WD_REPEATS_REGION domain-containing protein

Overview
NameWD_REPEATS_REGION domain-containing protein
Smed IDSMED30008519
Length (bp)1854
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD_REPEATS_REGION domain-containing protein (SMED30008519) t-SNE clustered cells

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30008519) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD_REPEATS_REGION domain-containing protein (SMED30008519) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30008519) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008519

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008519SMESG000018097.1 SmedASXL_004094SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30008519SMESG000018097.1 SmedASXL_012755SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30008519SMESG000018097.1 dd_Smed_v4_29867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008519SMESG000018097.1 dd_Smed_v4_29867_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30008519SMESG000018097.1 dd_Smed_v4_21908_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30008519SMESG000018097.1 dd_Smed_v4_29867_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: T05C3.2 (pep chromosome:WBcel235:V:5493747:5503010:1 gene:WBGene00020254.1 transcript:T05C3.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T05C3.2)

HSP 1 Score: 91.2781 bits (225), Expect = 9.419e-19
Identity = 117/502 (23.31%), Postives = 220/502 (43.82%), Query Frame = 3
Query:  252 VNDIKIGRNQMSNLVEFSTSRAFLIAAVKNVIIIYXXXXXXXXXXXXXXXXAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILA-NTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQSKRIILIL--SYNSSESKV------------VCYSYNLDKKVFVE-SFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLK-NYFNNEIEVGKYEIICLESKSGNLVALRNSVSDN-GYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFDYIEKKE 1703
            V +I I     +  V F++     +A V+  + ++N+ ++  + +      AH GRI+NL  +       +++SS+D +IK+WN+ N      P +  ME+ IE ISV ++     P + A  TR +  +W+I+      S     +  +V+  L+S  +   IV  ES  L +++   +   I    + N F+ +   Y+  + +I ++    +S+E K+            V YS+    ++F E +     +T  +I L+     +++ L F     +EK             T+KIK +      + +V   +II + S S  ++ +    SDN    +D R  K  + + Q++G       + +N   L GLF+P +GGL + ++ + Q    L+    +G+       S + +YV Y  +     +VFR+ D + I      + I C  S   + F+                + +G  DG+L+T  L D + K+E
Sbjct: 1285 VRNIPIRPRHTTTAVTFASHDTVFVAGVRKHLFLWNVSTTELLRSLD----AHFGRILNLDSVSHQGQNILISSSLDHTIKIWNMENIFEKSFP-VSTMEQSIEKISVAKDN----PTLAAVQTRKNIGIWDIKSHRYIASLVANVHGAVVSDSLLS-ADGRTIVAIESDQLLLWDLRTQ-SVIHSVHAPNVFQIF---YMNKEALIGVIYRQVDSAEQKIARLTIYSITDFSVQYSFEYPCRLFKECAVMRDGITGVVITLF---KGHDSLLVF---DAVEK-------------TQKIKFRPRQSKKQKDVMINKIIAMPSNSNQIIVVE---SDNKSSVWDIRVRKFHRSLTQFNG-------VVSNDGKL-GLFAPAKGGLFVIDMRSGQVAKTLIGNVTEGVNDVTCSFSPNAQYVFYNHSGHKTLRVFRVLDCQLIGTFRPHATITC-WSYDPDGFF----------------VIIGAQDGSLLTVVLNDPMVKEE 1725          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: CG10185 (gene:FBgn0038397 transcript:FBtr0083235)

HSP 1 Score: 103.219 bits (256), Expect = 2.569e-22
Identity = 102/447 (22.82%), Postives = 183/447 (40.94%), Query Frame = 3
