Protein CobW

Overview
NameProtein CobW
Smed IDSMED30008524
Length (bp)1518
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein CobW (SMED30008524) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein CobW (SMED30008524) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein CobW (SMED30008524) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein CobW (SMED30008524) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Protein CobW vs. Ensembl Human
Match: CBWD1 (COBW domain containing 1 [Source:HGNC Symbol;Acc:HGNC:17134])

HSP 1 Score: 219.935 bits (559), Expect = 5.978e-68
Identity = 104/171 (60.82%), Postives = 133/171 (77.78%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K++AVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G++A+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGI+T+VD  Y    L E + DG INE  RQ++LAD I+ NKTDL+   D++  +  IR
Sbjct:   51 LGAGKTTLLNYILTEQHSKRVAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADAILINKTDLVPEEDVKKLRTTIR 221          
BLAST of Protein CobW vs. Ensembl Human
Match: CBWD2 (COBW domain containing 2 [Source:HGNC Symbol;Acc:HGNC:17907])

HSP 1 Score: 224.172 bits (570), Expect = 7.982e-68
Identity = 106/171 (61.99%), Postives = 135/171 (78.95%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K++AVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G++A+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGI+T+VD  Y    LAE + DG INE  RQ++LAD I+ NKTDL+   D++  +A IR
Sbjct:   51 LGAGKTTLLNYILTEQHSKRVAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLAEEKPDGLINEATRQVALADAILINKTDLVPEEDVKKLRATIR 221          
BLAST of Protein CobW vs. Ensembl Human
Match: CBWD2 (COBW domain containing 2 [Source:HGNC Symbol;Acc:HGNC:17907])

HSP 1 Score: 223.787 bits (569), Expect = 1.664e-67
Identity = 106/171 (61.99%), Postives = 135/171 (78.95%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K++AVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G++A+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGI+T+VD  Y    LAE + DG INE  RQ++LAD I+ NKTDL+   D++  +A IR
Sbjct:   51 LGAGKTTLLNYILTEQHSKRVAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLAEEKPDGLINEATRQVALADAILINKTDLVPEEDVKKLRATIR 221          
BLAST of Protein CobW vs. Ensembl Human
Match: CBWD1 (COBW domain containing 1 [Source:HGNC Symbol;Acc:HGNC:17134])

HSP 1 Score: 221.09 bits (562), Expect = 6.531e-67
Identity = 104/173 (60.12%), Postives = 134/173 (77.46%), Query Frame = 3
Query:   51 ILLGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            +L G+GKTTLLNYIL E H K++AVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G++A+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGI+T+VD  Y    L E + DG INE  RQ++LAD I+ NKTDL+   D++  +  IR
Sbjct:   13 LLTGAGKTTLLNYILTEQHSKRVAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADAILINKTDLVPEEDVKKLRTTIR 185          
BLAST of Protein CobW vs. Ensembl Human
Match: CBWD1 (COBW domain containing 1 [Source:HGNC Symbol;Acc:HGNC:17134])

HSP 1 Score: 220.705 bits (561), Expect = 1.354e-66
Identity = 104/171 (60.82%), Postives = 133/171 (77.78%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K++AVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G++A+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGI+T+VD  Y    L E + DG INE  RQ++LAD I+ NKTDL+   D++  +  IR
Sbjct:   51 LGAGKTTLLNYILTEQHSKRVAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADAILINKTDLVPEEDVKKLRTTIR 221          
BLAST of Protein CobW vs. Ensembl Zebrafish
Match: cbwd (COBW domain containing [Source:ZFIN;Acc:ZDB-GENE-040426-2388])

