIQEMQRALQFKDNEIAELKSHLDKFQSVFPFSRGSAAGCAGTGGASGSGAGGSGGSGPGTATGATRKSGQNFQRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIK--HRYDDEGAMERRKI-------NEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLN-ERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRN--ITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089312)

HSP 1 Score: 535.028 bits (1377), Expect = 1.829e-176
Identity = 307/700 (43.86%), Postives = 436/700 (62.29%), Query Frame = 2
Query:  140 EVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFT-----------------VGGNSLKEKFFKRSKKHGVSAEAWT-STKMAEPVH---HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYA-AEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDEN-SGWDADF 2170
            ++++++   + KD +I EL+S +DK ++V   S   +                          G      + F+R +  G+SAE  + S+ + E V    ++KD  ++ LIK A+L N  +++L+  QI EIV+CMY  K  A + +I+EG   + +YV+  G+ +V RE   +S ++     GELA+LYNC+RTAT+ A  +  +W I+R  F+TIM +T   R AE   FL++VPI  DL E  L K++D+LE   Y + + I++QG   + FFII  G   VT K  +  +EK IR L  GDFFGEKAL    LRTA++   +      L + R  F +L+  L  IK  +  DDE   + +K          +F+    +D++ I TLGVGGFGRV LV+  G   +SFALK MKK  IV+ +QQ H++SEK I+ E +  FI +LF+TFKD KY+Y+LME CLGGELW++LRD+  FDD TTRF  +CVVEAF+YLH RNIIYRDLKPENLL++ E GY+KL DFGFAK+L+ G+KTWTFCGTPEYVAPE+ILN+ HD SAD WSLG+L +ELL G PPF+ SDPM+ Y++ILKG+++I+   N  ++  A + I +LC  +P ERLG  R G  +I+ HK+F G+ W  L+   ++ P  P +K   D +NFD YP + +  P ++ +GWD DF
Sbjct:  401 KIQEMQRALQFKDNEIAELKSHLDKFQSVFPFSRGSAAGCAGTGGASGSGAGGSGGSGPGTATGATRKSGQNFQRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIK--HRYDDEGAMERRKI-------NEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLN-ERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRN--ITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089304)

HSP 1 Score: 535.028 bits (1377), Expect = 1.829e-176
Identity = 307/700 (43.86%), Postives = 436/700 (62.29%), Query Frame = 2
Query:  140 EVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFT-----------------VGGNSLKEKFFKRSKKHGVSAEAWT-STKMAEPVH---HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYA-AEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDEN-SGWDADF 2170
            ++++++   + KD +I EL+S +DK ++V   S   +                          G      + F+R +  G+SAE  + S+ + E V    ++KD  ++ LIK A+L N  +++L+  QI EIV+CMY  K  A + +I+EG   + +YV+  G+ +V RE   +S ++     GELA+LYNC+RTAT+ A  +  +W I+R  F+TIM +T   R AE   FL++VPI  DL E  L K++D+LE   Y + + I++QG   + FFII  G   VT K  +  +EK IR L  GDFFGEKAL    LRTA++   +      L + R  F +L+  L  IK  +  DDE   + +K          +F+    +D++ I TLGVGGFGRV LV+  G   +SFALK MKK  IV+ +QQ H++SEK I+ E +  FI +LF+TFKD KY+Y+LME CLGGELW++LRD+  FDD TTRF  +CVVEAF+YLH RNIIYRDLKPENLL++ E GY+KL DFGFAK+L+ G+KTWTFCGTPEYVAPE+ILN+ HD SAD WSLG+L +ELL G PPF+ SDPM+ Y++ILKG+++I+   N  ++  A + I +LC  +P ERLG  R G  +I+ HK+F G+ W  L+   ++ P  P +K   D +NFD YP + +  P ++ +GWD DF
Sbjct:  401 KIQEMQRALQFKDNEIAELKSHLDKFQSVFPFSRGSAAGCAGTGGASGSGAGGSGGSGPGTATGATRKSGQNFQRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAILDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIK--HRYDDEGAMERRKI-------NEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLN-ERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRN--ITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 325/696 (46.70%), Postives = 436/696 (62.64%), Query Frame = 2
Query:  122 INQLIEEVKQ-------LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVH-----HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEI-DNAPDENSGWDADF 2170
            + + IEE++Q       L+ E   KDE I++LQ+ +DK R+V+  +    + +        ++L+E   +R+K+  +SAE  T+  + +  H     + K   +K LIK A+L N  +++LE  QI EIV+CMY  +    S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATV+   +  +W IDR  F+TIM +T   +HAE   FL++VP    L E  L+KLAD+LE   YS  E I++QG   + FFII  G   VT++         +R L  GD+FGEKAL    +RTA+V AAE  T  L + R  F  L+G L  +    Y D         A    E   + F      D   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+ E  S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  F+D TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE LRK  +  P  P +    D SNFD++PE+  D  PD+NSGWD DF
Sbjct:   11 LQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQVHKQ--------SALQEH--QRTKRQAISAEP-TAFDIQDLSHVTLPFYPKSPQSKELIKEAILDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLQEEILSKLADVLEETHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGTPVYLRALGKGDWFGEKALQGEDIRTANVIAAEAVT-CLVIDRESFKHLIGGLDDVSNKGYDD-------AGAKAKYEAENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 684          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 317/684 (46.35%), Postives = 423/684 (61.84%), Query Frame = 2
Query:  137 EEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKM----AEPVH-HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEI-DNAPDENSGWDADF 2170
            E +K+++     K++++ EL+  + K ++VL              T+G  +         +  G+SAE  T+       +E +  H+K   +K LIK A+L N  +++LE  QI EIV+CMY  +    S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATV+   +  +W IDR  F+TIM +T   +HAE   FL++VP    L E  L+KLAD+LE   YS  E I++QG   + FFII  G   VT++         +R L  GD+FGEKAL    +RTA+V AAE  T  L + R  F  L+G L  +    Y D         A    E   + F      D   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+ E  S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  F+D TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE LRK  +  P  P +    D SNFD++PE+  D  PD+NSGWD DF
Sbjct:   17 ERIKEMERLLSAKEQEVNELKRKLHKYQSVLPS------------TIGPRT--------RRAQGISAEPQTARSFQDLKSEALRKHHKSVRSKELIKEAILDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLQEEILSKLADVLEETHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGTPVYLRALGKGDWFGEKALQGEDIRTANVIAAEAVT-CLVIDRESFKHLIGGLDDVSNKGYDD-------AGAKAKYEAENAFFSNLKLVDFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 669          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1a (protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:ZDB-GENE-040426-1308])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 312/691 (45.15%), Postives = 426/691 (61.65%), Query Frame = 2
Query:  113 VADINQLIEEVKQLKNESKIKD--EKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHN--KDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEI-DNAPDENSGWDADF 2170
            ++D+++   ++  LK E +I+D   ++ E +  I +L+  L +   +  + Q+G             +  +  G+SAE  T   ++        K   +K+LIK+A+L N  +++LE  QI EIV+CMY      NS +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATV+      +W IDR  F+TIM +T   +HAE    L++V     L E  L+KLAD+LE   Y     I++QG   + FFII  G   +T++     +   +R++  GD FGEKAL    +RTA+V AAE  T  L + R  +  L+G L  +      D E       A    E   + F     SD   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+ E  S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  FDD TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++W+ LRK  +  P  P +  + D SNFD++PE+  D  PD+NSGWD DF
Sbjct:    1 MSDLDEDFAKILMLK-EERIRDLERRLLEREDEISELKRKLHKCQSVLPSAQIGP------------RTHRAQGISAEPQTHQDLSNQSFRRVAKSDRSKDLIKSAILDNDFMKNLEMSQIQEIVDCMYPVDYDKNSCIIKEGDVGSLVYVMEDGKVEVTKEGLKLCTMGPGKVFGELAILYNCTRTATVRTVSSVKLWAIDRQCFQTIMMRTGLIKHAEYMELLKSVLTFRGLPEEILSKLADVLEETHYEDGNYIIRQGARGDTFFIISKGKVTMTREDCPGQEPVYLRSMGRGDSFGEKALQGEDIRTANVIAAETVT-CLVIDRDSYKHLIGGLEDVSNKGCEDAE-------AKAKYEAENAFFSNLNLSDFNIIDTLGVGGFGRVELVQLKSDEMKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGNFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKITKNAANLIKKLCRDTPSERLGNLKNGVKDIQKHKWFEGFNWDGLRKGTLMPPIIPNVTSSTDTSNFDSFPEDNEDPPPDDNSGWDIDF 667          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 321/725 (44.28%), Postives = 445/725 (61.38%), Query Frame = 2
Query:  104 NVNVADINQLIEEVKQLKNE-SKIKD---EKIKELQSVIDKLRAVLDQS---HPLSNNRQVGFTVGGNSLKEKFFKR-SKKHGVSAEAWTSTKMA--------EPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKI--NYGD----DERFQDFQKA---LPPVEP----------RVSDFKPA-PFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            N     I  L E++ Q K   S+I D    K  +L  + D L++  +      PL      G T     L+E   +R   K GVSAE  + T  +        E     K+ + K L+ +AL KN  L+ LE +Q+ ++VECMYE+       VI++G   N+L+V+  GK DV++    ++ I   T FGELA+LYNC RTA+VKA  +   W +DR +F  IMR T   RH + + FLR+V +L  L    LTK+ D LEV+ Y+K + I+++GE  N F+II +G   VTQ   + ++ + I TL  GD+FGEKAL+S  +R+A++ A E   E L + R  F + VG    +KK   +Y D    D++ ++ +++    PP  P          R S F    PF+ ++ I TLGVGGFGRV LVKLK  E+ +FALKC+KK HIV  +Q+ H+ SE+ ILLE +  FI ++++T+KD KYVY+L+E CLGGE+WS+LRDR  F++ T +FC+ CV EAF+YLH   IIYRDLKPENL++   +GY+KL DFGFAK+L+ G++TWTFCGTPEYVAPEIILNK H  S D WSLGIL +ELL G PPF+ SD M IY+ ILKG+E +D    KK++ +    I +LC ++P ERLGN +NG  DIK H++F G+ W  L+   + SP   ++K   D S FD+YP E +  PDE SGWD DF
Sbjct:   47 NAKELQIKHLEEQLAQQKQTLSEISDTLRSKCLQLNKLQDALKSQGELGLLPSPLKEKVSQGLT---GLLRETLNRRKGAKAGVSAEPSSRTYDSSGIPKFYFESARVWKEQSVKKLLTDALNKNQYLRRLEVQQVKDMVECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDYFGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKKRNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELVKLKN-ENVTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACLGGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLD-TDGYVKLVDFGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSDQMIIYTFILKGIEKMDFP--KKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGFSWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTDF 764          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 321/725 (44.28%), Postives = 445/725 (61.38%), Query Frame = 2
Query:  104 NVNVADINQLIEEVKQLKNE-SKIKD---EKIKELQSVIDKLRAVLDQS---HPLSNNRQVGFTVGGNSLKEKFFKR-SKKHGVSAEAWTSTKMA--------EPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKI--NYGD----DERFQDFQKA---LPPVEP----------RVSDFKPA-PFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            N     I  L E++ Q K   S+I D    K  +L  + D L++  +      PL      G T     L+E   +R   K GVSAE  + T  +        E     K+ + K L+ +AL KN  L+ LE +Q+ ++VECMYE+       VI++G   N+L+V+  GK DV++    ++ I   T FGELA+LYNC RTA+VKA  +   W +DR +F  IMR T   RH + + FLR+V +L  L    LTK+ D LEV+ Y+K + I+++GE  N F+II +G   VTQ   + ++ + I TL  GD+FGEKAL+S  +R+A++ A E   E L + R  F + VG    +KK   +Y D    D++ ++ +++    PP  P          R S F    PF+ ++ I TLGVGGFGRV LVKLK  E+ +FALKC+KK HIV  +Q+ H+ SE+ ILLE +  FI ++++T+KD KYVY+L+E CLGGE+WS+LRDR  F++ T +FC+ CV EAF+YLH   IIYRDLKPENL++   +GY+KL DFGFAK+L+ G++TWTFCGTPEYVAPEIILNK H  S D WSLGIL +ELL G PPF+ SD M IY+ ILKG+E +D    KK++ +    I +LC ++P ERLGN +NG  DIK H++F G+ W  L+   + SP   ++K   D S FD+YP E +  PDE SGWD DF
Sbjct:   52 NAKELQIKHLEEQLAQQKQTLSEISDTLRSKCLQLNKLQDALKSQGELGLLPSPLKEKVSQGLT---GLLRETLNRRKGAKAGVSAEPSSRTYDSSGIPKFYFESARVWKEQSVKKLLTDALNKNQYLRRLEVQQVKDMVECMYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDYFGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKKRNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELVKLKN-ENVTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACLGGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLD-TDGYVKLVDFGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSDQMIIYTFILKGIEKMDFP--KKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGFSWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTDF 769          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: tnpo2 (transportin 2 [Source:Xenbase;Acc:XB-GENE-968452])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 319/705 (45.25%), Postives = 439/705 (62.27%), Query Frame = 2
Query:  137 EEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHN-------KDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIK--------KINYGDDERFQDFQKALPPVEPR-----------VSDFKP-APFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            E++ QL+ E ++K  +I +LQ   D L   + Q+ P  + ++         L     ++  K GVSAE  TS     P   N       KD +AK LI  A++ N  L+ LE   +  +V+CMYE+  + +  VI+EG+  N+LYV+  G  DV +    + +++  TAFGELA+LYNC+RTATVKA  DS +WV+DR +F+ IM  +   +H E  +FLR    L  +    L  L  +     Y K + I+++GE  N FFII  G   VTQ +    + +EI+TL  GD+FGEKAL+S  +R+A++ A E +T+ L + R  F ++VG    ++        ++   D +R ++ +K+L     R           VS F   +PF  +  I TLG GGFGRV LVKLK  E  +FALKC+KK+HIV   QQ HV  EKNIL +++ SFI RL++TF+D KYVY+L+EVCLGGELWS+LRD   F++ T RFC  CV+EAF+YLH R I+YRDLKPENLL+  E GY+K+ DFGFAK++  GKKTWTFCGTPEYVAPEII+N+ HD  AD WSLGIL YELL G PPFS +DP+KIY+M+LKG+E +D  H  ++  ++   I +LC  +P ERLGN +NG  DI+ HK+FQG++WE LR  K+ SP   +IK   D S FD +  E +  PDE SGWD +F
Sbjct:   60 EKILQLEKELEVKVIQIDKLQ---DALGYNVTQTSPKGSQKK--------KLLSAHRRQKAKEGVSAEP-TSRHYYNPSSQNPDVTCVRKDSSAKKLITGAIMSNDFLRQLEASHVRCMVDCMYERVYSKSQLVIQEGAAGNHLYVLADGLLDVIQNSRLLGQMHPGTAFGELAILYNCKRTATVKAVTDSKIWVLDRQVFQNIMMSSAQAQHQEYFSFLRRYVGLFSVMIYRL--LYTIKNTDFYDKGDYIIREGEEGNTFFIIAKGKVCVTQAVEGSQEPQEIKTLGVGDYFGEKALISEDVRSANIIAEEDDTQCLVIDRDTFNQMVGTYQELQTYLREYVFQLALNDHDR-RNARKSLHHSMSRDNSEVNQLRELVSKFSSTSPFRYLDVITTLGTGGFGRVELVKLKD-EDMTFALKCIKKKHIVDTHQQEHVYWEKNILQQINCSFIIRLYRTFRDAKYVYMLLEVCLGGELWSILRDTGPFEEGTARFCTGCVLEAFDYLHNRGIVYRDLKPENLLLDSE-GYIKMVDFGFAKKIGPGKKTWTFCGTPEYVAPEIIMNRGHDFGADYWSLGILIYELLTGSPPFSGTDPIKIYNMVLKGIEKVDFPH--RIGRRSEDVIRRLCRINPAERLGNRKNGISDIRKHKWFQGFNWEGLRNRKLLSPLKREIKGITDHSYFDNFLPESEEPPDELSGWDKNF 745          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 324/696 (46.55%), Postives = 436/696 (62.64%), Query Frame = 2
Query:  122 INQLIEEVKQ-------LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVH-----HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEI-DNAPDENSGWDADF 2170
            + + IEE++Q       L+ E   KDE I+ LQ+ +DK R+V+  +     ++Q   T+G         +R+K+  +SAE  T+  + E  H     + K   +K LIK A+L N  +++LE  QI EIV+CMY  +   +S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATVK   +  +W IDR  F+TIM +T   +H E   FL++VP    L E  ++KLAD+LE   Y   + I++QG   + FFII  G   VT++    +    +RTL  GD+FGEKAL    +RTA+V AAE  T  L + R  F  L+G L  +    Y D E    ++          + F     +D   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+    S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  FDD TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE LRK  +  P  P +    D SNFD++PE+  D  PD+NSGWD DF
Sbjct:   11 LQEKIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQ-QVHKQNPTTLGE--------QRTKRQAISAEP-TAIDIQELSHVTLPFYPKSPQSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE-------AAFFGNLKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 685          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 324/696 (46.55%), Postives = 436/696 (62.64%), Query Frame = 2
Query:  122 INQLIEEVKQ-------LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVH-----HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEI-DNAPDENSGWDADF 2170
            + + IEE++Q       L+ E   KDE I+ LQ+ +DK R+V+  +     ++Q   T+G         +R+K+  +SAE  T+  + E  H     + K   +K LIK A+L N  +++LE  QI EIV+CMY  +   +S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATVK   +  +W IDR  F+TIM +T   +H E   FL++VP    L E  ++KLAD+LE   Y   + I++QG   + FFII  G   VT++    +    +RTL  GD+FGEKAL    +RTA+V AAE  T  L + R  F  L+G L  +    Y D E    ++          + F     +D   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+    S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  FDD TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE LRK  +  P  P +    D SNFD++PE+  D  PD+NSGWD DF
Sbjct:   11 LQEKIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQ-QVHKQNPTTLGE--------QRTKRQAISAEP-TAIDIQELSHVTLPFYPKSPQSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE-------AAFFGNLKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 685          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 314/684 (45.91%), Postives = 425/684 (62.13%), Query Frame = 2
Query:  137 EEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHN-KDFT----AKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEI-DNAPDENSGWDADF 2170
            E ++ L+N    K+++I+EL+  + K ++VL     + +   +G             + ++  G+SAE  +     +      K FT    +K LIK A+L N  +++LE  QI EIV+CMY  +   +S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATVK   +  +W IDR  F+TIM +T   +H E   FL++VP    L E  ++KLAD+LE   Y   + I++QG   + FFII  G   VT++    +    +RTL  GD+FGEKAL    +RTA+V AAE  T  L + R  F  L+G L  +    Y D E    ++          + F     +D   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+    S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  FDD TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE LRK  +  P  P +    D SNFD++PE+  D  PD+NSGWD DF
Sbjct:   17 ERIRDLENRLSEKEKEIQELKRKLHKYQSVL----AMPSTSHIGP------------RTTRAQGISAEPQSFRSYHDLTRQAFKKFTKSERSKELIKEAILDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE-------AAFFGNLKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 673          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: ptafr (platelet activating factor receptor [Source:Xenbase;Acc:XB-GENE-968925])