Query:  405 AHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEF----YRSIYVQ----SKRIILILSYNSSESKVVCYSYNLDKKVFVES--FFEYHLTDKLIHLYP----VLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFDYIEKKE 1703
            AH GRII L+ +  G    +VTSSID+S+KVWN+ N +  +V  ID+ E  I+ IS+      E    +  TRS   +W    G +    +      IV    I+   ++ I     K L      E++   D++  + +       Y+ + V     ++R IL  +   S  +    +     +   E   FF +    ++I   P    V++ + AY+         K    V  + +     K+ LK     E+      ++ +  K+  +  +    S+ G   D +  K  + + +W G        +  ++   GL++P RGGL++  L    T+   + K  +G+     + +E+ +YV YY + +   +VFR +D + I    L +E+  + S          +   RA       I +G  DG +    + D   KKE
Sbjct: 1256 AHFGRIIQLEPLTIGNWNNLVTSSIDRSVKVWNINN-IFEKVHVIDRHELQIDDISL-----SEVDMAVTVTRSCVGVWETRSGRLLAKLADSPLGAIVTHAEITPDGRYIISSETGKFLVWNRVSEQVVFRDDQPGIQQITLMDYGYKVLTVSVPNINQRDILAAAAGGSADEANRLTAITTMRSVPEGSIFFRFEFPIRMITGMPFRQSVITADNAYIVVVTVDKSNKDCLGVYSATNGAFVSKVLLKGCSIKEV----ISLVPMPHKANQVAVIS---SEKGSVMDIKTKKHVRSIAKWGG--------SITRDGKCGLYAPTRGGLEMLELRKGTTVKTFIPKVAEGVFSVICIFTENDEYVAYYHSGRKTIRVFRTADTEMIANYRLQAELTAIKS----------SKDGRA-------IVLGTVDGCMSVLAIVD--PKKE 1662          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A3S1BTZ6 (WD_REPEATS_REGION domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_000687 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 8.589e-38
Identity = 130/508 (25.59%), Postives = 239/508 (47.05%), Query Frame = 3
Query:  216 VGSFNYGFKIW-----FVNDIKIG--------RNQMSNLVEFSTSRAFLIAAVKNVIIIYXXXXXXXXXXXXXXXXAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQ-SKRIILILSYNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFDYIEK 1697
            VG+   G++++      V ++K+         +NQ+++LV F+    F++A V+  + ++++K  + V        AH GRI  L  +  G++  +++SS+DK+IKVWN    L    P ID++ERPIE I +      E P     TR++ ++WN+E G + ++F   + S IV+ H +   +   +V  ES  + I+        ++    L   +  + +  +   + I+  S  + +++ +C++    ++V+    FEY++     +  PV++K+     F      EKS  +V         +   +   + N +E   Y  +       N VA+ +   + G   D +K    + V +W+G        N  Q   IGL++P RGGL++ NL T +T  +L+ K  +G+ Q  +  +ES K+V+YY +     +VFR+SDGK I      +E+K +      N+                 I +GC DG+L T  + D  E+
Sbjct: 1229 VGTVALGYRLYDLHTDVVRELKLPHGTRNIPTKNQLTSLVVFTKGNQFVVAGVRKNLYVWDVKQGNMVKTLD----AHFGRICALTSVSTGRN-AIISSSMDKTIKVWNFDKILEEVHP-IDRLERPIETIHL----ASESPLCATTTRNTVAIWNLETGRLVKTFVGNARSSIVS-HAVITADGDYVVSAESPKVLIWEISNDTPIVE----LTAGDVQQVLLCEEDTKCIVGSSLPAGKAQCLCFTVPEGQEVYK---FEYNVKK---YRSPVITKD---CIFLAVPATEKSGDVVSVYHAKTGARMYNIHLKYQNYVE---YSHLVAMPHDSNWVAVIDP--EKGNILDLKKKALVRSVPRWNG--------NAMQEGKIGLYAPTRGGLELINLKTTKTTKVLIPKVAEGVFQVTAFFTESDKHVVYYHSRHRTVRVFRISDGKMIANYKTSAEVKAIAGNEQGNY-----------------IVIGCLDGSLTTLAIADPEEE 1682          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: R7TPK7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_169319 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 3.007e-33
Identity = 119/472 (25.21%), Postives = 227/472 (48.09%), Query Frame = 3
Query:  216 VGSFNYGFKIWFVN-------DIKIG------RNQMSNLVEFSTSRAFLIAAVKNVIIIYXXXXXXXXXXXXXXXXAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILA-NTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQSKRIILILSYNSSESKVVCYSYNLDKKVFVE--------SFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVS 1565