HSP 1 Score: 217.624 bits (553), Expect = 1.217e-65
Identity = 105/171 (61.40%), Postives = 133/171 (77.78%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K+IAVILNEFG GS++E +  +  +G LYEEWLEL NGCLCCS+KD G+KA+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGIVTV+D  Y    L E + +G INE  RQI+LAD+ I NKTDL+   ++   +  +R
Sbjct:   33 LGAGKTTLLNYILTEQHNKRIAVILNEFGEGSALEKSLAVSQAGELYEEWLELRNGCLCCSVKDNGLKAIENLMEKKGKFDYILLETTGLADPGAVASMFWVDAELGSDVYLDGIVTVIDAKYGLQHLTEEKPEGLINEAARQIALADLTIINKTDLVHETELLKLRDTVR 203          
BLAST of Protein CobW vs. Ensembl Zebrafish
Match: cbwd (COBW domain containing [Source:ZFIN;Acc:ZDB-GENE-040426-2388])

HSP 1 Score: 194.512 bits (493), Expect = 4.946e-57
Identity = 98/171 (57.31%), Postives = 124/171 (72.51%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K+IAVILNEFG GS++E +  +  +G LYEEWLEL NGCLCCS+KD G+KA+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGIVTV+D  Y                   QI+LAD+ I NKTDL+   ++   +  +R
Sbjct:   33 LGAGKTTLLNYILTEQHNKRIAVILNEFGEGSALEKSLAVSQAGELYEEWLELRNGCLCCSVKDNGLKAIENLMEKKGKFDYILLETTGLADPGAVASMFWVDAELGSDVYLDGIVTVIDAKYG-----------------LQIALADLTIINKTDLVHETELLKLRDTVR 186          
BLAST of Protein CobW vs. Ensembl Xenopus
Match: cbwd2 (COBW domain containing 1, gene 2 [Source:NCBI gene;Acc:496702])

HSP 1 Score: 216.083 bits (549), Expect = 8.842e-65
Identity = 102/159 (64.15%), Postives = 129/159 (81.13%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLIS 530
            LG+GKTTLLNYIL E H K+IAVI+NEFG GS++E +  +  +G LYEEWLEL NGCLCCS+KD G+KA+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGIV+VVD  Y    L E + +  INE  RQ++LADV+I NKTDL++
Sbjct:   77 LGAGKTTLLNYILTEQHNKRIAVIINEFGEGSAVEKSLAISQAGELYEEWLELRNGCLCCSVKDNGLKAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIVSVVDAKYALKHLQEEKPESLINEAARQVALADVLIINKTDLVA 235          
BLAST of Protein CobW vs. Ensembl Xenopus
Match: cbwd2 (COBW domain containing 1, gene 2 [Source:NCBI gene;Acc:496702])

HSP 1 Score: 216.468 bits (550), Expect = 1.095e-64
Identity = 102/159 (64.15%), Postives = 129/159 (81.13%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLIS 530
            LG+GKTTLLNYIL E H K+IAVI+NEFG GS++E +  +  +G LYEEWLEL NGCLCCS+KD G+KA+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGIV+VVD  Y    L E + +  INE  RQ++LADV+I NKTDL++
Sbjct:   77 LGAGKTTLLNYILTEQHNKRIAVIINEFGEGSAVEKSLAISQAGELYEEWLELRNGCLCCSVKDNGLKAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIVSVVDAKYALKHLQEEKPESLINEAARQVALADVLIINKTDLVA 235          
BLAST of Protein CobW vs. Ensembl Xenopus
Match: cbwd2 (COBW domain containing 1, gene 2 [Source:NCBI gene;Acc:496702])

HSP 1 Score: 194.126 bits (492), Expect = 3.175e-57
Identity = 97/159 (61.01%), Postives = 122/159 (76.73%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLIS 530
            LG+GKTTLLNYIL E H K+IAVI+NEFG GS++E +  +  +G LYEEWLEL NGCLCCS+KD G+KA+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDG            Q +EI     INE  RQ++LADV+I NKTDL++
Sbjct:   35 LGAGKTTLLNYILTEQHNKRIAVIINEFGEGSAVEKSLAISQAGELYEEWLELRNGCLCCSVKDNGLKAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDG-----------KQTSEIH---LINEAARQVALADVLIINKTDLVA 179          
BLAST of Protein CobW vs. Ensembl Xenopus
Match: cbwd2 (COBW domain containing 1, gene 2 [Source:NCBI gene;Acc:496702])