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 300/651 (46.08%), Postives = 405/651 (62.21%), Query Frame = 2
Query:  308 KRSKKHGVSAEAWTSTKMA-------EPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYG-------DDERFQDFQKALPPVEPR---------------VSDFKPA-PFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            ++  K GVSAE  +            E     K+ + K LI +AL KN  ++ ++  QI ++VECMYE+       +I +G   + ++V+  GK +VF+E   ++ I   T FGELA+LYNC RTA+VKA      W +DR +F+ IMRKT   +H E  +FL++VP+L +L E  L K+AD LE++ Y   + I+++GE  + FFII  G   VTQ      + + I+ L  GD+FGEKAL+S  +R+A++ A     E L + R  F + VG    + K   G       DDER    + A  PV  R               ++ F  A PF +++ + TLGVGGFGRV LVK+K  E+  FALKC+KK HIV  +QQ H+ SEKNIL E  S FI +L+ TFKD KYVY+L+E CLGGELWS+LRDR  FD+ T +FC  CV EAFEYLH + ++YRDLKPENLL+  E GY+KL DFGFAK++  G+KTWTFCGTPEYVAPE+ILNK H  S D WSLGIL YELL G PPF+  D M IY++IL+G+E I+   N    P+ +  I +LC ++P ERLGN +NG  DIK H++F G++WE L    + SP  P+++   D S FD+YP + +  PDE SGWD DF
Sbjct:  145 RKGAKEGVSAEPTSRYDGGDHPRFSFEKARVRKNTSEKILISDALNKNQFMKRMDHHQIQDMVECMYERIYLQGEFIIRQGEPGSQIFVLADGKAEVFQENKLLTSIPVWTTFGELAILYNCTRTASVKAITGVRTWALDREVFQNIMRKTAQSKHEEYLSFLKSVPLLKELPEHKLMKIADCLELEFYEMDDYIIREGEEGSTFFIISKGKVKVTQSTEGYKEPQYIKFLEKGDYFGEKALISDDVRSANILAYGDRVECLVMDRETFNKTVGTYEELMKCLEGYVANLTLDDER----RHAKSPVNERHLRAVSMELNKMKQTLARFPSASPFENLEIVTTLGVGGFGRVELVKVKN-ENLVFALKCIKKRHIVDNRQQEHIHSEKNILEEACSPFIVKLYCTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTAKFCTGCVTEAFEYLHQKGVLYRDLKPENLLLDSE-GYVKLVDFGFAKKIFPGQKTWTFCGTPEYVAPEVILNKGHSFSVDFWSLGILLYELLTGSPPFTGPDQMIIYNLILQGIEKIEFYKNITKRPEDL--IRRLCRENPAERLGNMKNGIADIKKHRWFNGFNWEGLNTRSLPSPLKPELEGPTDHSYFDSYPPDEEIPPDEVSGWDQDF 787          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 322/709 (45.42%), Postives = 445/709 (62.76%), Query Frame = 2
Query:  143 VKQLKNESKIKDEKIKELQSVI-----DKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTK--------MAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKK--------INYGDDERFQ-------DFQKALP----PVEPRVSDFKP-APFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            + +L  E + K  ++ +LQ VI       L+A  D+  PL  +R+    V  +S      +R  K GVSAE  T T           E     KD + K LI +AL KN  L+ L+ +QI ++VECMY +     S VI++G   N+++V+  G+ +VF+ +  +S I   T FGELA+LYNC RTA+VKA  +   W +DR +F+ IMR+T   R  E + FLR+V +L +L E  LTK+ D LEV+ Y K + I+++GE  + FFI+  G   VTQ     DQ + I+TL  G++FGEKAL+S  +R+A++ A E++   L + R  F + VG    ++K        +N  D++R            KAL      ++ +V+ F   +PF +++ I TLGVGGFGRV LVK+K  E+ +FA+KC++K+HIV  KQQ HV SEK IL EL S FI +L++TFKD KYVY+L+E CLGGELWS+LRDR  FD+ T++FC++CV EAF+YLH   IIYRDLKPENL++   +GYLKL DFGFAK++ +G+KTWTFCGTPEYVAPE+ILNK HD S D WSLGIL YELL G PPFS  D M  Y++ILKG+E +D    +K++ +    I +LC ++P ERLGN +NG  DIK H++  G++WE L+   + SP   ++    D S FD YP E    PDE SGWD DF
Sbjct:   65 IAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKV-PLDVHRKTSGLVSLHS------RRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLEMIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKN-ENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDA-DGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFP--RKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 325/696 (46.70%), Postives = 437/696 (62.79%), Query Frame = 2
Query:  122 INQLIEEVKQ-------LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVH-----HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDN-APDENSGWDADF 2170
            + + IEE++Q       L+ E   KDE I++LQ+ +DK R+V+ +       +Q   T+ G         R+K+  +SAE  T+  + +  H     + K   +K+LIK A+L N  +++LE  QI EIV+CMY  +   +S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATVK  V+  +W IDR  F+TIM +T   +H E   FL++VP    L +  L+KLAD+LE   Y   E I++QG   + FFII  G   VT++    +    +RTL  GD+FGEKAL    +RTA+V AAE  T  L + R  F  L+G L  +    Y D E    ++          + F     SD   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+    S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  F+D TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE LRK  +  P  P +    D SNFD++PE+ D   PD+NSGWD DF
Sbjct:   11 LQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVI-RPATQQAQKQSASTLQGEP-------RTKRQAISAEP-TAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE-------AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 686          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 307/696 (44.11%), Postives = 427/696 (61.35%), Query Frame = 2
Query:  143 VKQLKNESKIKDEKIKELQSVI-----DKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTK--------MAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYG-------DDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            + +L  E + K  ++ +LQ VI       L+A  D+  PL  +R+    V  +S      +R  K GVSAE  T T           E     KD + K LI +AL KN  L+ L+ +QI ++VECMY +     S VI++G   N+++V+  G+ +VF+ +  +S I   T FGELA+LYNC RTA+VKA  +   W +DR +F+ IMR+T   R  E + FLR+V +L +L E  LTK+ D LEV+ Y K + I+++GE  + FFI+  G   VTQ     DQ + I+TL  G++FGEKAL+S  +R+A++ A E++   L + R  F + VG    ++K   G       DDE+           +  +S +K +    ++ I+            VK+K  E+ +FA+KC++K+HIV  KQQ HV SEK IL EL S FI +L++TFKD KYVY+L+E CLGGELWS+LRDR  FD+ T++FC++CV EAF+YLH   IIYRDLKPENL++   +GYLKL DFGFAK++ +G+KTWTFCGTPEYVAPE+ILNK HD S D WSLGIL YELL G PPFS  D M  Y++ILKG+E +D    +K++ +    I +LC ++P ERLGN +NG  DIK H++  G++WE L+   + SP   ++    D S FD YP E    PDE SGWD DF
Sbjct:   65 IAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKV-PLDVHRKTSGLVSLHS------RRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRH--------AKRSMSSWKLSKALSLEMIQ--------LKEKVKVKN-ENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDA-DGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFP--RKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 733          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 318/683 (46.56%), Postives = 428/683 (62.66%), Query Frame = 2
Query:  137 EEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHNKDFT----AKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDN-APDENSGWDADF 2170
            E +K+L+     K+E+I+EL+  + K ++VL    P+ +       +G  +        ++  G+SAE  T     +     + FT    +K+LIK A+L N  +++LE  QI EIV+CMY  +   +S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATVK  V+  +W IDR  F+TIM +T   +H E   FL++VP    L +  L+KLAD+LE   Y   E I++QG   + FFII  G   VT++    +    +RTL  GD+FGEKAL    +RTA+V AAE  T  L + R  F  L+G L  +    Y D E    ++          + F     SD   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+    S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  F+D TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE LRK  +  P  P +    D SNFD++PE+ D   PD+NSGWD DF
Sbjct:   17 ERIKELEKRLSEKEEEIQELKRKLHKCQSVL----PVPSTH-----IGPRT--------TRAQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAE-------AAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 346.28 bits (887), Expect = 2.745e-112
Identity = 197/383 (51.44%), Postives = 247/383 (64.49%), Query Frame = 2
Query: 1025 LRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDN-APDENSGWDADF 2170
            +RTA+V AAE  T  L + R  F  L+G L  +    Y D        +A    E   + F     SD   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK I+    S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  F+D TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC                     ++F+G++WE LRK  +  P  P +    D SNFD++PE+ D   PD+NSGWD DF
Sbjct:   32 VRTANVIAAEAVT-CLVIDRDSFKHLIGGLDDVSNKAYED-------AEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKIAKNAANLIKKLC---------------------RWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 382          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|O76360|EGL4_CAEEL (cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans OX=6239 GN=egl-4 PE=1 SV=2)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 312/691 (45.15%), Postives = 448/691 (64.83%), Query Frame = 2
Query:  152 LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVG-------GNSLKEKFF------KRSKKHGVSAEAWT-STKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFK----PAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            +K  S+++ E +  LQ   DKLR+VL+Q    + +               GN L++K        +R+KK  VSAE      K A   H+NK   AK +I++A+ KN  L+ L ++QI E+V CMYE +  A   VI+EG   + L+VV  G+  V RE   + ++   T  GELA+LYNC RTA+V+A  D  +WV+DR +F+ I ++   +RH++L  FL  V I  +L+E  ++K+AD+++   Y     I++QGE  + FF+I SG   VTQ+I    + +EIR L  GDFFGE+ALL   +RTA++ A     E+L L R  F +L+G+L ++KK +YGD ER     +  P     V DF+         +++++ TLGVGGFGRV LV + G + ++FALK +KK+HIV  +QQ H+ +E+NI++E S+ +I +L++TF+D K+VY+L+EVCLGGELW+ LRDR  FDD T RF ++CV+E  EYLH +NI+YRDLKPEN L++   GYLKL DFGFAK+L +G+KTWTFCGTPEYV+PEIILNK HD +AD W+LGI   EL+ G PPF ASDPMK Y++ILKG++++++  N+++   A + + +LC  +P ERLG+G  G  DI+ H++F G+DWE LR   +K P  PK+ +  D +NFD YP + D  PDE SGWD  F
Sbjct:   94 IKRISELEGE-VTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIGDLESLKK-DYGDKERLAQVVREPPSPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLA-NTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIP-NRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 780          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|A8X6H1|EGL4_CAEBR (cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae OX=6238 GN=egl-4 PE=3 SV=2)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 311/692 (44.94%), Postives = 449/692 (64.88%), Query Frame = 2
Query:  149 QLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVG------GNSLKEKFF-------KRSKKHGVSAEAWT-STKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKP----APFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
             +K  S+++ E +  LQ   DKLR+VL+Q    + +     +        GN L++K         +R+KK  VSAE      K A   H+NK   AK +I++A+ KN  L+ L ++QI E+V CMYE +  A   VI+EG   + L+VV  G+  V RE   + ++   T  GELA+LYNC RTA+V+A  D  +WV+DR +F+ I ++   +RH+++  FL  V I  +LTE  ++K+AD+++   Y     IL+QGE  + FF+I SG   VTQ+I    + +EIR L  GDFFGE+ALL   +RTA++ A     E+L L R  F +L+G+L  ++K +YGD ER     +  P     V DF+         +++++ TLGVGGFGRV LV + G + +++ALK +KK+HIV  +QQ H+ +E+NI++E S+ +I +L++TF+D K+VY+L+EVCLGGELW+ LRDR  FDD T RF ++CV+E  EYLH +NI+YRDLKPEN L++  +GYLKL DFGFAK+L +G+KTWTFCGTPEYV+PEIILNK HD +AD W+LGI   EL+ G PPF ASDPMK Y++ILKG++++++  N+++   A + + +LC  +P ERLG+G  G  DI+ H++F G+DWE LR   +K P  PK+ +  D +NFD YP + D  PDE SGWD  F
Sbjct:   62 HIKRISELEGE-VTTLQRECDKLRSVLEQKAQSAASPGQPPSPSPRTDQLGNDLQQKAVFPADGTQQRAKKIAVSAEPTNFENKPATLQHYNKTVAAKQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGATLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQIINFLSKVSIFANLTEDRISKIADVMDQDYYDGGHYILRQGEKGDAFFVINSGQVKVTQQIEGEKEAREIRILNQGDFFGERALLGDEVRTANIIAQAPGVEVLTLDRESFTKLIGDLDTLRK-DYGDKERVATLVREPPSPVKIVDDFREEFANVTLKNVKRLATLGVGGFGRVELVCVNGDKSKTYALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLA-NSGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIP-NRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRTKTLKPPILPKVNNPADVTNFDNYPPDNDVPPDEFSGWDEGF 749          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q61410|KGP2_MOUSE (cGMP-dependent protein kinase 2 OS=Mus musculus OX=10090 GN=Prkg2 PE=1 SV=1)