            V +    FK+W V        D+  G      +N ++N +  S    FL+A V+  + ++++K+ + +        AH GRII+L+ +      ++V+SSIDKSIKVWN  N +   V  I +ME+PI+ +S+  N      ++ A NTR+   +WN+E G + ++  +  +S IV  H I   N   ++  ESK + +++ E +                +++    ++ +L L  N  ++K +  S   + K  V+        + ++Y      +H   VL+ +  +L    +  ++ ++ L  +      T    +   ++N I+   Y  +       NL+AL +   D G  +D ++    K +++W+G            N   GLF+P RGGL++  + + +TIH L+ K  +G+  + +L +++ ++ +YY + K + KVFR+SDGK + E    +EI+ + S
Sbjct: 1166 VATVALSFKVWDVRTSKMYQLDLPTGVRNIPQKNPLANQICLSRDSEFLVAGVRKNLYVWDVKAGNLIKTLD----AHFGRIISLRSVISKDVNRVVSSSIDKSIKVWNFENIMED-VHNIHRMEKPIDAVSLATNA-----YVGAVNTRTCVGVWNLESGKLMKTLVSGQHSAIV-YHSIITANAQYVISAESKNVVMFDLETE----------------KAVSSNVQQDVLQLMLNDDDTKCIAVSKGTEGKGIVKCRVVPSGVTVYQYEYIMMKVHKAAVLTSDGLFL-VVPAMSLKATEVLSLYHAKTG-THMYDMTPKYHNYID---YTHLVAMPHDPNLIALIDP--DKGNIWDIKRKCHTKTINRWNGV--------CTHNGKFGLFAPTRGGLELLEMRSSKTIHTLIPKVAEGVFTNKTLFTKNDQHAVYYHSGKRSIKVFRVSDGKQVAEYKCHAEIRAIAS 1595          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A2C9JJX6 (WD_REPEATS_REGION domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106073338 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 6.152e-33
Identity = 122/476 (25.63%), Postives = 227/476 (47.69%), Query Frame = 3
Query:  273 RNQMSNLVEFSTSRAFLIAAVKNVIIIYXXXXXXXXXXXXXXXXAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQ-SKRIILILSYNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQF----SLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFD 1685
            +NQ+++LV F+ +  F++A V+  + ++++K  + V        AH GRI  L     G++  +++SS+DK+IKVWN    L    P ID++ERPIE I + +            TR++ ++WN+  G + ++F   + S IV+  +I+   ++ +V  ES  + I++    L K      L+  E  + +  +   + I++     ++ +++C S    ++VF    F+Y +     + +PV++K   YL    S   +KS  ++      +     T ++K +NY +       Y  I       NL+A+ +   + G   D +K    + V +W+G +          +  IG+++P RGGL++ NL T +T  +L+ +  +G+ Q     + S K+V+YY +     ++FR SDGK I      +E+K +      N              C   I +GC DG+L T  + D
Sbjct: 1136 KNQLNSLVVFTKNNQFVVAGVRKNLYVWDVKQGNMVKVLD----AHFGRICALTSSSVGRN-AVISSSMDKTIKVWNFDKILEEVHP-IDRLERPIETIHLAQQSQ----LCATTTRNTVAIWNLGTGRLVKTFVGNARSAIVSHAVITSKGEY-VVSAESPKVLIWD----LTKDTPITGLSVGEVQQVMLSEEDTKAIVVCKIPGAKVQIICMSVPDGQEVFK---FDYTVK---TYRHPVITKEGLYLAVPAS---DKSGDVIAVHHAKTGARLYTLQLKYQNYLD-------YSHIVALPNDPNLIAVIDP--EKGNILDLKKKALVRSVPRWNGHAM--------GDGKIGMYAPARGGLELINLKTTKTTKVLIPRVAEGVFQVTVFFTASDKHVVYYHSRHRTLRLFRTSDGKMIANYKTSAEVKAIAGNDQGN--------------C---IVIGCLDGSLTTLAIAD 1553          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A210PU69 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19717 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 4.754e-29
Identity = 120/479 (25.05%), Postives = 220/479 (45.93%), Query Frame = 3
Query:  273 RNQMSNLVEFSTSRAFLIAAVKNVIIIYXXXXXXXXXXXXXXXXAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQSKRIILILSYNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEV--------GKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFD 1685