HSP 1 Score: 192.586 bits (488), Expect = 3.281e-56
Identity = 94/159 (59.12%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLIS 530
            LG+GKTTLLNYIL E H K+IAVI+NEFG GS++E +  +  +G LYEEWLEL NGCLCCS+KD G+KA+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLD                E + +  INE  RQ++LADV+I NKTDL++
Sbjct:   35 LGAGKTTLLNYILTEQHNKRIAVIINEFGEGSAVEKSLAISQAGELYEEWLELRNGCLCCSVKDNGLKAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLD----------------EEKPESLINEAARQVALADVLIINKTDLVA 177          
BLAST of Protein CobW vs. Ensembl Mouse
Match: Cbwd1 (COBW domain containing 1 [Source:MGI Symbol;Acc:MGI:2385089])

HSP 1 Score: 221.861 bits (564), Expect = 6.761e-67
Identity = 105/171 (61.40%), Postives = 135/171 (78.95%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H +KIAVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G++A+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGI+TVVD  Y    L E + DG +NE  RQ++LAD+I+ NKTDL+S  ++ + +  IR
Sbjct:   49 LGAGKTTLLNYILTEQHNRKIAVILNEFGEGSAVEKSLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITVVDSKYGLKHLTEEKPDGLVNEATRQVALADMILINKTDLVSEEELNNLRTTIR 219          
BLAST of Protein CobW vs. UniProt/SwissProt
Match: sp|Q8IUF1|CBWD2_HUMAN (COBW domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CBWD2 PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 7.992e-67
Identity = 106/171 (61.99%), Postives = 135/171 (78.95%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K++AVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G++A+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGI+T+VD  Y    LAE + DG INE  RQ++LAD I+ NKTDL+   D++  +A IR
Sbjct:   51 LGAGKTTLLNYILTEQHSKRVAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLAEEKPDGLINEATRQVALADAILINKTDLVPEEDVKKLRATIR 221          
BLAST of Protein CobW vs. UniProt/SwissProt
Match: sp|Q8VEH6|CBWD1_MOUSE (COBW domain-containing protein 1 OS=Mus musculus OX=10090 GN=Cbwd1 PE=1 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 4.729e-66
Identity = 105/171 (61.40%), Postives = 135/171 (78.95%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H +KIAVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G++A+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGI+TVVD  Y    L E + DG +NE  RQ++LAD+I+ NKTDL+S  ++ + +  IR
Sbjct:   49 LGAGKTTLLNYILTEQHNRKIAVILNEFGEGSAVEKSLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITVVDSKYGLKHLTEEKPDGLVNEATRQVALADMILINKTDLVSEEELNNLRTTIR 219          
BLAST of Protein CobW vs. UniProt/SwissProt
Match: sp|Q99MB4|CBWD1_RAT (COBW domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Cbwd1 PE=2 SV=2)