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 323/709 (45.56%), Postives = 448/709 (63.19%), Query Frame = 2
Query:  143 VKQLKNESKIKDEKIKELQSVI-----DKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTK--------MAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKK--------INYGDDERFQ-------DFQKALP----PVEPRVSDFKP-APFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            + +L  E + K  ++ +LQ VI       L+A  D+  PL  +R+    V  +S      +R  K GVSAE  T T           E     KD + K LI +AL KN  L+ L+ +QI ++VECMY +K++  S VI++G   N+++V+  G+ +VF+ +  +S I   T FGELA+LYNC RTA+VKA  +   W +DR +F+ IMR+T   R  E + FLR+V +L +L E  LTK+ D LEV+ Y K + I+++GE  + FFI+  G   VTQ     DQ + I+TL  G++FGEKAL+S  +R+A++ A E++   L + R  F + VG    ++K        +N  D++R            KAL      ++ +V+ F   +PF +++ I TLGVGGFGRV LVK+K  E+ +FA+KC++K+HIV  KQQ HV SEK IL EL S FI +L++TFKD KYVY+L+E CLGGELWS+LRDR  FD+ T++FC++CV EAF+YLH   IIYRDLKPENL++   +GYLKL DFGFAK++ +G+KTWTFCGTPEYVAPE+ILNK HD S D WSLGIL YELL G PPFS  D M  Y++ILKG+E +D    +K++ +    I +LC ++P ERLGN +NG  DIK H++  G++WE L+   + SP   ++    D S FD YP E    PDE SGWD DF
Sbjct:   65 IAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKV-PLDVHRKTSGLVSLHS------RRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGEKLSTGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLEMIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKN-ENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHLLGIIYRDLKPENLILDA-DGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFP--RKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q13237|KGP2_HUMAN (cGMP-dependent protein kinase 2 OS=Homo sapiens OX=9606 GN=PRKG2 PE=1 SV=1)

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 321/709 (45.28%), Postives = 446/709 (62.91%), Query Frame = 2
Query:  143 VKQLKNESKIKDEKIKELQSVI-----DKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTK--------MAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKK--------INYGDDERFQ-------DFQKALP----PVEPRVSDF-KPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            + +L  E + K  ++ +LQ V+       L+A  D+  PL  +R+    V  +S      +R  K GVSAE  T T           E     KD + K LI +AL KN  L+ L+ +QI ++VECMY +     S +I++G   N+++V+  G+ +VF+ +  +S I   T FGELA+LYNC RTA+VKA  +   W +DR +F+ IMR+T   R  + + FLR+V +L +L E  LTK+ D LEV+ Y K + I+++GE  + FFI+  G   VTQ     DQ + I+TL  G++FGEKAL+S  +R+A++ A E++   L + R  F + VG    ++K        +N  D++R            KAL      ++ +V+ F   +PF +++ I TLGVGGFGRV LVK+K  E+ +FA+KC++K+HIV  KQQ HV SEK IL EL S FI +L++TFKD KYVY+L+E CLGGELWS+LRDR  FD+ T++FC++CV EAF+YLH   IIYRDLKPENL++  E GYLKL DFGFAK++ +G+KTWTFCGTPEYVAPE+ILNK HD S D WSLGIL YELL G PPFS  D M  Y++ILKG+E +D    +K++ +    I +LC ++P ERLGN +NG  DIK H++  G++WE L+   + SP   ++K   D S FD YP E    PDE SGWD DF
Sbjct:   65 IAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKV-PLEVHRKTSGLVSLHS------RRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKN-ENVAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAE-GYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFP--RKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q64595|KGP2_RAT (cGMP-dependent protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Prkg2 PE=1 SV=1)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 319/709 (44.99%), Postives = 445/709 (62.76%), Query Frame = 2
Query:  143 VKQLKNESKIKDEKIKELQSVI-----DKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTK--------MAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKK--------INYGDDERFQ-------DFQKALP----PVEPRVSDFKP-APFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            + +L  E + K  ++ +LQ VI       L+A  D+  PL  +R+    V  +S      +R  K GVSAE  + T           E     KD + K LI +AL KN  L+ L+ +QI ++VECMY +     S ++++G   N+++V+  G+ +VF+ +  +S I   T FGELA+LYNC RTA+VKA  +   W +DR +F+ IMR+T   R  E + FLR+V +L +L E  LTK+ D LEV+ Y K + I+++GE  + FFI+  G   VTQ     DQ + I+TL  G++FGEKAL+S  +R+A++ A E++   L + R  F + VG    ++K        +N  D++R            KAL      ++ +V+ F   +PF +++ I TLGVGGFGRV LVK+K  E+ +FA+KC++K+HIV  KQQ HV SEK IL EL S FI +L++TFKD KYVY+L+E CLGGELWS+LRDR  FD+ T++FC++CV EAF+YLH   IIYRDLKPENL++   +GYLKL DFGFAK++ +G+KTWTFCGTPEYVAPE+ILNK HD S D WSLGIL YELL G PPFS  D M  Y++ILKG+E +D    +K++ +    I +LC ++P ERLGN +NG  DIK H++  G++WE L+   + SP   ++    D S FD YP E    PDE SGWD DF
Sbjct:   65 IAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKV-PLDVHRKTSGLVSLHS------RRGAKAGVSAEPTSRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIVKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLEMIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKN-ENIAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDA-DGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFP--RKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: Q6USR9 (cGMP-dependent protein kinase OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 331/694 (47.69%), Postives = 454/694 (65.42%), Query Frame = 2
Query:  116 ADINQLIEEVKQLKNESKIKDEKIKELQSVIDKLRAV-LDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMA--EPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDD----ERFQDFQKALPPV--EPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            A+I +L EEV +LK+  ++K + +K  +S  D L  +  +Q+ P +                     +KK GVS E+ +S  +   +  HH KDF +K LIK+A+L N  ++ L   Q+ EI++CMYEK++     +I+ G    +LYV   G  +V +E  ++ EI     FGELA+LYNC+RTA+VKA   + +WV+DR +F+ IM KT  +R  E   FL++VP+L +L    L K++D+LE   + + E I+++G   + FFI+  G   VTQKI    + KE+R L  GD+FGEKALLS   RTA+V A     E L + R  F + VG+L+ ++  +YGD+    ER       + PV   P   +F+     D+Q + TLG+GGFGRV LV+L   + ++FALKC+KK+HIV+ +QQ H+ SEK I++E  S FI +L +TF+D KYVY+LMEVCLGGELW++LRDR  FDD+T RFC++CV+EAF YLH + IIYRDLKPENLL+    GY+KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELLNG PPFS SDPM+ Y++ILKG++ I+    KK+S  A   I +LC  +P ERLG G+NG  DI+ +K+FQG+DW+ L  L +  P  PK+K+  D SNFD+YP ++D A DE SGWD DF
Sbjct:   60 AEIARLKEEVHKLKSVLQLKVDTLKAQESKPDLLSTIDENQAEPTAPRGP-----------------AKKQGVSGESPSSKTLGYVDLTHHEKDFKSKQLIKDAILSNEFIKVLAATQLREIIDCMYEKRVPKACYIIKGGERGEHLYVCADGLLEVHKEDKRLGEIKSGGLFGELAILYNCKRTASVKAVTHTTLWVLDRRVFQAIMMKTGLQRREENMAFLKSVPLLKNLPSDKLAKMSDVLEYDFFHENEYIIREGAAGDTFFILNKGEVKVTQKIAGHAEPKEVRRLKRGDYFGEKALLSEDRRTANVIALPPGVECLTVDRESFTQFVGDLNELRNKDYGDEARGAERRSGSDSTVSPVSERPVAKEFENCSLDDLQLVTTLGMGGFGRVELVQLSKEKGKTFALKCLKKKHIVETRQQEHIYSEKKIMMEADSPFITKLHKTFRDRKYVYMLMEVCLGGELWTILRDRGNFDDLTARFCVACVLEAFSYLHAKGIIYRDLKPENLLLDA-RGYVKLVDFGFAKKIGVGKKTWTFCGTPEYVAPEIILNKGHDHSADYWSLGILMYELLNGTPPFSGSDPMRTYNIILKGIDHIEFP--KKISRSAHVLIKKLCRDNPMERLGYGKNGISDIRKNKWFQGFDWDGLMDLTLTPPIVPKVKNPTDTSNFDSYPRDMDIAADELSGWDIDF 733          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: V3Z912 (cGMP-dependent protein kinase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_127769 PE=3 SV=1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 323/626 (51.60%), Postives = 431/626 (68.85%), Query Frame = 2
Query:  311 RSKKHGVSAEAWTSTKM-AEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQD-FQKALPP----VEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            RSKK GVS E+ ++++   E  HH+KDF +K LIK+A+L N  L++L+  Q+ EIV+CMY+KKI     +I+EG   N+LYV   G+ +V +E T +  +    AFGELA+LYNC RTA+VKA  +  VWV+DR +F+ IM KT  +R  E   +LR+VP+L DL    L KLAD+LE+  Y + E I+++G T + FFI+  G   VTQ+I   +  +EIR L  GD+FGEK+LLS   RTA+V A     E L + R  F +L+G+L+ ++  +YGD+ R        L P     +  + +F      D+  + TLG+GGFGRV LV+L   + +++ALKC+KK+HIV  +QQ H+ SEK I+L   + FI RLF+TF+D KYVY++ME CLGGELW++LRDR  FDD TTRF +SCVVEAF+YLH + IIYRDLKPENLL+  + GY+KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD +AD WSLGIL +ELL G PPFS SDPMK Y++ILKG++ I+    +K+S  A + I +LC  +P ERLG G+NG  DIK HK+FQG+DWE L    +  P  PK+K+  D SNFD+YP++ D   DE SGWDADF
Sbjct:  104 RSKKQGVSGESSSNSQSNVELKHHDKDFRSKQLIKDAILDNDFLKNLDSTQVREIVDCMYDKKIKEGHYIIKEGESGNHLYVSADGEVEVQKEGTILGRMASGRAFGELAILYNCTRTASVKALTEVRVWVLDRAMFQAIMMKTGIQRRDENIRYLRSVPLLRDLPADKLAKLADVLEIDFYHEGEYIIREGATGDSFFILNKGEVKVTQRIQGHNNPQEIRKLKRGDYFGEKSLLSEDRRTANVIALPPGVECLTVDRDSFNQLIGDLNELRTKDYGDEARGASRLSGELTPGSRDKDRILEEFVNIKIDDLDVVATLGMGGFGRVELVQLSNDKMKTYALKCLKKKHIVDTRQQEHIYSEKQIMLTSRTPFIARLFKTFRDNKYVYMMMEACLGGELWTILRDRGSFDDKTTRFYVSCVVEAFKYLHHKGIIYRDLKPENLLLDNK-GYIKLVDFGFAKKIGAGKKTWTFCGTPEYVAPEIILNKGHDHAADYWSLGILMFELLTGSPPFSGSDPMKTYNIILKGIDVIEFP--RKISRNAHALIKKLCRDAPVERLGYGKNGITDIKKHKWFQGFDWEGLLNHSITPPIIPKVKNPTDYSNFDSYPKDNDIPADETSGWDADF 726          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A5N4A4B0 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_14115 PE=4 SV=1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 330/707 (46.68%), Postives = 457/707 (64.64%), Query Frame = 2
Query:   80 IKSDVISNNVNVADIN-QLIEEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVG-----GNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVH---HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDM-THNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            +K  +    VN  +++ +L+E  K++ +    K+ ++ +LQ  + KL++VL Q+   SN   +  ++       N +       +KK GVSAE+      A  +H   H KDF +K LIK+A++ N+ L+HL+  Q+ EIV+ MY ++  A S VI EG    +LYV   G F+V ++   +  +    AFGELA+LYNC RTA+++   DS VWV+DR +F+ IM +T  +R  +   FLR+VP+L +L+   L K+AD+LEV+ Y     I++QG + + FFII SG+  +TQ+I     E++IRTL  GD+FGE+ALL    RTASV A     E L L R  F++L+G+L   K+ +YGDD+R      ++  V     ++      D+  I TLGVGGFGRV LV+    +  +FALKC+KK+HIV  +QQ H+ SEK I++   S FICRL++TF+D+KYVY+L+E CLGGE+W++LRDRA FDD TTRF  +CV+EAF+YLH R IIYRDLKPENLL+  + GY+KL DFGF+KRL    KTWTFCGTPEYVAPE ILNK HD + D W+LGIL YELL G PPF+ASDPMK Y++ILKG++ ID   HN  +S  A S I +LC   P ERLG  R G QDIK HK+FQG+DW+ LR   +  P +  ++   D SNFD + +++D  PDE S WD DF
Sbjct:  248 LKQQLADLEVNYGNLHTKLLESRKEVHS----KESQVIKLQREVHKLKSVLQQATCFSNESDILTSLQEQHAMANRVPPAAVTFNKKQGVSAESSDIIGPAGDIHVQKHEKDFRSKQLIKDAIMDNNFLKHLDSLQVREIVDSMYPRQCEAGSYVIREGDAGAHLYVSAEGDFEVIKDDKVLGRMGSGKAFGELAILYNCTRTASIRVVTDSKVWVLDRKVFQQIMVRTGLQRLQDNINFLRSVPLLANLSNDVLAKIADVLEVEFYPSGAYIVRQGASGDTFFIISSGNVKITQRISGGLDEEDIRTLTRGDYFGEQALLREECRTASVIAMSPGVECLTLDRESFIQLIGDLSVFKEKDYGDDQRMLMRPSSVASVCAEKQEYDYMRLDDLDIIATLGVGGFGRVELVQYANDQSMTFALKCLKKQHIVDTQQQDHIFSEKMIMMCCRSPFICRLYRTFRDSKYVYMLLEACLGGEVWTILRDRACFDDHTTRFITACVIEAFDYLHNRGIIYRDLKPENLLLDND-GYVKLVDFGFSKRLGYSSKTWTFCGTPEYVAPETILNKGHDRAVDYWALGILMYELLTGSPPFTASDPMKTYNLILKGIDMIDFEKHN--VSRSAQSLIKKLCRDLPSERLGYQRGGIQDIKKHKWFQGFDWDGLRARSLPVPITKLVRGPCDTSNFDCFDKDVDIPPDELSDWDIDF 947          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A182E268 (cGMP-dependent protein kinase OS=Onchocerca ochengi OX=42157 GN=NOO_LOCUS2064 PE=3 SV=1)