            +NQ+  LV F+    F++A V+  + +++ K  + V        AH GRII+L+ +  G   K+++SSIDK+IKVWN  N L   V  ID+ME+PIE I    + TH   + +  +R+   +WN+  G +E S  T S   +V+  +I+   K+       KLL     +E   K+   + + +            R+I +     ++ KV  Y++   ++V+    FEY+L    +    VL+ + ++     +   +KS  ++        T    L   +NN   V          ++I+ ++ + GN++             D +K    + V +W+G +         +N   GL++P+RGGLQ+  L T +T+   + +  +G+     L +++ ++V+YY +     +VFR+SDGK +      +E+K +VS               A+G   E + +G  DG+     + D
Sbjct: 1201 KNQLFTLVVFTKHNHFVVAGVRKNMYVWDTKQGNMVKVLD----AHFGRIISLRAVSSG-CNKVISSSIDKTIKVWNFDNILED-VHSIDRMEKPIETID-LASETH---YGVTTSRNCIGVWNLGTGKLELSLETKS---VVSLAVITKDGKYVAAAESGKLLIWEVSQESASKVIIHKDIQQLLMNEG----DSRVIALAKEGFNKGKVTAYTFPEGEQVYT---FEYNLR---VFKPGVLTIDGSFFAVLAT---DKSGDVLGVYHAKSGTHLYNLGLKYNNYKPVQSMRAMRHDPHQIVLVDEEKGNVI-------------DLKKKTVPRSVSRWNGMAM--------KNGKFGLYAPNRGGLQLLELKTGKTVRTFIPRVAEGVFSIDVLFTQNDRHVVYYHSGHRTIRVFRVSDGKMVANFKAHAEVKAMVST--------------AEG---ETVVIGAVDGSFTVLSIAD 1615          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: V3YVS0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_135306 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 8.487e-29
Identity = 129/503 (25.65%), Postives = 235/503 (46.72%), Query Frame = 3
Query:  207 KICVGSFNYGFKIWFVN-----DIKI--------GRNQMSNLVEFSTSRAFLIAAVKNVIIIYXXXXXXXXXXXXXXXXAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYV----QSKRIILILSYNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQF--SLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDG 1658
            K  + +   GFK+W +      D+K+         +NQ+++ V F+    F+++ V+  I +++ K  + V        AH GRII+L  +F G    +++SSIDK+IKVWN    L    P ID++E+PIE + +      +    ++ TR+  ++W++  G +E++++  S   ++   +I+   KF I + ES +  ++       ++    +L  F      +V      K+I+      S +   VC+       V V   FEY++        PVLS++E +L    S   +KS  +V    +L   +   ++LK  ++N  +     +I L   S NL+A+ +S  D     D +K    + V +W+G           QN  +G  +P RGGLQ+ +    + I  L+ +  +G+     L ++  KY++YY +     +VFR+SDGK I      +E+K +  K S++  K+  +     GL   ++     DG
Sbjct: 1155 KYLIATVASGFKLWDLRIMTRRDLKLPPGARNIPSKNQLTSQVVFTRLNEFVVSTVRKNIYVWDAKQGNLVKILD----AHFGRIISLSPVFSG-CNIIISSSIDKTIKVWNFDKILEDVHP-IDRLEKPIETLEL----ASKADLCVSTTRNMVAVWSLLTGRLEKTYTCHSRGAVITYAVITQDGKFVISV-ESGIAVLW-------ELSRDTALTSFPVGDVQHVLKMDDDKKILTFSKPPSGKGTCVCFEI---PSVGVLYKFEYNVKK---FRPPVLSQDEVHLVVPAS---DKSGDVVGVYNALTGTLVYNLQLK--YSNFTDYS--HVIALPHDS-NLIAVIDS--DKANILDLKKKTLIRSVSKWNGV--------VTQNGKMGFNAPSRGGLQLIDTKHGKPIRTLIPRVAEGVFSMDVLFTKDDKYILYYHSGHRTIRVFRISDGKLIANFKPQAEVKVI--KGSSDGTKV--AIGTVDGLVTYMVLADPDDG 1611          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000018097.1 (SMESG000018097.1)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 497/514 (96.69%), Postives = 497/514 (96.69%), Query Frame = 3
Query:  210 ICVGSFNYGFKIWFVNDIKIGR---------------NQMSNLVEFSTSRAFLIAAVKNVIIIYXXXXXXXXXXXXXXXXAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQSKRIILILSYNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFDYIEKKEL 1706
            I VGSFNYGFKIWFVNDIKIG                NQMSNLVEFSTSRAFLIAAVKNVIIIYNIKSSSNVINPSVIIPAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQSKRIILILSYNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFDYIEKKEL
Sbjct: 1160 IAVGSFNYGFKIWFVNDIKIGSIILKLPINVVNIPTGNQMSNLVEFSTSRAFLIAAVKNVIIIYNIKSSSNVINPSVIIPAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQSKRIILILSYNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFDYIEKKEL 1673          

HSP 2 Score: 152.91 bits (385), Expect = 2.242e-38
Identity = 72/78 (92.31%), Postives = 76/78 (97.44%), Query Frame = 1
Query:    1 LIILSKFVSELEGNDFQVHVIHVDFVASLYSGTCAYCFNNELTMFCFIMKELNYFTIVCHSTLDNVKVLRYALDHLTM 234
            LIILSKFVSELEGNDFQVHVIHVDFVASLYSGTCAYCFNNELTMFCFIMKELNYFTIVCHSTLDNVKVLRYA++  ++
Sbjct: 1072 LIILSKFVSELEGNDFQVHVIHVDFVASLYSGTCAYCFNNELTMFCFIMKELNYFTIVCHSTLDNVKVLRYAVNKESI 1149          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000018097.1 (SMESG000018097.1)

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 497/514 (96.69%), Postives = 497/514 (96.69%), Query Frame = 3
Query:  210 ICVGSFNYGFKIWFVNDIKIGR---------------NQMSNLVEFSTSRAFLIAAVKNVIIIYXXXXXXXXXXXXXXXXAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQSKRIILILSYNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFDYIEKKEL 1706
            I VGSFNYGFKIWFVNDIKIG                NQMSNLVEFSTSRAFLIAAVKNVIIIYNIKSSSNVINPSVIIPAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQSKRIILILSYNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFDYIEKKEL
Sbjct:  907 IAVGSFNYGFKIWFVNDIKIGSIILKLPINVVNIPTGNQMSNLVEFSTSRAFLIAAVKNVIIIYNIKSSSNVINPSVIIPAHNGRIINLQYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFENYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNKFAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQSKRIILILSYNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFCESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGNLVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLFSPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATKSNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNELIFVGCSDGTLITFGLFDYIEKKEL 1420          

HSP 2 Score: 152.14 bits (383), Expect = 3.578e-38
Identity = 72/78 (92.31%), Postives = 76/78 (97.44%), Query Frame = 1
Query:    1 LIILSKFVSELEGNDFQVHVIHVDFVASLYSGTCAYCFNNELTMFCFIMKELNYFTIVCHSTLDNVKVLRYALDHLTM 234
            LIILSKFVSELEGNDFQVHVIHVDFVASLYSGTCAYCFNNELTMFCFIMKELNYFTIVCHSTLDNVKVLRYA++  ++
Sbjct:  819 LIILSKFVSELEGNDFQVHVIHVDFVASLYSGTCAYCFNNELTMFCFIMKELNYFTIVCHSTLDNVKVLRYAVNKESI 896          
The following BLAST results are available for this feature:
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T05C3.29.419e-1923.31pep chromosome:WBcel235:V:5493747:5503010:1 gene:W... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG101852.569e-2222.82gene:FBgn0038397 transcript:FBtr0083235[more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1BTZ68.589e-3825.59WD_REPEATS_REGION domain-containing protein OS=Ely... [more]
R7TPK73.007e-3325.21Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2C9JJX66.152e-3325.63WD_REPEATS_REGION domain-containing protein OS=Bio... [more]
A0A210PU694.754e-2925.05Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
V3YVS08.487e-2925.65Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000018097.12.242e-3896.69SMESG000018097.1[more]
SMESG000018097.13.578e-3896.69SMESG000018097.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008519 ID=SMED30008519|Name=WD_REPEATS_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1854bp