HSP 1 Score: 221.476 bits (563), Expect = 5.123e-66
Identity = 106/171 (61.99%), Postives = 134/171 (78.36%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H +KIAVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G+KA+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGI+TVVD  Y    L E + DG +NE  RQ++LAD+I+ NKTDL+S  ++   +  IR
Sbjct:   50 LGAGKTTLLNYILTEQHNRKIAVILNEFGEGSAVEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLKAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITVVDSKYGLKHLTEEKPDGLVNEATRQVALADMILINKTDLVSEEELNKLRTTIR 220          
BLAST of Protein CobW vs. UniProt/SwissProt
Match: sp|Q9BRT8|CBWD1_HUMAN (COBW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CBWD1 PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 9.031e-66
Identity = 104/171 (60.82%), Postives = 133/171 (77.78%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K++AVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G++A+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGI+T+VD  Y    L E + DG INE  RQ++LAD I+ NKTDL+   D++  +  IR
Sbjct:   51 LGAGKTTLLNYILTEQHSKRVAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADAILINKTDLVPEEDVKKLRTTIR 221          
BLAST of Protein CobW vs. UniProt/SwissProt
Match: sp|Q5JTY5|CBWD3_HUMAN (COBW domain-containing protein 3 OS=Homo sapiens OX=9606 GN=CBWD3 PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 6.203e-63
Identity = 102/171 (59.65%), Postives = 132/171 (77.19%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K++AVILNE G GS++E +  +   G LYEEWLEL NGCLCCS+KD G++A+E+LM+K+GKFD IL+ETTGLADPG +AS+FW+D  L SD+YLDGI+T+VD  Y    L E + DG INE  RQ++LAD+I+ NKTDL+   D++  +  IR
Sbjct:   51 LGAGKTTLLNYILTEQHSKRVAVILNESGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLRAIENLMQKKGKFDDILLETTGLADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADIILINKTDLVPEEDVKKLRTTIR 221          
BLAST of Protein CobW vs. TrEMBL
Match: A0A210PNU3 (COBW domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08804 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 2.274e-72
Identity = 112/172 (65.12%), Postives = 140/172 (81.40%), Query Frame = 3
Query:   54 LLGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
             LG+GKTTLLNY+L E HGKKIAVI+NEFG G S+E +  +   G LYEEWLEL NGCLCCS+KD GVKA+E+LM K+GKFDY+L+ETTGLADPGPIAS+FWLDE LCSD++LDGI+T+VDG Y    L E ++DG +NE  RQI+LAD+I+ NKTDLIS +++   + +IR
Sbjct:   27 FLGAGKTTLLNYVLSEQHGKKIAVIMNEFGEGESVEKSMSIGQEGELYEEWLELRNGCLCCSVKDNGVKAIENLMTKKGKFDYVLLETTGLADPGPIASIFWLDEELCSDIFLDGIITMVDGKYCSQHLKEKKEDGSVNEATRQIALADIIVLNKTDLISDIELDSLKQQIR 198          
BLAST of Protein CobW vs. TrEMBL
Match: X2AWY7 (cobW domain-containing protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 4.194e-72
Identity = 114/172 (66.28%), Postives = 141/172 (81.98%), Query Frame = 3