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 326/694 (46.97%), Postives = 456/694 (65.71%), Query Frame = 2
Query:  149 QLKNESKIKDEKIKELQSVIDKLRAVLDQSH----PLSNNRQVGFTVGGNSLKEKFFK-----------RSKKHGVSAE-AWTSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVS----DFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            QLK  ++++ E +K LQS  DKLR+VLDQ       LSN ++V +  G   L+ +  +           RSKK  VSAE A   T+ A   HH K   +K LI++A+ KN  L+ L ++Q+ E+VECMYE +  A   VI+EG   + L+VV  G+  V RE   + ++      GELA+LYNC RTA+V+A  D  +WV+DR +F+ I  +   +RHA+L  FL  V +  +L+E  ++K+AD+L+   YS    I+++GE  + FFI+ SG   VTQ+I +  + +EIR L  GDFFGEKALL   +RTASV A     E+L L R  F +L+G+L A+ + +YGD +R        PP  PR +    +F      ++++I TLG+GGFGRV LV + G + ++FALK +KK+HIV  +QQ H+ +E+NI++E  S +I RL+ TF+D KYVY+LMEVCLGGELW+ LRDR  FDD T RF ++CV+EA EYLH +NI+YRDLKPEN L++ + GYLKL DFGFAK+L +G+KTWTFCGTPEYV+PEIILNK HD +AD W+LGI   EL+ G PPF A+DPMK Y++ILKG++++++  N+++   A + + +LC  +P ERLG G  G  DI+ H++F G+DWE LR   +K+P  PK+    D +NFD+YP E D  PDE SGWD  F
Sbjct:   45 QLKRINELEKE-VKTLQSECDKLRSVLDQKAQSVAALSNTKKVSW--GTEELRTELQQKAVLPTVDDGVRSKKMAVSAEPANLDTQKATLQHHPKSAGSKQLIRDAVQKNDFLRQLAKEQVIELVECMYEMRARAGQWVIQEGEPGDRLFVVAEGQLQVSREGIVLGKLGAGVVMGELAILYNCVRTASVQALSDVQLWVLDRSVFQMITMRLGMERHAQLMAFLSKVSLFENLSEDRISKIADVLDQDYYSGGNYIIREGEKGDTFFILTSGQVRVTQQIEDEPEPREIRILKQGDFFGEKALLGEEVRTASVIAINPGVEVLTLDRESFAKLIGDLEALNR-DYGDSQRRATVVVPEPP-SPRKTAQEKEFADLQLKNLKRIVTLGIGGFGRVELVCINGDKMRTFALKALKKKHIVDTRQQEHIFAERNIMMETRSDWIVRLYTTFRDAKYVYMLMEVCLGGELWTTLRDRGHFDDYTARFYVACVLEALEYLHRKNIVYRDLKPENCLLT-QTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQAADPMKTYTLILKGVDALEIP-NRRIGKTATALVKKLCKDNPGERLGCGSGGVGDIRKHRWFMGFDWEGLRSRTLKAPIVPKVASPSDVTNFDSYPPEQDVPPDEFSGWDEGF 731          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A044T9L7 (cGMP-dependent protein kinase OS=Onchocerca volvulus OX=6282 PE=3 SV=2)