CTAATTATTTTATCAAAATTTGTATCAGAATTAGAAGGAAATGATTTTCA
AGTTCATGTAATTCACGTCGATTTTGTTGCATCATTATATTCCGGTACTT
GTGCTTATTGTTTTAATAATGAACTAACAATGTTTTGTTTTATAATGAAA
GAGTTAAATTATTTCACAATTGTATGCCATTCAACTTTAGATAACGTAAA
AGTGTTAAGATATGCGTTGGATCATTTAACTATGGATTTAAAATCTGGTT
TGTAAATGACATCAAAATTGGAAGAAATCAAATGTCTAACCTAGTAGAAT
TTTCAACAAGTCGTGCATTTCTCATTGCTGCTGTTAAAAATGTGATTATA
ATTTATAATATTAAGTCCAGTTCAAACGTAATTAATCCATCAGTAATAAT
TCCCGCTCATAATGGACGAATAATTAATTTACAATATATTTTTGATGGAA
AAAGCGAAAAGATGGTTACTAGCTCCATAGATAAGTCAATTAAAGTATGG
AATTTAAGAAATGCATTATCGAGTCAAGTACCATTCATTGATAAAATGGA
GCGCCCTATTGAAGGAATTTCTGTGTTTGAGAACTATACACATGAATTTC
CATTTATTTTAGCAAATACCAGATCATCTGCATCTTTATGGAATATAGAA
AAGGGAAATATTGAAGAATCATTTTCAACTATTTCAAATTCTTTTATAGT
TAATTGTCATTTAATTTCTGATGTTAATAAATTTGCAATAGTTATTTGTG
AATCTAAACTTTTAACAATTTATAATTATGAAGAGAAACTTGAAAAAATT
GACGAAAGAGAGTCTTTGAATGAATTTGAATTTTATCGCTCAATTTATGT
ACAATCAAAACGTATTATATTAATTTTAAGTTATAATTCTTCAGAATCAA
AAGTAGTATGTTATTCTTATAATTTAGATAAGAAAGTGTTCGTGGAATCA
TTTTTTGAATATCATTTAACCGATAAACTTATTCATTTATATCCGGTTTT
AAGTAAAAATGAAGCGTATTTATATTTCTGTGAAAGCAAAGGCATTGAAA
AGTCAAAGTCTTTAGTCCAATTTTCTTTAGATAACTTTATAACAAAGAAA
ATTAAATTAAAAAATTATTTCAACAATGAAATTGAAGTTGGAAAGTATGA
AATAATTTGTCTAGAAAGCAAATCCGGAAATTTAGTAGCTCTAAGAAACA
GTGTTTCGGATAACGGATATTTTTTCGATTTTAGAAAAAGTAAAAGTTGG
AAGAAAGTACACCAGTGGTCTGGACAGTCTGCTTTGATTGAAAATATAAA
TACGAATCAAAATTCATTAATTGGGTTATTTTCTCCAGATAGAGGCGGAC
TGCAGATCTTTAATTTGAATACTAAACAAACTATTCATATTTTATTACAA
AAGTCATTTGATGGTCTTTGCCAAAGCTTTTCATTGATATCGGAGAGTAA
AAAATATGTTATATATTATCGTGCGACTAAATCAAATTTTAAGGTGTTCC
GATTATCAGATGGAAAATTTATAACTGAGATAAATTTACCATCAGAAATT
AAATGTGTGGTATCTAAATATTCAAATAACTTCTATAAGTTGATCAATTC
ACCATCAAGAGCAAAAGGATTGTGCAATGAATTAATATTTGTTGGATGTT
CAGATGGCACATTAATAACTTTTGGATTGTTTGACTACATTGAAAAAAAG
GAACTTTAAATCTTTCCAAATGAAAAAAATTAAAAGTATAAAATTTAGAA
TTTCAAAAATTTACAATTTAAAAGAAAACATTCATAAATTAATGCATTTT
CCAGGCCGAGGTGGACAGATTTTCAAGATAAATAATAATATAGTTATAGC
ATAT
back to top

protein sequence of SMED30008519-orf-1

>SMED30008519-orf-1 ID=SMED30008519-orf-1|Name=SMED30008519-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=476bp
MSNLVEFSTSRAFLIAAVKNVIIIYNIKSSSNVINPSVIIPAHNGRIINL
QYIFDGKSEKMVTSSIDKSIKVWNLRNALSSQVPFIDKMERPIEGISVFE
NYTHEFPFILANTRSSASLWNIEKGNIEESFSTISNSFIVNCHLISDVNK
FAIVICESKLLTIYNYEEKLEKIDERESLNEFEFYRSIYVQSKRIILILS
YNSSESKVVCYSYNLDKKVFVESFFEYHLTDKLIHLYPVLSKNEAYLYFC
ESKGIEKSKSLVQFSLDNFITKKIKLKNYFNNEIEVGKYEIICLESKSGN
LVALRNSVSDNGYFFDFRKSKSWKKVHQWSGQSALIENINTNQNSLIGLF
SPDRGGLQIFNLNTKQTIHILLQKSFDGLCQSFSLISESKKYVIYYRATK
SNFKVFRLSDGKFITEINLPSEIKCVVSKYSNNFYKLINSPSRAKGLCNE
LIFVGCSDGTLITFGLFDYIEKKEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR001680WD40_repeat
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 3..267
e-value: 9.2E-11
score: 43.7
NoneNo IPR availablePANTHERPTHR18763:SF1coord: 40..125
coord: 309..422
NoneNo IPR availablePANTHERPTHR18763WD-REPEAT PROTEIN 18coord: 40..125
coord: 309..422
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 61..75
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 40..83
score: 10.408
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 1..83
score: 10.153
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 5..464