Query:   54 LLGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
             LG+GKTTLLNYIL E HGKKIAVILNEFG GS+IE +  +  SG L+EEWLEL NGCLCCS+KDVGVKA+E+LM K+GKFDYIL+ETTGLADPGPIAS+FWLDE LC DL+LDGI+T++D  +    L E++ +G +NEC+RQ++LADVII NK DLIS  ++   + +IR
Sbjct:   28 FLGAGKTTLLNYILTEQHGKKIAVILNEFGEGSAIEKSMSVGQSGELFEEWLELRNGCLCCSVKDVGVKAIENLMAKKGKFDYILLETTGLADPGPIASMFWLDEELCCDLFLDGIITLIDAKFCLQHLHEVKPEGVVNECVRQVALADVIIVNKLDLISDEELVQLEQQIR 199          
BLAST of Protein CobW vs. TrEMBL
Match: A0A1S3JU35 (COBW domain-containing protein 1 OS=Lingula unguis OX=7574 GN=LOC106175943 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 4.451e-71
Identity = 115/171 (67.25%), Postives = 141/171 (82.46%), Query Frame = 3
Query:   54 LLGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKI 563
             LG+GKTTLLNYIL E HGK+IAVILNEFG GS+IE +  +  SG LYEEWLEL NGCLCCS+KD GV+A+E+LMKK+GKFDYIL+ETTGLADPGPIAS+FW+DE LCSD+YLDGIVTVVD  +    L E + DG INE + Q++LADVII NKTDL++  ++ D +A++
Sbjct:   29 FLGAGKTTLLNYILTEQHGKRIAVILNEFGEGSAIEKSMSIGQSGELYEEWLELRNGCLCCSVKDNGVQAIENLMKKKGKFDYILLETTGLADPGPIASMFWIDEELCSDIYLDGIVTVVDAKFCLQHLLEQKPDGVINEAVSQVALADVIIINKTDLVNDEELNDLRAQL 199          
BLAST of Protein CobW vs. TrEMBL
Match: A0A0L8IFS4 (cobW domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22005134mg PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 3.153e-70
Identity = 109/171 (63.74%), Postives = 138/171 (80.70%), Query Frame = 3
Query:   54 LLGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKI 563
             LG+GKTTLLNYIL ENHGK+IAVILNEFG GSSIE +  +   G L+EEWLEL NGCLCCS+KD GVKA+E+LM K+GKFDYIL+ETTGLADPGPIAS+FW+DE LCSD+YLDGI+T++D  +    L E++ D  +NEC RQI+LAD+++ NK DL+S  ++   + +I
Sbjct:   27 FLGAGKTTLLNYILSENHGKRIAVILNEFGEGSSIEKSLAVGQKGELFEEWLELRNGCLCCSVKDNGVKAIENLMLKKGKFDYILLETTGLADPGPIASIFWVDEELCSDIYLDGIITMIDAKHCLQHLNEVKKDNLVNECARQIALADLVVINKVDLVSKTELSQVKERI 197          
BLAST of Protein CobW vs. TrEMBL
Match: A0A0B7AZP7 (CobW C-terminal domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF148525 PE=4 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.356e-70
Identity = 115/172 (66.86%), Postives = 139/172 (80.81%), Query Frame = 3
Query:   54 LLGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
             LGSGKTTLLNYIL+E HGK+IAVILNEFG G SIE +  +   G L+EEWLEL NGCLCCS+KD GVKA+E+LM+K+GKFDYIL+ETTGLADPGPIAS+FWLDE LCSD+YLDG+V +VD  + +  L E ++DG INE  RQI+L DVI+ NKTDLI S  ++D   +IR
Sbjct:   28 FLGSGKTTLLNYILNEQHGKRIAVILNEFGEGDSIEKSMSVGEKGELFEEWLELRNGCLCCSVKDNGVKAIENLMQKKGKFDYILLETTGLADPGPIASIFWLDEELCSDVYLDGVVVMVDSKFCKQHLMEEKEDGSINEAQRQIALGDVIVINKTDLIESDLLEDLNHEIR 199          
BLAST of Protein CobW vs. Ensembl Cavefish
Match: cbwd (COBW domain-containing protein 1-like [Source:NCBI gene;Acc:111188809])