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 326/694 (46.97%), Postives = 456/694 (65.71%), Query Frame = 2
Query:  149 QLKNESKIKDEKIKELQSVIDKLRAVLDQSH----PLSNNRQVGFTVGGNSLKEKFFK-----------RSKKHGVSAE-AWTSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVS----DFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            QLK  ++++ E +K LQS  DKLR+VLDQ       LSN ++V +  G   L+ +  +           RSKK  VSAE A   T+ A   HH K   +K LI++A+ KN  L+ L ++Q+ E+VECMYE +  A   VI+EG   + L+VV  G+  V RE   + ++      GELA+LYNC RTA+V+A  D  +WV+DR +F+ I  +   +RHA+L  FL  V +  +L+E  ++K+AD+L+   YS    I+++GE  + FFI+ SG   VTQ+I +  + +EIR L  GDFFGEKALL   +RTASV A     E+L L R  F +L+G+L A+ + +YGD +R        PP  PR +    +F      ++++I TLG+GGFGRV LV + G + ++FALK +KK+HIV  +QQ H+ +E+NI++E  S +I RL+ TF+D KYVY+LMEVCLGGELW+ LRDR  FDD T RF ++CV+EA EYLH +NI+YRDLKPEN L++ + GYLKL DFGFAK+L +G+KTWTFCGTPEYV+PEIILNK HD +AD W+LGI   EL+ G PPF A+DPMK Y++ILKG++++++  N+++   A + + +LC  +P ERLG G  G  DI+ H++F G+DWE LR   +K+P  PK+    D +NFD+YP E D  PDE SGWD  F
Sbjct:   76 QLKRINELEKE-VKTLQSECDKLRSVLDQKAQSVAALSNTKKVSW--GTEELRTELQQKAVLPTVDDGVRSKKMAVSAEPANLDTQKATLQHHPKSAGSKQLIRDAVQKNDFLRQLAKEQVIELVECMYEMRARAGQWVIQEGEPGDRLFVVAEGQLQVSREGIVLGKLGAGVVMGELAILYNCVRTASVQALSDVQLWVLDRSVFQMITMRLGMERHAQLMAFLSKVSLFENLSEDRISKIADVLDQDYYSGGNYIIREGEKGDTFFILTSGQVRVTQQIEDEPEPREIRILKQGDFFGEKALLGEEVRTASVIAINPGVEVLTLDRESFTKLIGDLEALNR-DYGDSQRRATVVVPEPP-SPRKTAQEKEFADLQLKNLKRIVTLGIGGFGRVELVCINGDKMRTFALKALKKKHIVDTRQQEHIFAERNIMMETRSDWIVRLYTTFRDAKYVYMLMEVCLGGELWTTLRDRGHFDDYTARFYVACVLEALEYLHRKNIVYRDLKPENCLLT-QTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQAADPMKTYTLILKGVDALEIP-NRRIGKTATALVKKLCKDNPGERLGCGSGGVGDIRKHRWFMGFDWEGLRSRTLKAPIVPKVASPSDVTNFDSYPPEQDVPPDEFSGWDEGF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000002114.2 (cGMP-dependent protein kinase 2-like [Source:NCBI gene;Acc:103041230])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 318/645 (49.30%), Postives = 422/645 (65.43%), Query Frame = 2
Query:  320 KHGVSAEAW---------TSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVG---ELHA-----IKKINYGDDERFQDFQKALPPVEPRVSDF-----KPAPFSD------IQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            K GVSAE           T     E     KD   K LI  A++ N  L+ LE +   E+V+CMYEK  TAN  VI+EG   N LYV+  G  +V +    + ++   TAFGELA+LYNC+RTATVKA   S +W +DR  F++IM ++   RH E  +FLR+V +L DL E  L K+ D LE+  + K E I+++GE  N FFII  G   VTQ      +  EI+ L  GD+FGEKAL+S  +R+A++ A E++T+ L + R  F ++VG   EL A     +++++  D+ R    Q  L    P+ ++      K A  S       +Q I TLG+GGFGRV LVKLK  E  +FALKC+KK+HIV  +QQ H+ SEKNIL + + +FI RLF+TF+D KYVY+L+EVCLGGELWSVLRD +FF++ T RFC+ CV+EAF+YLHG  I+YRDLKPENLL+  E GY+K+ DFGFAKR+  GKKTWTFCGTPEYVAPE+I+NK HD  AD WSLGIL +ELL G PPFS SDP+KIY+M+L G+E +D+   K++S +    I +LC  +P ERLGN +NG  DIK HK+FQG++WE LR+ K+ SP   ++    D S+FD +P E++  PDE SGWD DF
Sbjct:  130 KEGVSAEPTSGHFCKEHRTQHVSIERTRIRKDSGIKKLINEAIMNNDFLKKLEPQHTREMVDCMYEKVYTANQLVIQEGEPGNYLYVLAEGLLEVIQNGKLLGQMRPGTAFGELAILYNCKRTATVKAVTQSHIWALDRQTFQSIMMRSTQARHEEYFSFLRSVSLLKDLPEEKLAKIVDCLEIDYFDKGEYIIREGEEGNTFFIIAKGEVSVTQSTEGYSEPLEIKILGVGDYFGEKALISEDVRSANIIAKENDTQCLVVDRDNFNQMVGTYEELQAYLREYVEQLSINDERRIAATQSPLYERSPQAAELRSLHEKAARLSSCSFLQQLQIIATLGMGGFGRVELVKLKN-EDTAFALKCIKKKHIVDTRQQEHIYSEKNILQQTNCNFIVRLFRTFRDEKYVYMLLEVCLGGELWSVLRDMSFFEEATARFCIGCVLEAFDYLHGMGIVYRDLKPENLLLDAE-GYVKMTDFGFAKRIGLGKKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILIFELLIGSPPFSGSDPIKIYTMVLHGIEKVDIP--KRISKRPEDLIRRLCKLNPAERLGNKKNGIIDIKKHKWFQGFNWEGLRRRKLASPLRRELNGPLDHSHFDMFPPELEEPPDELSGWDKDF 770          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 304/654 (46.48%), Postives = 418/654 (63.91%), Query Frame = 2
Query:  290 LKEKFFKR-SKKHGVSAE----AWTSTKMA----EPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYG------DDERFQDFQKA---LPPVEP--------RVSDFKPA-PFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            L+E   KR   K GVSAE     + S+ M     E     K+ + K L+ +AL KN  L+ LE +QI ++VECMYE+       VI++G   N+L+V+  G  DV++    ++ I   T FGELA+LYNC RTA+VKA      WV+DR +F  IMR T   RH + ++FLR+V +L  L E  LTK+ D LEV+ Y K + ++++GE  N F+II  G   VTQ   + ++ + I TL  GD+FGEKAL+S  +R+A++ A E   E L + R  F + VG    +KK   G       D++ ++ +++    PP  P        R  +F     FS+++ I TLG+GGFGRV LVK+K  E+ +FALKC+KK HIV  +Q+ H+ SE+ IL E +S FI ++++TFKD+KYVY+L+E CLGGE+WS+LRDR  F++ T +FC+ CV EAFEYLH + IIYRDLKPENL++   +GY+KL DFGFAK+++ G+KTWTFCGTPEYVAPEIILNK H  S D W+LGIL +ELL G PPF+ SD M  Y+ ILKG+E +D    KK+S +    I +LC ++P ERLGN +NG  DIK H++F G+ W  L+   + SP   ++K   D S FD YP E +  PDE SGWD DF
Sbjct:  118 LRETLNKRKGAKAGVSAEPSSRTYDSSSMPKFYFESARVWKEPSVKKLLTDALNKNRYLRRLEGQQIKDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETLARDDKKRNAKRSGSNTPPSSPLSLDRIQLREKNFTSTLSFSNLEIIATLGIGGFGRVELVKVKN-ENVTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDS-DGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDFP--KKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWDMDF 767          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 289/636 (45.44%), Postives = 392/636 (61.64%), Query Frame = 2
Query:  290 LKEKFFKR-SKKHGVSAE----AWTSTKMA----EPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            L+E   KR   K GVSAE     + S+ M     E     K+ + K L+ +AL KN  L+ LE +QI ++VECMYE+       VI++G   N+L+V+  G  DV++    ++ I   T FGELA+LYNC RTA+VKA      WV+DR +F  IMR T   RH + ++FLR+V +L  L E  LTK+ D LEV+ Y K + ++++GE  N F+II  G   VTQ   + ++ + I TL  GD+FGEKAL+S  +R+A++ A E   E L + R  F + VG    +KK   G  E       A    +     F  A  S   K+K                  E+ +FALKC+KK HIV  +Q+ H+ SE+ IL E +S FI ++++TFKD+KYVY+L+E CLGGE+WS+LRDR  F++ T +FC+ CV EAFEYLH + IIYRDLKPENL++   +GY+KL DFGFAK+++ G+KTWTFCGTPEYVAPEIILNK H  S D W+LGIL +ELL G PPF+ SD M  Y+ ILKG+E +D    KK+S +    I +LC ++P ERLGN +NG  DIK H++F G+ W  L+   + SP   ++K   D S FD YP E +  PDE SGWD DF
Sbjct:  118 LRETLNKRKGAKAGVSAEPSSRTYDSSSMPKFYFESARVWKEPSVKKLLTDALNKNRYLRRLEGQQIKDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETL-----ARDDKKRNAKWFLIAVCSSQVKVKN-----------------ENVTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDS-DGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDFP--KKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWDMDF 728          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 314/684 (45.91%), Postives = 415/684 (60.67%), Query Frame = 2
Query:  137 EEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVH-----HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEI-DNAPDENSGWDADF 2170
            E +++++     K+E+I EL+  + K ++VL  S PL   R                   +  G+SAE    T   +        H K   +K LIK A+L N  +++LE  QI EI  C           +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATV+   +  +W IDR  F+TIM +T   +HAE   FL++VP    L E  L+KLAD+LE   Y   E I++QG   + FFII  G   VT++    D    +R L  GD+FGEKAL    +RTA+V AA+  T  L + R  F  L+G L  +    Y D         A    E   + F     +D   I TLGVGGFGRV LV+LK  E ++FA+K +KK HIV  +QQ H+ SEK+I+ E  S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  F+D TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE LRK  +  P  P +    D SNFD++PE+  D  PD+NSGWD DF
Sbjct:   17 ERIREMELRLAEKEEEIAELKRKLHKCQSVL-PSAPLMGPRT-----------------RRAQGISAEPQPFTSFQQLTSEALRKHAKSDRSKELIKEAILDNDFMKNLELSQIQEIESC-----------IIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLAEEILSKLADVLEETHYDDGEYIIRQGARGDTFFIISKGKVNVTREDSPSDTPVYLRALGKGDWFGEKALQGEDIRTANVIAADAVT-CLVIDRDSFKHLIGGLDDVSSKGYED-------AGAKAKYEAENAFFSNLKLADFNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKHIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPDVSSPTDTSNFDSFPEDSEDPPPDDNSGWDTDF 660          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 522.702 bits (1345), Expect = 6.848e-176
Identity = 295/654 (45.11%), Postives = 402/654 (61.47%), Query Frame = 2
Query:  290 LKEKFFKR-SKKHGVSAE----AWTSTKMA----EPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYG------DDERFQDFQKA---LPPVEP--------RVSDFKPA-PFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            L+E   KR   K GVSAE     + S+ M     E     K+ + K L+ +AL KN  L+ LE +QI ++VECMYE+       VI++G   N+L+V+  G  DV++    ++ I   T FGELA+LYNC RTA+VKA      WV+DR +F  IMR T   RH + ++FLR+V +L  L E  LTK+ D LEV                            VTQ   + ++ + I TL  GD+FGEKAL+S  +R+A++ A E   E L + R  F + VG    +KK   G       D++ ++ +++    PP  P        R  +F     FS+++ I TLG+GGFGRV LVK+K  E+ +FALKC+KK HIV  +Q+ H+ SE+ IL E +S FI ++++TFKD+KYVY+L+E CLGGE+WS+LRDR  F++ T +FC+ CV EAFEYLH + IIYRDLKPENL++  + GY+KL DFGFAK+++ G+KTWTFCGTPEYVAPEIILNK H  S D W+LGIL +ELL G PPF+ SD M  Y+ ILKG+E +D    KK+S +    I +LC ++P ERLGN +NG  DIK H++F G+ W  L+   + SP   ++K   D S FD YP E +  PDE SGWD DF
Sbjct:  118 LRETLNKRKGAKAGVSAEPSSRTYDSSSMPKFYFESARVWKEPSVKKLLTDALNKNRYLRRLEGQQIKDMVECMYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEV--------------------------VKVTQSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETLARDDKKRNAKRSGSNTPPSSPLSLDRIQLREKNFTSTLSFSNLEIIATLGIGGFGRVELVKVKN-ENVTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSD-GYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDFP--KKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWDMDF 741          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002200.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 356.295 bits (913), Expect = 1.458e-117
Identity = 181/340 (53.24%), Postives = 238/340 (70.00%), Query Frame = 2
Query: 1151 RFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            R  +   ALP  +PR         + +  I TLGVGGFGRV LVKLK  +  +FALKC+KK+ +V+ +QQ HV SEK IL E S  FI R ++TF+D K+V+LLME CLGGELWSVLRD   F +++ RFC++CVVEA  YLH R I+YRDLKPENLL+    GY+K+ DFGFAK+L  G+K WTFCGTPEYV PE+I+N+ HD  AD W+LG+L YELL G+PPFS +DPMK Y+ IL G+E +   +  ++  +A   I +LC ++P ERLGN ++G  D++ HK+FQG+DWE LR  ++ SP   ++    D  NFD +PE++D  PDE SGWD DF
Sbjct:   17 RLMELLSALPTSDPR---------AHMDVIATLGVGGFGRVQLVKLKDSD-VTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVRFYRTFRDQKFVFLLMEACLGGELWSVLRDSGGFQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDA-RGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPN--EVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPEDLDVPPDETSGWDHDF 343          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002201.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36797:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002201.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 291.967 bits (746), Expect = 1.038e-93
Identity = 140/288 (48.61%), Postives = 187/288 (64.93%), Query Frame = 2
Query: 1307 SFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            +FALKC+KK+ +V+ +QQ HV SEK IL E S  FI R                   GG           F +++ RFC++CVVEA  YLH R I+YRDLKPENLL+    GY+K+ DFGFAK+L  G+K WTFCGTPEYV PE+I+N+ HD  AD W+LG+L YELL G+PPFS +DPMK Y+ IL G+E +   +  ++  +A   I +LC ++P ERLGN ++G  D++ HK+FQG+DWE LR  ++ SP   ++    D  NFD +PE++D  PDE SGWD DF
Sbjct:   23 TFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVR-------------------GG-----------FQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDAR-GYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPN--EVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPEDLDVPPDETSGWDHDF 277          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.81 bits (608), Expect = 2.204e-73
Identity = 122/274 (44.53%), Postives = 171/274 (62.41%), Query Frame = 2
Query: 1304 QSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEE 2125
            Q  +LK  K+  +VK+KQ  H L+EK IL  +S  F+ RL  +FKD   +Y+++E   GGE++S LR    F +  +RF  + +V AFEYLH  ++IYRDLKPENLLI  + GY+++ DFGFAKR++   +TWT CGTPEY+APEIIL+K ++ + D W+LG+L YE+  G PPF A  P++IY  I+ G     +      S      +  L      +R GN +NG  DIK+HK+F   DW  + + K+++PF PK K   D SNFD Y EE
Sbjct:    5 QHVSLKATKRTKVVKLKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLID-QQGYIQVTDFGFAKRVKG--RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG----KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFDDYEEE 271          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: stk38l (serine/threonine kinase 38 like [Source:ZFIN;Acc:ZDB-GENE-040426-798])

HSP 1 Score: 171.014 bits (432), Expect = 2.228e-47
Identity = 95/309 (30.74%), Postives = 168/309 (54.37%), Query Frame = 2
Query: 1310 FALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGF------AKRLE--------------------NGKK---TW---------TFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPE 2122
            +A+K ++K  +++ +Q  H+ +E++IL+E  + ++ ++F +F+D K +YL+ME   GG++ ++L  +    +  T+F ++  + A + +H    I+RD+KP+NLL+  + G++KL DFG       A R E                    N K+   TW         +  GTP+Y+APE+ L   ++   D WSLG++ +E+L G PPF +  P + Y  ++   E++       +S K+   I + CC++   R+G   NG ++IK+H +F+G DWE +R+     P   +IK   D SNFD +PE
Sbjct:   13 YAMKVLRKADMLEKEQVAHIRAERDILVEADNLWVVKMFYSFQDPKNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAESILAIDSIHQLGFIHRDIKPDNLLLDSK-GHVKLSDFGLCTGLKKAHRTEFYRDLTQAQPSDFSTSSKPMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFLQTGYNKLCDWWSLGVIMFEMLIGYPPFCSESPQETYRKVMHWRETLVFPPEVPISEKSRDLILRFCCEA-ENRVGA--NGVEEIKTHAFFEGVDWEHMRERPAAIPI--EIKSIDDTSNFDEFPE 315          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.555 bits (436), Expect = 2.366e-47
Identity = 96/270 (35.56%), Postives = 157/270 (58.15%), Query Frame = 2
Query: 1310 FALKCMKKEHIVKMKQQTHVLSEKNILLE-LSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKR-LENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMIL-KGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFD 2110
            +A+K MKK  I++ K++ H+++E+N+L++ +   F+  L  +F+    +Y +M+   GGEL+  L+ +  F +   +F  + +  A  YLH  NI+YRDLKPEN+L+  + G++ L DFG  K  ++    T TFCGTPEY+APE++    +D + D W LG + YE+L G+PPF + +  ++Y  IL + L+    T N      AIS +  L  K P +RLG   +   +IK+H +F   +W  L   ++ SP++P +    D  NFD
Sbjct:  118 YAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQ-GHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPCTTN-----AAISVLEGLLHKDPHQRLG-ATSDILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFD 380          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 233.032 bits (593), Expect = 3.108e-70
Identity = 112/273 (41.03%), Postives = 169/273 (61.90%), Query Frame = 2
Query: 1310 FALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAF-DGSNFDAYPEE 2125
            +A+K +KK+ +VKMKQ  H   E+ +L  +   F+ R++ TF+D + ++++M+   GGEL+S+LR    F +   +F  + V+ A EYLH  NIIYRDLKPEN+L+   NG++K+ DFGFAK ++    TWT CGTP+Y+APE+I  K ++ S D WSLG+L YE+L G  PF  + PMK Y  IL+G     + +     P  +  +++L       R+GN ++G +DIK+H +F    WE+L    +++P+ P I     D S FD YPEE
Sbjct:   96 YAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLD-RNGHIKITDFGFAKEVQT--VTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQG----KVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEE 361          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 222.631 bits (566), Expect = 3.786e-66
Identity = 115/273 (42.12%), Postives = 170/273 (62.27%), Query Frame = 2
Query: 1310 FALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDA-FDGSNFDAYPEE 2125
            +ALK +KK  IVK+KQ  H   E+ +L  +S  FI R++ TF+D++ V+++M+   GGEL+S+LR    F +   +F  + V  A EYLH ++IIYRDLKPEN+L+  +NG++K+ DFGFAK + +   T+T CGTP+Y+APE++  K ++ S D WS G+L YE+L G  PF  S+ MK Y  IL      ++       P A   + +L  +   ERLGN +NG +D+K+H +F    WEKL    +++P+ P I+    D S FD YPEE
Sbjct:  114 YALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLD-KNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNA----ELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEE 379          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 216.853 bits (551), Expect = 5.312e-64
Identity = 110/273 (40.29%), Postives = 171/273 (62.64%), Query Frame = 2
Query: 1310 FALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDA-FDGSNFDAYPEE 2125
            +A+K +KKE +V++KQ  H   E+ +L  ++  FI R++ TF+D + ++++M+   GGEL+S+LR    F +   +F  + V  A EYLH ++IIYRDLKPEN+L+  +NG++K+ DFGFAK + +   T+T CGTP+Y+APE++  K ++ S D WS GIL YE+L G  PF  S+ MK Y  IL          N+ +       +++L  +   +RLGN +NG +D+K+H +F+   WEKL    +++P+ P I+    D S FD YPEE
Sbjct:  113 YAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLD-KNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVK----DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEE 378          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 179.104 bits (453), Expect = 4.283e-48
Identity = 100/283 (35.34%), Postives = 160/283 (56.54%), Query Frame = 2
Query: 1310 FALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAK-RLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFD---AYPEEIDNAPDE 2146
            +ALK ++K +IV   + TH L+E+ +L  +   FI  L  +F+  + +YL++    GGEL+  L+    F    +RF ++ ++ A + LH  ++IYRDLKPEN+L+  + G++ LCDFG  K  +++  KT TFCGTPEY+APEI+L + +  + D W+LGIL YE++ G+PP+   +   +Y  IL+      +       P A   +  L  + P  RL  G NG  +I++H +F+   W+KL       P+ P +K   D +NFD      + ID+  DE
Sbjct:  370 YALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQ-GHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQ----PLLFPDGFDPAAKDLLIGLLSRDPSRRL--GVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDE 645          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 178.333 bits (451), Expect = 9.127e-48
Identity = 98/283 (34.63%), Postives = 157/283 (55.48%), Query Frame = 2
Query: 1310 FALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAK-RLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFD---AYPEEIDNAPDE 2146
            +ALK ++K +IV   + TH L+E+ +L  +   FI  L  +F+  + +Y ++    GGEL+  L+    FD    RF  + ++ A + LH  +++YRDLKPEN+L+  + G++ LCDFG  K  +++  KT TFCGTPEY+APE++L   +  + D W+LG+L YE+L G+PP+   D  K+Y  IL+      +         A   +  L  + P  RL  G NG  +I++H +F    W++L       P+ P + ++ D SNFD      + ID+  DE
Sbjct:  373 YALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQ-GHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQE----PLVFPDGFDRDAKDLLIGLLSRDPTRRL--GYNGADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVVDE 648          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 324/677 (47.86%), Postives = 443/677 (65.44%), Query Frame = 2
Query:  152 LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAE---PVH-HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            L+ E + KDE I+ L+S +DK R+VL    P S         GG S       R+++ G+SAE  ++ ++A+   P+  H K+  +K LIK A+L N  L++LE  Q+ E+VECM E+    +  +I+E    ++LYV+  GK  V +E T +  +    AFGELA+LYNC RTA+V+A     +W IDR  F+TIM KT   R AE   FLR+V +L DL E+ L K+AD++E   Y + E I++QG   + FFII+SG+  +TQ+         +R L  G +FGEKAL    LRTA+  A +     L L R  F++ +G L  I++  Y D +R  D Q A   +  +  +F      D+  +KTLG+GGFGRV LV++ G + ++FALK +KK HIV+ +QQ H++SEK I++E +S FI RL +TFKD KY+Y+L+EVCLGGELW++LRDR  FDD TTRF + CV+EAF+YLH + I+YRDLKPENLL+ G +GY KL DFGFAK++  G+KTWTFCGTPEYVAPEIILNK HD SAD WSLGIL YELL G PPFS +DPMK Y++ILKG++ ID    +K++  A + I +LC  +P ERLG  + G +DI  HK+F G++W+ LR  K+ SP +PKIK   D SNFD YP + D  PD+ +GWD DF
Sbjct:    3 LEQELRRKDELIRRLESELDKYRSVLQP--PASAG------PGGRSRA-----RNQRQGISAEPQSAKQVADSSKPLQRHPKNSRSKELIKEAILDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEEGKCQVTKEGTVLGHMGPGKAFGELAILYNCTRTASVRAQTSGKLWAIDRQTFQTIMMKTGLMRTAEHMEFLRSVNLLKDLAESYLLKIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNVDITQRTNVHSDPVHVRNLSKGAYFGEKALKGEDLRTANCIAGKGGVTCLVLDREAFVQFIGNLDDIQRDQYDDSQRGVDPQTA-SHLRAQQDEFANVRLEDLTVVKTLGIGGFGRVELVQVAG-DKRTFALKTLKKHHIVETRQQDHIMSEKKIMMESNSPFIVRLHKTFKDKKYLYMLLEVCLGGELWTILRDRGSFDDSTTRFYVGCVIEAFQYLHSKGIVYRDLKPENLLLDG-HGYCKLVDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGTDPMKTYNIILKGIDMIDFP--RKITRNAHALIKKLCRDNPVERLGYQKGGLKDIMKHKWFDGFNWDGLRSRKLNSPIAPKIKSPVDASNFDDYPADDDIPPDDMTGWDKDF 661          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO38399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY8])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 302/652 (46.32%), Postives = 412/652 (63.19%), Query Frame = 2
Query:  308 KRSKKHGVSAEAWTSTKMAEPVHHNK-------DFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVS-DFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYF------------------QGYDWEKLRKLKMKSPFSP-----KIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            K+ K+  VS E  +STK  E     K       DF +K LIK+A+ +N  L++LE  Q+ EIV+CMY      N  +I+EG   N LY +  G+  V RE   + E+     FGELA+LYNCRRTATV A   + +W IDR +F+ IM +T   R AE   FL++VP+L +L  A L+KLAD+LEV  Y   + I+++ E  + F+II  GSA VTQ+I      KEIR L  GD+FGEKALLS   RTA+V A E+  E L + R  F+ ++G +  +++ +YGD++R       +P  E +VS +F      D++ + TLG GG           +E  ++ALKC+KK+HI+  +QQ HV SEK IL+E +S FIC++++TFKD KYVY+L+E CLGGELW++LRDR  F+D T RFC++CVVE FEYLH + I+YRDLKPENLL+  + GY+KL DFGFAK++ +G+KTWTFCGTPEYVAPEIILNK HD S+D WSLGIL +ELL G PPFS+SDPMK Y++IL+GL+ ++       +P+  + I +LC  +P ERLG  ++G  DIK HKY                   Q   W     L  K+  SP     +++ + D SNFD Y +++D  PDE SGWD +F
Sbjct:   18 KKEKRQAVSGE--SSTKAQEESRTGKELERFPKDFRSKQLIKDAIFENDFLKNLEAAQVREIVDCMYSNTFQRNDVIIQEGDAGNALYAIADGRLQVTRENKVLGEMVAGMVFGELAILYNCRRTATVTAMEPTKLWKIDRRVFQIIMMRTGMIRQAEHMAFLKSVPLLKELPNAELSKLADVLEVDFYHAGDYIIRENERGDTFYIITKGSARVTQRIEGQTGPKEIRKLQKGDYFGEKALLSEDRRTANVIAEENGVECLVVDRTVFMTVIGNMDELREKDYGDEKRGAKRTLDVPEEERKVSKEFADLTLEDLEVVATLGTGG--------FGRVELVTYALKCLKKKHILDTRQQEHVYSEKRILMETNSPFICKIYRTFKDRKYVYMLLEACLGGELWTILRDRGTFEDATARFCIACVVEGFEYLHSKGIVYRDLKPENLLLDAK-GYVKLVDFGFAKKIGSGRKTWTFCGTPEYVAPEIILNKGHDLSSDYWSLGILIFELLTGSPPFSSSDPMKTYNIILRGLDMVEFPKRIGRNPQ--NLIKRLCKDNPVERLGYQKDGLSDIKKHKYVVPWFPLAGTHRRDPRTSNQTRFWLMTTTLSFKT--SPIYLLIRVESSTDYSNFDVYSKDMDIPPDEMSGWDENF 654          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 241.121 bits (614), Expect = 2.146e-73
Identity = 124/276 (44.93%), Postives = 172/276 (62.32%), Query Frame = 2
Query: 1310 FALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGL----ESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEE 2125
            +ALK M    ++++KQ  HV +EKNIL+ +   FI  L  T  D  ++Y+L+E   GGEL++ LR    F++ T  F  S +V A +YLHG +I+YRDLKPEN+L+   +G++KL DFGFAK + +  KTWT CGTPEY+APEII +K H+ + D W+LGIL YE+L G PPF   +P  IY  IL G     + +D T  K L       I +L       RLG+ +NG +D+K+HK+F+  DW  + + K+K P +PKI    D  NFD YPEE
Sbjct:   44 YALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLD-RDGHVKLTDFGFAKEVHD--KTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSGKVEWPKHMDNTSAKDL-------IKKLLVHDRTRRLGSMKNGSEDVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFDDYPEE 309          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO31895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM6])

HSP 1 Score: 198.749 bits (504), Expect = 5.041e-55
Identity = 105/280 (37.50%), Postives = 164/280 (58.57%), Query Frame = 2
Query: 1310 FALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDEN 2149
            +A+K +KK   +K++ +   + E++IL+++   FI RL   F+    VYL+++   GG+L++ L     F +   +F L+ +  A ++LHG  IIYRDLKPEN+L+   +G++ L DFG +K  E+ +KT++FCGT EY+APE++  + H  +AD WS G+L +E+L G  PF   D     +MILK      +   + L+P+A S + QL  ++P  RLG G  G +DIK H +F   +WE L K ++K PF P    A D   FD  PE     P ++
Sbjct:   38 YAMKVLKKA-TLKVRDRMRTMKERDILVDVQHPFIVRLNYAFQTEGKVYLILDFLRGGDLFTRLSKEIMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDA-SGHVALTDFGLSKESEHDQKTYSFCGTVEYMAPEVVNRRGHSQAADWWSYGVLMFEMLTGSLPFQGKDRKDTMNMILKA----KLGMPQFLTPEAQSLLRQLFKRNPLNRLGAGDLGIEDIKKHPFFSTINWELLYKREIKPPFKPAAGRADDAFYFD--PEFTSKTPQDS 309          

HSP 2 Score: 99.7525 bits (247), Expect = 8.340e-22
Identity = 65/192 (33.85%), Postives = 101/192 (52.60%), Query Frame = 2
Query: 1319 KCMKKEHIVKM--KQQTHVLSEKNILLELSSS-FICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGY---LKLCDFGFAK--RLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILK 1870
            K   KE+ VK+  K +     E  ILL       I  L   ++  K VY++ME+  GGEL   +       +      +  +     +LH   +++RDLKP N++ + ++G    L++ DFGFAK  R  NG    T C T  +VAPE++  + +D++ D+WSLG+L Y +L+G+ PF A  P    S+ILK
Sbjct:  376 KADGKEYAVKIFEKPKKDPSEEMEILLRFGHHPNIVHLRDAYEAGKQVYIVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAKQMRATNGL-LMTPCYTANFVAPEVLKKQGYDAACDIWSLGVLLYTMLSGLTPF-AVGPEDTPSVILK 565          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 186.422 bits (472), Expect = 3.989e-52
Identity = 121/326 (37.12%), Postives = 170/326 (52.15%), Query Frame = 2
Query: 1145 DERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQT-HVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKR--LENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDA 2113
            DER +  Q +   V P+     P  F ++ K+   G  G   +        + + FA+K +KK  I++ ++ T H  +E+NIL  +   FI  L   F+    +YL++E   GGEL+  L     F + T  F LS +  A E+LH + I+YRDLKPEN+L+   NG++KL DFG  K    EN   T TFCGT EY+APEI+    H  + D WSLG L Y++L G PPF A +  K    ILKG     +     L+P+A  FI +L  + P  RLG        IK+H +F+   WE L   K++ PF P I    D S FD+
Sbjct:   40 DERMETLQLSEETVNPKDEKVGPESF-ELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDA-NGHVKLTDFGLCKESIFENSL-THTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKG----KLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFDS 358          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: ENSORLT00000001302.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 331/742 (44.61%), Postives = 460/742 (61.99%), Query Frame = 2
Query:   74 PSIKSDVISNNVN-----VADINQLIE----EVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFF-----KRSKKHGVSAEA-------W----TSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVG---ELHAIKKINYGD----DER---FQDFQKALPPVEPRVSDFK------PA--PFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            P + SD++   +      +A  NQ  +    ++++L+ E + K  +I++LQ  I   + V      L ++    F+        K       +   K GVSAE        W    +S   A  VH N D   K LI  A+L N  L+ LE + + E+V+CMYEK  +    VI+EG   N LYV+  G  +V +    + E++  TAFGELA+LYNC+RTATVKA + S +W ++R  F+TIM +T   RH E  TFLR+V +L  L E  L ++ D LEV+ + K E I+++GE  N FFII  G   VTQ      Q +EI+TL  GD+FGE+AL+S  +R+A++   E++T+ L + R  F ++VG   EL    K   G+    DER       Q++  P    +S  +      PA  PF +++ I TLG+GGFGRV LVKLK  E  +FALKC+KK+H+V  +QQ H+ SEK IL + +SSFI RLF+TF+D KY+Y+L+EVCLGGELW+VLRD + F++ T RFC+ CV+EAF+YLH   IIYRDLKPENLL+   +GY+K+ DFGFAK++  G+KTWTFCGTPEYVAPE+I+NK HD  AD WSLGIL +ELL G PPFS SDP+KIY+M+L G++ +D    K++  +    I +LC  +P ER+GN +NG  DIK HK+FQG++WE L+  K+ SP   +++   D SNFD +P   + APDE SGWD DF
Sbjct:   33 PHLDSDILRVRITYLETELARRNQEFQTQELQLRRLQKELETKVSQIEKLQDAIHSHQTVGLSPTALCHHSCRHFSAINQGRFHKVAVEVHRRLRAKEGVSAEPPSADNFLWRYRPSSVSTARTVHKNSD--TKRLINEAILSNDFLKKLEPQHMREMVDCMYEKVYSEGQLVIQEGDAGNYLYVLAEGLLEVIQNGKLLGEMHPGTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQTTQARHQEYFTFLRSVSLLKQLPEEKLGRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVTQSSEGFTQPQEIKTLGVGDYFGERALISEDVRSANIICNENDTQCLVVDRDNFNQMVGTYEELQTYLKEYVGELSKSDERRHFLPHSQQSDSPEAQELSRLRERTARIPANQPFQELEVIATLGMGGFGRVELVKLKD-EESTFALKCIKKKHVVDTRQQQHIYSEKKILQQTNSSFIIRLFRTFRDNKYIYMLLEVCLGGELWTVLRDMSCFEEQTARFCIGCVLEAFDYLHSMGIIYRDLKPENLLLDA-DGYVKMADFGFAKQIGIGRKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILVFELLTGNPPFSGSDPIKIYTMVLHGIDRVDFP--KRIGKRPDDLIRRLCKLNPVERIGNKKNGIMDIKKHKWFQGFNWEGLQGRKLPSPLKRELRGPMDHSNFDMFPPNSEEAPDELSGWDKDF 768          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 326/697 (46.77%), Postives = 444/697 (63.70%), Query Frame = 2
Query:  122 INQLIEEVKQ-------LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVH-----HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQK-IPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEI-DNAPDENSGWDADF 2170
            + + IEE++Q       L+ E   KDE I+ LQ+ +DK R+V+  +    + +        N L E+  +R+K+  +SAE  T+  + +  H     + K   +K+LIK A+L N  +++LE  QI EIV+CMY  +   +S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATVK   +  +W IDR  F+TIM +T   +H E   FL++VP   DL E  L+KLAD+LE   Y+  E I++QG   + FFII  G   VT++ +PN  +   +R+L  GD+FGEKAL    +RTASV AAE  T  L + R  F  L+G L  +    + D +       A    E   + F     +D   I TLGVGGFGRV LV+LK  E+++FA+K +KK HIV  +QQ H+ SEK I+ E  S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  F+D TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL +ELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE L+K  +  P  P +    D SNFD++PE+  D  PD+NSGWD DF
Sbjct:   11 LQEKIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQ--------NELHEQ--QRTKRQAISAEP-TAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPN-GEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAEAVT-CLVIDRDSFKHLIGGLEDVSSKGHDDAD-------AKAKYEAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVTSPVDTSNFDSFPEDNEDPPPDDNSGWDVDF 684          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:101158535])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 301/643 (46.81%), Postives = 414/643 (64.39%), Query Frame = 2
Query:  308 KRSKKHGVSAEAWTSTKMA---EPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKK--------INYGDDERF----------QDFQKALPPVEPRVSDFKPA-PFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            ++  K GVSAE  +S+      E     KD + K L+ +AL KN  L+ LE +QI ++VECMYE+       VI++G   N+L+V+  GK +VF+    ++ I   T FGELA+LYNC RTA+V+A      W +DR  F+ IMR+T   RH + + FLR+V +L +L +  L+K+ D LEV+ Y K E I+++GE  + F+II  G   VTQ        + I  L  GD+FGEKAL+S  +R+A++ A ++  E L + R  F + VG  + ++K        ++  D +R           Q        ++  VS F  + PF  ++ I TLGVGGFGRV LVK+KG E  +FALK +KK+H+V+ KQ+ H+ SE+ IL E  S FI RL++TFKD+KYVY+L+E CLGGE+WS+LRDR  FDD T +FC+ CV EAFEYLH + ++YRDLKPENLL+  E GY+KL DFGFAK++ +G+KTWTFCGTPEYVAPEIILNK H+ S D W+LGIL +ELL G PPFS SD M IY+ ILKG+E +D    K +S +    I +LC ++P ERLGN +NG  DIK H++F G++WE L+   + SP   ++K   D S FD+YP + D+ PDE SGWD DF
Sbjct:  131 RKGAKSGVSAEPTSSSLQKFSFEKARVPKDASVKKLLTDALNKNQYLRRLELQQIKDMVECMYERNYQQGECVIKQGEPGNHLFVLAEGKLEVFQHNKLLTWITVWTTFGELAILYNCTRTASVRAVNKVKTWALDREAFQNIMRRTAETRHEQYRNFLRSVSLLANLPDDKLSKIVDCLEVEYYDKGEYIIREGEEGSTFYIIAQGKVKVTQTTEAHKLPQIINALQKGDYFGEKALVSDDVRSANIIADDNGVECLVIDRETFDQTVGNFNELQKHLQGYVASLDRDDKKRHLKKSVSRHQSQSLSPGFMQLKDMVSLFTSSRPFHHLEVIATLGVGGFGRVELVKVKG-EDVTFALKAIKKKHVVENKQEEHIHSERRILAEARSPFIVRLYRTFKDSKYVYMLLEACLGGEVWSLLRDRGSFDDPTAKFCIGCVTEAFEYLHRKGVLYRDLKPENLLLDME-GYVKLVDFGFAKKIRSGQKTWTFCGTPEYVAPEIILNKGHNFSVDFWALGILVFELLTGSPPFSGSDQMTIYTFILKGIEKMDFP--KMISKRPEDLIRKLCRRNPSERLGNLKNGITDIKKHRWFTGFNWEGLKARTLASPLKRELKGPMDHSYFDSYPPDEDSPPDELSGWDEDF 769          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 531.176 bits (1367), Expect = 5.037e-180
Identity = 309/666 (46.40%), Postives = 423/666 (63.51%), Query Frame = 2
Query:  122 INQLIEEVKQ-------LKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVH-----HNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQK-IPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKI 2080
            + + IEE++Q       L+ E   KDE I+ LQ+ +DK R+V+  +    + +        N L E+  +R+K+  +SAE  T+  + +  H     + K   +K+LIK A+L N  +++LE  QI EIV+CMY  +   +S +I+EG   + +YV+  GK +V +E  K+  +     FGELA+LYNC RTATVK   +  +W IDR  F+TIM +T   +H E   FL++VP   DL E  L+KLAD+LE   Y+  E I++QG   + FFII  G   VT++ +PN  +   +R+L  GD+FGEKAL    +RTASV AAE  T  L + R  F  L+G L  +    + D +       A    E   + F     +D   I TLGVGGFGRV LV+LK  E+++FA+K +KK HIV  +QQ H+ SEK I+ E  S FI RL++TFKD+KY+Y+LME CLGGELW++LRDR  F+D TTRF  +CVVEAF YLH + IIYRDLKPENL++    GY KL DFGFAK++  GKKTWTFCGTPEYVAPEIILNK HD SAD WSLGIL +ELL G PPFS  DPMK Y++IL+G++ I+    KK++  A + I +LC  +P ERLGN +NG +DI+ HK+F+G++WE L+K  +  P  P +
Sbjct:   11 LQEKIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQ--------NELHEQ--QRTKRQAISAEP-TAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPN-GEPVYLRSLGKGDWFGEKALQGEDIRTASVIAAEAVT-CLVIDRDSFKHLIGGLEDVSSKGHDDAD-------AKAKYEAENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILD-HRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEFP--KKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNV 653          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: ENSORLT00000001298.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 529.25 bits (1362), Expect = 1.091e-178
Identity = 315/742 (42.45%), Postives = 434/742 (58.49%), Query Frame = 2
Query:   74 PSIKSDVISNNVN-----VADINQLIE----EVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFF-----KRSKKHGVSAEA-------W----TSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVG---ELHAIKKINYGD----DER---FQDFQKALPPVEPRVSDFK------PA--PFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            P + SD++   +      +A  NQ  +    ++++L+ E + K  +I++LQ  I   + V      L ++    F+        K       +   K GVSAE        W    +S   A  VH N D   K LI  A+L N  L+ LE + + E+V+CMYEK  +    VI+EG   N LYV+  G  +V +    + E++  TAFGELA+LYNC+RTATVKA + S +W ++R  F+TIM +T   RH E  TFLR+V +L  L E  L ++ D LEV+ + K E I+++GE  N FFII  G   VTQ      Q +EI+TL  GD+FGE+AL+S  +R+A++   E++T+ L + R  F ++VG   EL    K   G+    DER       Q++  P    +S  +      PA  PF +++ I TLG+GGFGRV LVKLK  E  +FALKC+KK+H+V  +QQ H+ SEK IL + +SSFI RLF+TF+D KY+Y+L+EVCLGGELW+VLRD + F++ T RFC+ CV+EAF+YLH   IIYRDLKPENLL+   +GY+K+ DFGFAK++  G+KTWTFCGTPEYVAPE+I+NK HD  AD WSLGIL +ELL G                             KL              +P ER+GN +NG  DIK HK+FQG++WE L+  K+ SP   +++   D SNFD +P   + APDE SGWD DF
Sbjct:   33 PHLDSDILRVRITYLETELARRNQEFQTQELQLRRLQKELETKVSQIEKLQDAIHSHQTVGLSPTALCHHSCRHFSAINQGRFHKVAVEVHRRLRAKEGVSAEPPSADNFLWRYRPSSVSTARTVHKNSD--TKRLINEAILSNDFLKKLEPQHMREMVDCMYEKVYSEGQLVIQEGDAGNYLYVLAEGLLEVIQNGKLLGEMHPGTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQTTQARHQEYFTFLRSVSLLKQLPEEKLGRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVTQSSEGFTQPQEIKTLGVGDYFGERALISEDVRSANIICNENDTQCLVVDRDNFNQMVGTYEELQTYLKEYVGELSKSDERRHFLPHSQQSDSPEAQELSRLRERTARIPANQPFQELEVIATLGMGGFGRVELVKLKD-EESTFALKCIKKKHVVDTRQQQHIYSEKKILQQTNSSFIIRLFRTFRDNKYIYMLLEVCLGGELWTVLRDMSCFEEQTARFCIGCVLEAFDYLHSMGIIYRDLKPENLLLDA-DGYVKMADFGFAKQIGIGRKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILVFELLTG-----------------------------KL--------------NPVERIGNKKNGIMDIKKHKWFQGFNWEGLQGRKLPSPLKRELRGPMDHSNFDMFPPNSEEAPDELSGWDKDF 727          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000052811.1 (SMESG000052811.1)

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 393/393 (100.00%), Postives = 393/393 (100.00%), Query Frame = 2
Query:   68 MKPSIKSDVISNNVNVADINQLIEEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKT 1246
            MKPSIKSDVISNNVNVADINQLIEEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKT
Sbjct:    1 MKPSIKSDVISNNVNVADINQLIEEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKT 393          

HSP 2 Score: 266.544 bits (680), Expect = 2.337e-80
Identity = 124/139 (89.21%), Postives = 128/139 (92.09%), Query Frame = 2
Query: 1595 YRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHK 2011
            + D++    L  G  G + LCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHK
Sbjct:  385 FSDIQKIKTLGVGGFGRVFLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHK 523          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000052811.1 (SMESG000052811.1)

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 368/368 (100.00%), Postives = 368/368 (100.00%), Query Frame = 2
Query:   68 MKPSIKSDVISNNVNVADINQLIEEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQK 1171
            MKPSIKSDVISNNVNVADINQLIEEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQK
Sbjct:    1 MKPSIKSDVISNNVNVADINQLIEEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQK 368          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000008788.1 (SMESG000008788.1)