HSP 1 Score: 219.55 bits (558), Expect = 1.808e-66
Identity = 106/171 (61.99%), Postives = 134/171 (78.36%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K+IAVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G+KA+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SDLYLDGIVTV+D  Y    L E + +G INE  RQ++LAD++I NKTDL+   ++ D +  +R
Sbjct:   32 LGAGKTTLLNYILTEQHSKRIAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLKAIENLMEKKGKFDYILLETTGLADPGAVASMFWVDAELGSDLYLDGIVTVIDAKYGLRHLTEEKPEGLINEAARQVALADLLIINKTDLVGEDELSDLRNSVR 202          
BLAST of Protein CobW vs. Ensembl Cavefish
Match: cbwd (COBW domain-containing protein 1-like [Source:NCBI gene;Acc:111188809])

HSP 1 Score: 177.178 bits (448), Expect = 8.038e-51
Identity = 90/144 (62.50%), Postives = 111/144 (77.08%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGY--YIESQLAEIRDDGDINECLR 479
            LG+GKTTLLNYIL E H K+IAVILNEFG GS++E +  +   G LYEEWLEL NGCLCCS+KD G+KA+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SDLYLDG   + D +  +I   L E + +G INE  R
Sbjct:   44 LGAGKTTLLNYILTEQHSKRIAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLKAIENLMEKKGKFDYILLETTGLADPGAVASMFWVDAELGSDLYLDG-KNLTDFFLVFILQHLTEEKPEGLINEAAR 186          
BLAST of Protein CobW vs. Ensembl Yeast
Match: YNR029C_mRNA (Putative protein of unknown function; deletion confers reduced fitness in saline [Source:SGD;Acc:S000005312])

HSP 1 Score: 150.984 bits (380), Expect = 4.638e-41
Identity = 87/183 (47.54%), Postives = 116/183 (63.39%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIE-INDLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKR-GKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDD-----------GDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LGSGK+TLL  I  +   KKIAVILNEFG  S IE    +K     Y+EWL+L NGCLCCS+K++GVKA+E ++++  GK DYIL+ET+G+ADP PIA +FW DE L S +Y+DGI+TV+D  +I   L +I  D           G++     Q+++AD II NK D I       +Q K R
Sbjct:   80 LGSGKSTLLEKIALKGADKKIAVILNEFGDSSEIEKAMTIKNGSNSYQEWLDLGNGCLCCSLKNIGVKAIEDMVERSPGKIDYILLETSGIADPAPIAKMFWQDEGLNSSVYIDGIITVLDCEHILKCLDDISIDAHWHGDKVGLEGNLTIAHFQLAMADRIIMNKYDTIEHSPEMVKQLKER 262          
BLAST of Protein CobW vs. Ensembl Nematostella
Match: EDO45103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTW8])

HSP 1 Score: 220.705 bits (561), Expect = 1.399e-69
Identity = 110/171 (64.33%), Postives = 133/171 (77.78%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LGSGKTTLLNYIL E H KKIAVILNEFG G +IE +  +   G LYEEWLEL NGCLCCS+KD G+KA+E+LM KRG+FDYIL+ETTGLADPGPIAS+FWLD+ L SDL LDGIVTVVD  Y    L E +   +INEC+RQ++LAD+II NK DL+   ++   + K++
Sbjct:   32 LGSGKTTLLNYILTEQHNKKIAVILNEFGEGHAIEKSMAIGQEGELYEEWLELRNGCLCCSVKDNGIKAIENLMLKRGRFDYILLETTGLADPGPIASMFWLDDELGSDLCLDGIVTVVDAKYCLQHLNEAKSGEEINECIRQVALADIIIINKLDLVGEEELTQLRDKLQ 202          
BLAST of Protein CobW vs. Ensembl Medaka
Match: cbwd (COBW domain containing 1 [Source:NCBI gene;Acc:101167045])

HSP 1 Score: 216.853 bits (551), Expect = 1.424e-65
Identity = 105/171 (61.40%), Postives = 134/171 (78.36%), Query Frame = 3
Query:   57 LGSGKTTLLNYILHENHGKKIAVILNEFGSGSSIEIN-DLKTSGTLYEEWLELLNGCLCCSIKDVGVKALESLMKKRGKFDYILIETTGLADPGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            LG+GKTTLLNYIL E H K+IAVILNEFG GS++E +  +  +G LYEEWLEL NGCLCCS+KD G+KA+E+LM+K+GKFDYIL+ETTGLADPG +AS+FW+D  L SD+YLDGIVTV+D  +   QL E + DG INE  RQI++AD+ I NKTDL +  ++   +  +R
Sbjct:   33 LGAGKTTLLNYILTEQHNKRIAVILNEFGEGSALEKSLAVSQAGELYEEWLELRNGCLCCSVKDNGLKAIENLMEKKGKFDYILLETTGLADPGAVASMFWVDAELGSDIYLDGIVTVIDAKFGLQQLMEEKADGFINEAARQIAVADLTIINKTDLATGEELNQVRDAVR 203          
BLAST of Protein CobW vs. Planmine SMEST
Match: SMESG000078530.1 (SMESG000078530.1)

HSP 1 Score: 161.77 bits (408), Expect = 2.891e-46
Identity = 79/79 (100.00%), Postives = 79/79 (100.00%), Query Frame = 3
Query:  330 PGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 566
            PGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR
Sbjct:    3 PGPIASLFWLDESLCSDLYLDGIVTVVDGYYIESQLAEIRDDGDINECLRQISLADVIIFNKTDLISSLDIQDRQAKIR 81          
The following BLAST results are available for this feature:
BLAST of Protein CobW vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CBWD15.978e-6860.82COBW domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
CBWD27.982e-6861.99COBW domain containing 2 [Source:HGNC Symbol;Acc:H... [more]
CBWD21.664e-6761.99COBW domain containing 2 [Source:HGNC Symbol;Acc:H... [more]
CBWD16.531e-6760.12COBW domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
CBWD11.354e-6660.82COBW domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Protein CobW vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein CobW vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein CobW vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cbwd1.217e-6561.40COBW domain containing [Source:ZFIN;Acc:ZDB-GENE-0... [more]
cbwd4.946e-5757.31COBW domain containing [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Protein CobW vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cbwd28.842e-6564.15COBW domain containing 1, gene 2 [Source:NCBI gene... [more]
cbwd21.095e-6464.15COBW domain containing 1, gene 2 [Source:NCBI gene... [more]
cbwd23.175e-5761.01COBW domain containing 1, gene 2 [Source:NCBI gene... [more]
cbwd23.281e-5659.12COBW domain containing 1, gene 2 [Source:NCBI gene... [more]
back to top
BLAST of Protein CobW vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cbwd16.761e-6761.40COBW domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Protein CobW vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IUF1|CBWD2_HUMAN7.992e-6761.99COBW domain-containing protein 2 OS=Homo sapiens O... [more]
sp|Q8VEH6|CBWD1_MOUSE4.729e-6661.40COBW domain-containing protein 1 OS=Mus musculus O... [more]
sp|Q99MB4|CBWD1_RAT5.123e-6661.99COBW domain-containing protein 1 OS=Rattus norvegi... [more]
sp|Q9BRT8|CBWD1_HUMAN9.031e-6660.82COBW domain-containing protein 1 OS=Homo sapiens O... [more]
sp|Q5JTY5|CBWD3_HUMAN6.203e-6359.65COBW domain-containing protein 3 OS=Homo sapiens O... [more]
back to top
BLAST of Protein CobW vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PNU32.274e-7265.12COBW domain-containing protein 1 OS=Mizuhopecten y... [more]
X2AWY74.194e-7266.28cobW domain-containing protein OS=Capitella teleta... [more]
A0A1S3JU354.451e-7167.25COBW domain-containing protein 1 OS=Lingula unguis... [more]
A0A0L8IFS43.153e-7063.74cobW domain-containing protein OS=Octopus bimaculo... [more]
A0A0B7AZP73.356e-7066.86CobW C-terminal domain-containing protein OS=Arion... [more]
back to top
BLAST of Protein CobW vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cbwd1.808e-6661.99COBW domain-containing protein 1-like [Source:NCBI... [more]