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 358/695 (51.51%), Postives = 485/695 (69.78%), Query Frame = 2
Query:   95 ISNNVNVADINQLIEEVKQLKNESKIKDEKIKELQSVIDKLRAVLDQSH-PLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPV--EPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            I + +   +I  L  ++K  + E   K+ +I+ELQ  I+KL +VLDQ+   L +N  +      NS++     RSKK GVS E+       + + + K  + K+L++ ++LKN LL +L   Q+ E++E MYE++I     VI EG E ++LYV  SG F+V++ +  +  ++    FGELALLYNCRRTA+VKA  D+ +WV+DR +F+ IM +T  +R  EL  FL++VP+L  L E  L KL +LLE+Q + + ECI++QGE+A+CFFIIQSGS  VTQ+     +E+ IRTL  G++FGEKALLS   RTA+VYA    T++LCLYR  FLEL+G+L+ +K  NY D++       +   +  +  +         D++ + TLGVGGFGRV LV+L      ++ALKCMKK HIV+ KQQ HV+SEK ILLE  S FICRL+ TFKD K+VY+LMEVCLGGELW+ LRD+  FDD+ T+FCL CV+EAF+YLH R IIYRDLKPENLLI+  +GYLKLCDFGFAKR+  GK+TWTFCGTPEYV+PEIILNKSHD ++D WS+GILTYELL G PPF+ +DPMKIY++ILKG+E+ D+ HN++++ +A SFI  LC  +  ERLGNG  G ++IKSHKYFQG+DWE +RK  + SPF PK+  + D SNFD + +E +  PDE SGWD +F
Sbjct:  179 IGDEIYEMEIENLRNQLKLTQEELNEKNIRIEELQREINKLTSVLDQTQISLESNDMISSV---NSIQ----NRSKKQGVSGESNKDQTNLKLIKYKKSNSIKSLLRESILKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEKHLLSKSSSKVSICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLIT-TSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEEF 863          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000007783.1 (SMESG000007783.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 365/721 (50.62%), Postives = 483/721 (66.99%), Query Frame = 2
Query:   23 NFQSLCINF*IIFFDMKPSIKSDVISNNVN-VADINQLIEE--VKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAEPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKEIRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPF--SDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            N ++L I +    +   P IK    SN +N V+++     E  ++  K E   K+ KI+ELQ  IDKL++VLDQ+H       + F    +SL +    RSK+ G+S E+    +        K    K +I+ A++ NHLL  L+  Q+ EI+ECMYEK    N  VI EG E   LYV   G+F+V++++  I +++ +  FGELALLYNC+RTA+VKA     +WV+DR +F+TIM KT  +R  +L+TFL +V +   L+E  L K+ +L+EVQ YS  +CI++QGE A+ FFII++G   VTQKI     E E+R + +G++FGEKALL  G RTA++YA +  TE+LCLYR  F EL+GEL+ ++   Y D+ R +             ++ K   F  +D + + TLG GGFGRV LV       +S+ALK MKK++IV+ KQQ HV+SEK ILLE  SS+ICRL+ TF D KYVYLL EVCLGGELW++LRDR  FDD  T FCL+CV+EA  YLH R I+YRDLKPENLL+ G +GYLKLCDFGFAK++  G +TWTFCGTPEYVAPEIILNKSHD S D WS+GILTYELLNG PPF A+DPMKIY+M LKG+E  ++ HN K++ KA S I +LC   P ERLGNG+NG ++I+ HKYFQG+DWE ++ + +KSPF+PKI    D SNFD +  E D  PDENSGWD DF
Sbjct:    5 NSKNLNIEYQRKLYGPDPKIKLMNSSNKLNSVSNVEAEKHESLLRAAKREIDEKNLKIEELQREIDKLKSVLDQTHS-----DLSFDHDSSSLND-IKARSKRLGISGESSNHQRFQTLNKFPKSNEVKKVIRQAIMNNHLLNKLDPSQVNEIIECMYEKHAVENCYVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGELNVLQAKEYDDESRAKMSLSMHSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITSFCLACVLEALSYLHSRGIVYRDLKPENLLV-GNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPIDTSNFDKFTNESDIPPDENSGWDKDF 716          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000016927.1 (SMESG000016927.1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 319/699 (45.64%), Postives = 450/699 (64.38%), Query Frame = 2
Query:  113 VADINQLIEE-------VKQLKNESKIKDEKIKELQSVIDKLRAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMA--EPVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNVIEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTATVKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANLTKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQK-IPNLDQEKE--IRTLLAGDFFGEKALLSGGLRTASVYAAE-HNTEILCLYRPGFLELVGELHAIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTXXXXXXXXXXXXKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFICRLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAFEYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGTPEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMILKGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYFQGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDADF 2170
            V  INQL +E       VK+L+   + KDEKI EL S +DK ++V   +    NN Q G              R +  G+SAE  T+ K+A  +P    KD   K LIK ++L+N  +++LEQ QI  IV+CM   K  ANS +I+EG   + +YV+  GK  V +E   + E+  ET FGELA+LYNC RTATV A  D  +W IDR  F++IM +T   ++ E   FL++VPI  DL E+ L K++ +LE   Y+  + I++QG   + FFII SG   VT+K  P+  +EKE  IR +  G++FGEKAL    LRTA++ AA+    + L L R  +++L+G+L ++++    +D      ++ L P +    ++K     D+  I TLG+GGFGRV LV++     +++ALK +KK HIV+ +QQ H+++E+NIL  + S FI RL +TFKD K++Y+LMEVCLGGELWS+LRDR+ FD+ TT+F  +CV+EA  YLH R I+YRDLKPENLL+  + G+ K+ DFGFAK++  G+KTWTFCGTPEYVAPEIILNK HD+ AD WSLGIL +ELL GMPPF+A DPMKIY++ILKG+++I+    KK+S  A + I +LC  +P ER+G G+ G ++ + H + + ++W+ L    +K P  P+I    D SNFD YP E +  PD+ SGWD DF
Sbjct:    2 VISINQLQQELIKKDEYVKKLEKLLQQKDEKIAELTSQLDKYQSVFSATQK-QNNVQSG--------PHNNQTRVRGLGISAEPQTA-KIANFQPSFFQKDSKTKELIKRSILENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTKEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQRTY--EDGVNDSPKEILGPSK----EYKNLALKDLVVIATLGIGGFGRVELVQIGDNAKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQ-GFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFP--KKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 681          
The following BLAST results are available for this feature:
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKG20.000e+045.28protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG20.000e+045.28protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG10.000e+046.84protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
PRKG20.000e+043.97protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG10.000e+046.71protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-40.000e+045.15cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+045.15cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+045.15cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+045.15cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+043.40cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkg21D0.000e+046.60gene:FBgn0000442 transcript:FBtr0078042[more]
for0.000e+043.86gene:FBgn0000721 transcript:FBtr0446099[more]
for1.829e-17643.86gene:FBgn0000721 transcript:FBtr0089310[more]
for1.829e-17643.86gene:FBgn0000721 transcript:FBtr0089312[more]
for1.829e-17643.86gene:FBgn0000721 transcript:FBtr0089304[more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg1b0.000e+046.70protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1b0.000e+046.35protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1a0.000e+045.15protein kinase cGMP-dependent 1a [Source:ZFIN;Acc:... [more]
prkg20.000e+044.28protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkg20.000e+044.28protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnpo20.000e+045.25transportin 2 [Source:Xenbase;Acc:XB-GENE-968452][more]
camk40.000e+046.55calcium/calmodulin-dependent protein kinase IV [So... [more]
camk40.000e+046.55calcium/calmodulin-dependent protein kinase IV [So... [more]
camk40.000e+045.91calcium/calmodulin-dependent protein kinase IV [So... [more]
ptafr0.000e+046.08platelet activating factor receptor [Source:Xenbas... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkg20.000e+045.42protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg10.000e+046.70protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg20.000e+044.11protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg10.000e+046.56protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg12.745e-11251.44protein kinase, cGMP-dependent, type I [Source:MGI... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O76360|EGL4_CAEEL0.000e+045.15cGMP-dependent protein kinase egl-4 OS=Caenorhabdi... [more]
sp|A8X6H1|EGL4_CAEBR0.000e+044.94cGMP-dependent protein kinase egl-4 OS=Caenorhabdi... [more]
sp|Q61410|KGP2_MOUSE0.000e+045.56cGMP-dependent protein kinase 2 OS=Mus musculus OX... [more]
sp|Q13237|KGP2_HUMAN0.000e+045.28cGMP-dependent protein kinase 2 OS=Homo sapiens OX... [more]
sp|Q64595|KGP2_RAT0.000e+044.99cGMP-dependent protein kinase 2 OS=Rattus norvegic... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q6USR90.000e+047.69cGMP-dependent protein kinase OS=Aplysia californi... [more]
V3Z9120.000e+051.60cGMP-dependent protein kinase OS=Lottia gigantea O... [more]
A0A5N4A4B00.000e+046.68Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A182E2680.000e+046.97cGMP-dependent protein kinase OS=Onchocerca ocheng... [more]
A0A044T9L70.000e+046.97cGMP-dependent protein kinase OS=Onchocerca volvul... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000002114.20.000e+049.30cGMP-dependent protein kinase 2-like [Source:NCBI ... [more]
prkg20.000e+046.48protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg20.000e+045.44protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg1b0.000e+045.91protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg26.848e-17645.11protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002200.11.458e-11753.24pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 ... [more]
ENSPMAT00000002201.11.038e-9348.61pep scaffold:Pmarinus_7.0:GL479132:31244:36797:-1 ... [more]
ENSPMAT00000001814.12.204e-7344.53pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
stk38l2.228e-4730.74serine/threonine kinase 38 like [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000006766.12.366e-4735.56pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK23.108e-7041.03cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK33.786e-6642.12cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK15.312e-6440.29cAMP-dependent protein kinase catalytic subunit; p... [more]
YPK24.283e-4835.34Protein kinase similar to S/T protein kinase Ypk1p... [more]
YPK19.127e-4834.63S/T protein kinase; phosphorylates, downregulates ... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO384070.000e+047.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383990.000e+046.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352282.146e-7344.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318955.041e-5537.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411663.989e-5237.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001302.20.000e+044.61cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
prkg10.000e+046.77protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
prkg20.000e+046.81protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg15.037e-18046.40protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
ENSORLT00000001298.21.091e-17842.45cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052811.12.337e-80100.00SMESG000052811.1[more]
SMESG000052811.10.000e+0100.00SMESG000052811.1[more]
SMESG000008788.10.000e+051.51SMESG000008788.1[more]
SMESG000007783.10.000e+050.62SMESG000007783.1[more]
SMESG000016927.10.000e+045.64SMESG000016927.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008534 ID=SMED30008534|Name=cGMP-dependent protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2231bp
CACATGAAATTCGTATCACTTGAATTTCCAATCGTTATGCATTAATTTTT
AGATTATTTTTTTCGACATGAAACCTTCCATTAAATCAGACGTTATTTCT
AACAACGTTAATGTTGCGGATATAAACCAATTAATTGAAGAAGTGAAACA
ATTGAAAAATGAAAGCAAAATTAAAGATGAAAAAATTAAAGAATTACAGT
CCGTTATCGATAAATTGCGAGCTGTACTTGATCAGTCCCATCCTTTGTCG
AACAATCGGCAGGTTGGCTTTACTGTCGGTGGAAATAGTTTAAAGGAAAA
ATTTTTTAAACGATCTAAAAAGCATGGAGTTTCAGCTGAAGCGTGGACTA
GTACCAAAATGGCCGAACCAGTTCACCATAACAAAGACTTTACGGCTAAA
AATCTGATAAAAAATGCACTATTAAAAAATCATCTGTTGCAGCATCTGGA
GCAAAAACAAATTGCAGAAATTGTCGAGTGTATGTATGAGAAAAAAATTA
CAGCAAATTCCAATGTAATCGAGGAAGGCTCGGAGGCCAACAATCTTTAT
GTAGTACATTCCGGAAAATTTGATGTCTTCAGAGAAAAGACTAAAATATC
GGAAATTAATAAAGAGACAGCGTTTGGAGAATTAGCACTTTTATACAATT
GCAGAAGGACAGCGACTGTGAAAGCCTGCGTCGACTCGGTTGTCTGGGTG
ATAGATCGTCCCTTATTCCGAACAATCATGAGGAAGACATACAGCAAACG
TCATGCGGAATTGCAGACTTTTCTTAGAAATGTACCTATTTTAATGGATC
TCACAGAAGCTAATCTCACAAAACTGGCAGATTTGCTAGAAGTTCAAGTT
TATTCAAAAAGAGAATGCATTTTAAAGCAAGGAGAAACAGCGAATTGTTT
TTTCATAATTCAATCAGGCTCAGCAATCGTAACACAGAAGATTCCCAATC
TTGATCAAGAAAAGGAAATAAGAACTTTACTTGCTGGAGATTTCTTTGGC
GAAAAAGCTCTTCTTAGCGGTGGACTTCGTACTGCATCTGTTTATGCAGC
TGAACATAATACGGAAATTCTGTGTCTTTATCGTCCAGGATTTTTAGAAT
TAGTCGGCGAATTGCACGCCATCAAGAAAATTAATTATGGAGATGATGAA
CGTTTTCAAGATTTTCAGAAGGCATTGCCTCCGGTTGAACCCCGAGTATC
AGATTTTAAACCTGCACCTTTTTCCGATATTCAAAAAATCAAAACTCTTG
GAGTTGGTGGATTTGGAAGAGTATTTCTGGTGAAATTAAAGGGAATGGAA
CACCAATCGTTTGCTTTAAAATGTATGAAAAAAGAACATATTGTCAAAAT
GAAACAACAAACACACGTTTTATCGGAGAAAAATATATTATTGGAACTTT
CATCATCATTTATCTGCAGACTTTTCCAAACATTCAAAGACACAAAATAC
GTTTACCTATTGATGGAGGTCTGCCTCGGCGGTGAATTGTGGAGTGTTTT
ACGTGACAGAGCATTCTTTGACGATATGACAACGAGGTTTTGCTTAAGTT
GTGTTGTTGAAGCATTTGAATATCTTCATGGAAGAAATATTATTTATCGA
GATTTGAAGCCAGAGAATCTTTTGATTTCGGGAGAAAATGGATATTTAAA
ATTGTGCGATTTTGGTTTCGCGAAGAGACTAGAAAATGGAAAGAAGACTT
GGACATTTTGTGGAACTCCTGAATACGTTGCACCTGAAATTATTCTTAAT
AAAAGTCACGATTCATCAGCTGATTTATGGTCATTAGGAATATTAACTTA
TGAATTGCTCAATGGAATGCCTCCATTTTCCGCCTCCGACCCGATGAAAA
TTTATTCAATGATATTAAAGGGTTTAGAATCCATAGATATGACGCATAAT
AAAAAACTTTCTCCAAAAGCGATCAGTTTTATTACACAGCTGTGCTGTAA
AAGTCCTCCTGAACGATTAGGAAATGGAAGAAATGGATTTCAGGACATCA
AATCTCATAAATATTTTCAAGGGTATGATTGGGAAAAATTACGAAAATTG
AAAATGAAATCTCCATTCAGTCCAAAAATCAAAGATGCATTTGATGGTTC
AAATTTTGATGCTTATCCAGAAGAAATAGATAACGCTCCTGATGAAAATT
CTGGGTGGGATGCTGATTTTTAGATTCTACCAACCCAGAACTATATATTT
AAATTAATATTTTTCAATATTAATTTCGTTC
back to top

protein sequence of SMED30008534-orf-1

>SMED30008534-orf-1 ID=SMED30008534-orf-1|Name=SMED30008534-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=702bp
MKPSIKSDVISNNVNVADINQLIEEVKQLKNESKIKDEKIKELQSVIDKL
RAVLDQSHPLSNNRQVGFTVGGNSLKEKFFKRSKKHGVSAEAWTSTKMAE
PVHHNKDFTAKNLIKNALLKNHLLQHLEQKQIAEIVECMYEKKITANSNV
IEEGSEANNLYVVHSGKFDVFREKTKISEINKETAFGELALLYNCRRTAT
VKACVDSVVWVIDRPLFRTIMRKTYSKRHAELQTFLRNVPILMDLTEANL
TKLADLLEVQVYSKRECILKQGETANCFFIIQSGSAIVTQKIPNLDQEKE
IRTLLAGDFFGEKALLSGGLRTASVYAAEHNTEILCLYRPGFLELVGELH
AIKKINYGDDERFQDFQKALPPVEPRVSDFKPAPFSDIQKIKTLGVGGFG
RVFLVKLKGMEHQSFALKCMKKEHIVKMKQQTHVLSEKNILLELSSSFIC
RLFQTFKDTKYVYLLMEVCLGGELWSVLRDRAFFDDMTTRFCLSCVVEAF
EYLHGRNIIYRDLKPENLLISGENGYLKLCDFGFAKRLENGKKTWTFCGT
PEYVAPEIILNKSHDSSADLWSLGILTYELLNGMPPFSASDPMKIYSMIL
KGLESIDMTHNKKLSPKAISFITQLCCKSPPERLGNGRNGFQDIKSHKYF
QGYDWEKLRKLKMKSPFSPKIKDAFDGSNFDAYPEEIDNAPDENSGWDAD
F*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035014STKc_cGK
IPR000595cNMP-bd_dom
IPR000961AGC-kinase_C
IPR000719Prot_kinase_dom
IPR014710RmlC-like_jellyroll
IPR002374cGMP_dep_kinase
IPR008271Ser/Thr_kinase_AS
IPR018488cNMP-bd_CS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
IPR018490cNMP-bd-like
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0004692cGMP-dependent protein kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0030553cGMP binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 12..46
NoneNo IPR availablePRINTSPR00103CAMPKINASEcoord: 144..158
score: 26.44
coord: 159..173
score: 40.22
coord: 342..354
score: 32.56
coord: 308..317
score: 63.67
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 473..675
e-value: 3.1E-102
score: 343.4
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 386..681
e-value: 3.1E-102
score: 343.4
NoneNo IPR availablePANTHERPTHR24353CYCLIC NUCLEOTIDE-DEPENDENT PROTEIN KINASEcoord: 18..701
NoneNo IPR availablePANTHERPTHR24353:SF90coord: 18..701
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 388..650
e-value: 3.8E-82
score: 288.9
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 389..650
e-value: 1.3E-70
score: 237.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 388..650
score: 44.739
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 651..701
e-value: 3.5E-6
score: 36.5
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 651..701
score: 12.242
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 123..236
e-value: 3.5E-19
score: 79.7
coord: 241..364
e-value: 1.2E-20
score: 84.6
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 260..346
e-value: 1.6E-16
score: 60.2
coord: 142..223
e-value: 1.9E-14
score: 53.5
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 241..363
score: 25.754
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 123..238
score: 31.516
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 241..357
e-value: 5.88008E-23
score: 92.3889
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 123..223
e-value: 1.37125E-24
score: 97.0113
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 93..227
e-value: 4.6E-40
score: 138.4
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 228..357
e-value: 1.1E-33
score: 117.7
IPR002374cGMP-dependent kinasePIRSFPIRSF000559cGMP-dep_kinasecoord: 2..701
e-value: 1.6E-265
score: 880.5
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 394..418
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 310..327
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 186..203
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 508..520
IPR035014cGMP-dependent protein kinase, catalytic domainCDDcd05572STKc_cGKcoord: 394..657
e-value: 3.15519E-151
score: 437.427
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 376..689
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 231..361
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 106..223