cbwd8.038e-5162.50COBW domain-containing protein 1-like [Source:NCBI... [more]
back to top
BLAST of Protein CobW vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein CobW vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YNR029C_mRNA4.638e-4147.54Putative protein of unknown function; deletion con... [more]
back to top
BLAST of Protein CobW vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO451031.399e-6964.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein CobW vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cbwd1.424e-6561.40COBW domain containing 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Protein CobW vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000078530.12.891e-46100.00SMESG000078530.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008524 ID=SMED30008524|Name=Protein CobW|organism=Schmidtea mediterranea sexual|type=transcript|length=1518bp
ACCATTTTGACAGGATATCTTGGTAAATTTATTATAATCTTAAAAAATAA
ATATTATTAGGATCTGGTAAAACCACATTATTAAATTATATTCTCCACGA
AAACCATGGTAAGAAAATTGCAGTGATTCTCAATGAATTTGGATCAGGGT
CTTCCATTGAAATAAATGATTTAAAAACTTCAGGAACTTTATACGAAGAA
TGGCTAGAATTATTAAATGGTTGTTTATGTTGTTCTATTAAAGATGTTGG
CGTAAAAGCTTTAGAGAGTTTAATGAAAAAGCGAGGAAAATTTGATTATA
TTTTAATTGAAACAACTGGATTAGCAGATCCTGGACCAATTGCTTCATTA
TTTTGGCTAGATGAGAGTCTTTGCAGTGATTTATATTTGGATGGAATTGT
TACCGTAGTCGATGGATACTATATCGAATCGCAGTTAGCAGAAATTCGTG
ATGATGGGGATATTAATGAATGCCTTAGACAAATATCTCTAGCCGATGTT
ATCATTTTCAATAAAACCGATCTAATATCTTCCTTAGATATTCAGGACAG
GCAGGCAAAAATCAGGTAATTTTCTTAAAAAGACATCAAAAATCGTTATT
TTTGATCAATGGTGAAAACTTTTAAAATCAATTCCATTTTTTAAAATTTA
TCAATAACGAGACCAAAATTTTAAGATTTAATGCATTTGTAATTCTTAAT
GATTGCTAATTCCTGCCACAATTCAGTCGCACTACTGGAATTTCCATACT
CTCCATTGGATGTTAGTTATAAGGCTGTTTTGCTATTGGCACTTTCTGGC
CGACGGGTTCGATGGTAGACAATTTTCCCGTTACAGTGTGGATACAGTAG
ACCACTGGCTCTCAAACTTTTCAAGTCCATGAACACTAAATTCTGATATA
TTTTTAGGCGGAACATCTACATTACAGCATAAACATTAAAACAGAAAGCG
CTGGAAATGGAAATGGAATCGTGTCGCAGCGTGTGATTGGCAACCCCTTG
CTCCCAAGGGCTACTTTTAGAAAATAATATGTATATAAATAAAATATGTA
TCGATATGATGCAAATATATTTATTGAAAACACAATTAAAATTACAATAC
TTTTAAAACAATCTCAAACTTAATCGAACCTTGAATCGTACATTTGATTT
TTTCGCGGAACACTTGAAAGTGCATCATGGAACACGCTTTGAGAACCAAG
CCAGTAGACTATCGCCTATCCGTACATTTTGAAGATTTAAAATTATCGAT
TAAATCCTATATCGAAATTAAAGAATGGATTTCTGGTGATGAAAATATGG
AAAATAAAATTGTAACCGATGAAGAAATTATAAAAACCTCGCAGCCTCAA
CTGATACTAAATGATTGTGATGATGAGTATGAAACCTACAAACATGGAAA
ATATAGAATCTTGAAGCGATTTTATTTTTGTGGTTTTAAAAAACAAATGA
AAATAAAAGAGTTTATGAAGAAATAATTAAAAATCATTTCATCGAATTTT
CTAATTGTTAAAAGCTAA
back to top

protein sequence of SMED30008524-orf-1

>SMED30008524-orf-1 ID=SMED30008524-orf-1|Name=SMED30008524-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MEHALRTKPVDYRLSVHFEDLKLSIKSYIEIKEWISGDENMENKIVTDEE
IIKTSQPQLILNDCDDEYETYKHGKYRILKRFYFCGFKKQMKIKEFMKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006779porphyrin-containing compound biosynthetic process
GO:0009236cobalamin biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR015155PFU
IPR027417P-loop_NTPase
IPR003495CobW/HypB/UreG_dom
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding