SMED30008513

Overview
NameSMED30008513
Smed IDSMED30008513
Length (bp)3344
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30008513 (SMED30008513) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30008513 (SMED30008513) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30008513 (SMED30008513) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30008513 (SMED30008513) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008513

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30008513SMESG000008541.1 dd_Smed_v4_8116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008513SMESG000008541.1 dd_Smed_v4_8116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008513SMESG000008541.1 dd_Smed_v4_8116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008513SMESG000008541.1 dd_Smed_v4_8116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008513SMESG000008541.1 dd_Smed_v4_8116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008513SMESG000008541.1 dd_Smed_v4_8116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30008513SMESG000008541.1 dd_Smed_v4_8116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008513SMESG000008541.1 dd_Smed_v4_8116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008513SMESG000008541.1 Contig38063newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008513SMESG000008541.1 Contig38063uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30008513 vs. Ensembl Human
Match: APEH (acylaminoacyl-peptide hydrolase [Source:HGNC Symbol;Acc:HGNC:586])

HSP 1 Score: 383.645 bits (984), Expect = 2.634e-118
Identity = 236/730 (32.33%), Postives = 379/730 (51.92%), Query Frame = -3
Query: 1123 MSVLKNITSVYKSYARYPNLNSAKF------LNNADPYIISSTWTVNDLVTSKTKNLNLNFYY---EKDKNLILKSP--QVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNV-LNCQILDHIPEFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3231
            +S  +   ++Y+  +R P L++A                + + WT  DL   + +N+     Y       +++   P    +     ++   S S   +A+   RK+  +   E K   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D SA   EI           G+QF + +D+GE + +   PV+C+LDV+   I VL+       +S G     P   G+ F G+ + P+ LG+ +C  R   L+Y  L   + + + D++ +  SP+ SPD   I++L+  +  PH QC +L  Y+  T  T VVVDVV   + E F+G+Y   L   CW+ DS  ++  SA + +  +  +D +   V  L    +  S  LL ++   ++ + S+PS  P L +G L SA  E  +  V L       ++    ++L   PE ++ ++    +++I +   S   +   PM++M HGGPHS+F T + +F A + ++GF  L+VNYRGS G+GQDSI SL G +G  DVKD   A E +++E     D + + L GGSHGGF++ HL   Y +  ++   RNPVIN+ SM  +TDIPDW   E G  +  D L +      M ++SP+  + ++K P+L+M+GQ+D+RVP  QG+E Y+AL+ R+V   L +YPK  H L+ VE  SDSF+N + W 
Sbjct:    7 LSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEWTQRDL--ERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVL--RKAGGTGPGEEK-QFLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVP--ENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSLAVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPRQLGENFSGIYCSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTSLTAGGSGGSWKLLTIDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQE--EHFDASHVALMGGSHGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVLWL 726          
BLAST of SMED30008513 vs. Ensembl Human
Match: APEH (acylaminoacyl-peptide hydrolase [Source:HGNC Symbol;Acc:HGNC:586])

HSP 1 Score: 374.015 bits (959), Expect = 1.178e-114
Identity = 235/735 (31.97%), Postives = 380/735 (51.70%), Query Frame = -3
Query: 1123 MSVLKNITSVYKSYARYPNLNSAKF------LNNADPYIISSTWTVNDLVTSKTKNLNLNFYY---EKDKNLILKSP--QVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNV-LNCQILDHIPEFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFT-----ECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3231
            +S  +   ++Y+  +R P L++A                + + WT  DL   + +N+     Y       +++   P    +     ++   S S   +A+   RK+  +   E K   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D SA   EI           G+QF + +D+GE + +   PV+C+LDV+   I VL+       +S G     P   G+ F G+ + P+ LG+ +C  R   L+Y  L   + + + D++ +  SP+ SPD   I++L+  +  PH QC +L  Y+  T  T VVVDVV   + E F+G+Y   L   CW+ DS  ++  SA + +  +  +D +   V  L    +  S  LL ++   ++ + S+PS  P L +G L SA  E  +  V L       ++    ++L   PE ++ ++    +++I +   S   +   PM++M HGGPHS+F T + +F A + ++GF  L+VNYRGS G+GQDSI SL G +G  DVKD   A E +++E     D + + L GGSHGGF++ HL   Y +  ++   RNPVIN+ SM  +TDIPD + +     E G  +  D L +      M ++SP+  + ++K P+L+M+GQ+D+RVP  QG+E Y+AL+ R+V   L +YPK  H L+ VE  SDSF+N + W 
Sbjct:    7 LSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEWTQRDL--ERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVL--RKAGGTGPGEEK-QFLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVP--ENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSLAVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPRQLGENFSGIYCSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTSLTAGGSGGSWKLLTIDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQE--EHFDASHVALMGGSHGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDCSVSCRCVVEAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVLWL 731          
BLAST of SMED30008513 vs. Ensembl Human
Match: APEH (acylaminoacyl-peptide hydrolase [Source:HGNC Symbol;Acc:HGNC:586])

HSP 1 Score: 140.584 bits (353), Expect = 5.560e-36
Identity = 93/281 (33.10%), Postives = 145/281 (51.60%), Query Frame = -3
Query: 2146 RKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVK 2952
            RK+  +   E K   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D SA   EI           G+QF + +D+GE + +   PV+C+LDV+   I VL+       +S G     P   G+ F G+ + P+ LG+ +C  R   L+Y  L   + + + D++ +  SP+ SPD   I++L+  +  PH QC +L  Y+  T  T VVVDVV   + E F+G+Y   L   CW+ DS  ++  SA +
Sbjct:   32 RKAGGTGPGEEK-QFLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVP--ENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSLAVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPRQLGENFSGIYCSLLPLGCWSADSQRVVFDSAQR 308          
BLAST of SMED30008513 vs. Ensembl Human
Match: APEH (acylaminoacyl-peptide hydrolase [Source:HGNC Symbol;Acc:HGNC:586])

HSP 1 Score: 123.25 bits (308), Expect = 7.517e-31
Identity = 73/229 (31.88%), Postives = 117/229 (51.09%), Query Frame = -3
Query: 2299 RKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRL 2952
            RK+  +   E K   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D SA   EI           G+QF + +D+GE + +   PV+C+LDV+   I VL+       +S G     P   G+ F G+ + P+ LG+ +C  R   L+Y  L   + + + D++ +  SP+ SPD   I++L+  +  PH QC +L
Sbjct:    6 RKAGGTGPGEEK-QFLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVP--ENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSLAVSSPRLSPDQCRIVYLQYPSLIPHHQCSQL 230          
BLAST of SMED30008513 vs. Ensembl Human
Match: APEH (acylaminoacyl-peptide hydrolase [Source:HGNC Symbol;Acc:HGNC:586])

HSP 1 Score: 85.8853 bits (211), Expect = 1.497e-17
Identity = 74/322 (22.98%), Postives = 132/322 (40.99%), Query Frame = -3
Query: 2299 MSVLKNITSVYKSYARYPNLNSAKF------LNNADPYIISSTWTVNDLVTSKTKNLNLNFYY---EKDKNLILKSPQ--VLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRL 3231
            +S  +   ++Y+  +R P L++A                + + WT  DL   + +N+     Y       +++   P    +     ++   S S   +A+   RK+  +   E K   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D SA   EI                        L   ++ I+   +               P   G+ F G+ + P+ LG+ +C  R   L+Y  L   + + + D++ +  SP+ SPD   I++L+  +  PH QC +L
Sbjct:    4 LSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEWTQRDL--ERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVL--RKAGGTGPGEEK-QFLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIAR----------------------LKKPDQAIKAFWA---------------PGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSLAVSSPRLSPDQCRIVYLQYPSLIPHHQCSQL 282          
BLAST of SMED30008513 vs. Ensembl Celegans
Match: dpf-5 (Dipeptidyl Peptidase Four (IV) family [Source:UniProtKB/TrEMBL;Acc:Q9TYX1])

HSP 1 Score: 271.937 bits (694), Expect = 7.928e-78
Identity = 204/728 (28.02%), Postives = 334/728 (45.88%), Query Frame = -3
Query: 1123 NMSVLKNITSVYKSYARYPNLNSAKF-LNNADPYI-ISSTWTVNDLVTSK-TKNLNLNFYYEK-----DKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKS-FNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIE--IGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPY-NLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTD-------VVVDVVKEPIT--EFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNIL-NVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFISSKKEGSCPMILMLHGGPHSAFYTDFTVFG-AAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTE-CGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3234
            ++  L+ +  +Y   A+ P     +    + D +I +++TW    +  +K T+   ++   +K     D+ L+      + + E    VYS+S    A  L   + D   +  K   +   ++EL     +L+    HG +H      FG   +      ++Y+AE        F  ++  D   K  E  +G +F+  + +GEQ   V  PVICI+D+    +  LD   +   +S       P   G+ F G E      LG IYC  R   L+YY L + ++ KI +   S    +FSPDG  ++W +  A GPH     ++  E              ++V +VKE  +  EF G          W+ DS  ++L+S+   + +++ ++I T N+  L N S  + + +LLD+ D  +L  VS+P+  P + +G+L       EM  V +      D      + +   EF + +     Y+ I I   +  + PM++  HGGPH A    +       +   G+  L VN+RGS G+G D I +L G  G MDVKD   A   ++ + P ++  +K+ L+GGSHGGFL SHL   Y    KS    NPV+N+ +M   TDIP+W + E  G    +  +   E    M+  SP++ V+    P L++IG+ D RV P       +AL+AR V   +  YP   HPL  V   +D  +N++ WF
Sbjct:   13 DVRALEKLKDLYGDLAQIPIPTQGRIEKKSGDEFIKVTTTWDNRAMQLNKLTRQQRVSLIGKKGPEVTDRYLMTSVSVPMCNYENQRSVYSASNSRVAQLLTIGTGDDKKQYLKIYNLEEHVEEL---CADLSTQKKHGTIHGGGCMPFGCLHFSYGEGHVLYVAERNSKTSQYFDADIEWDNETKVFESKVGKKFELTESWGEQNDGVKQPVICIVDISSGNVTALDQ--IPANISPSYTKWAPGDAGVVFFGLEEQDTPRLGRIYCNNRRGNLYYYELATAKLTKISEGEISAEELQFSPDGNTLVWFQRAADGPHQAVLEMVAVEWPLKVDSAENIEKRIIVPIVKEKRSADEFQGFTFPQTATRSWSTDSKRLILSSSWCSKLELLSVNIATGNIEKLTNHSICLGTWSLLDVYDNEVLAVVSAPNRPPNVLLGQLPGTGKAEEMVWVRIDEAKAVDK--RRHLFEFSWEFVNLERDGATYEGILIVPNEGNNLPMVVNPHGGPHGASMASWPRRDLTTLLNSGYAVLQVNFRGSLGFGDDFIRALPGNCGDMDVKDVHNAVLTVLDKNP-RISRDKVVLFGGSHGGFLVSHLIGQYPGFYKSCVALNPVVNIATMHDITDIPEWCYFEGTGEYPDWTKITTTEQREKMFNSSPIAHVENATTPYLLLIGEKDLRVVPHY-RAFIRALKARGVPARVLTYPPSNHPLDEVNVEADYAINMVRWF 731          
BLAST of SMED30008513 vs. Ensembl Celegans
Match: dpf-5 (Dipeptidyl Peptidase Four (IV) family [Source:UniProtKB/TrEMBL;Acc:Q9TYX1])

HSP 1 Score: 271.937 bits (694), Expect = 7.928e-78
Identity = 204/728 (28.02%), Postives = 334/728 (45.88%), Query Frame = -3
Query: 1123 NMSVLKNITSVYKSYARYPNLNSAKF-LNNADPYI-ISSTWTVNDLVTSK-TKNLNLNFYYEK-----DKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKS-FNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIE--IGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPY-NLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTD-------VVVDVVKEPIT--EFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNIL-NVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFISSKKEGSCPMILMLHGGPHSAFYTDFTVFG-AAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTE-CGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3234
            ++  L+ +  +Y   A+ P     +    + D +I +++TW    +  +K T+   ++   +K     D+ L+      + + E    VYS+S    A  L   + D   +  K   +   ++EL     +L+    HG +H      FG   +      ++Y+AE        F  ++  D   K  E  +G +F+  + +GEQ   V  PVICI+D+    +  LD   +   +S       P   G+ F G E      LG IYC  R   L+YY L + ++ KI +   S    +FSPDG  ++W +  A GPH     ++  E              ++V +VKE  +  EF G          W+ DS  ++L+S+   + +++ ++I T N+  L N S  + + +LLD+ D  +L  VS+P+  P + +G+L       EM  V +      D      + +   EF + +     Y+ I I   +  + PM++  HGGPH A    +       +   G+  L VN+RGS G+G D I +L G  G MDVKD   A   ++ + P ++  +K+ L+GGSHGGFL SHL   Y    KS    NPV+N+ +M   TDIP+W + E  G    +  +   E    M+  SP++ V+    P L++IG+ D RV P       +AL+AR V   +  YP   HPL  V   +D  +N++ WF
Sbjct:   13 DVRALEKLKDLYGDLAQIPIPTQGRIEKKSGDEFIKVTTTWDNRAMQLNKLTRQQRVSLIGKKGPEVTDRYLMTSVSVPMCNYENQRSVYSASNSRVAQLLTIGTGDDKKQYLKIYNLEEHVEEL---CADLSTQKKHGTIHGGGCMPFGCLHFSYGEGHVLYVAERNSKTSQYFDADIEWDNETKVFESKVGKKFELTESWGEQNDGVKQPVICIVDISSGNVTALDQ--IPANISPSYTKWAPGDAGVVFFGLEEQDTPRLGRIYCNNRRGNLYYYELATAKLTKISEGEISAEELQFSPDGNTLVWFQRAADGPHQAVLEMVAVEWPLKVDSAENIEKRIIVPIVKEKRSADEFQGFTFPQTATRSWSTDSKRLILSSSWCSKLELLSVNIATGNIEKLTNHSICLGTWSLLDVYDNEVLAVVSAPNRPPNVLLGQLPGTGKAEEMVWVRIDEAKAVDK--RRHLFEFSWEFVNLERDGATYEGILIVPNEGNNLPMVVNPHGGPHGASMASWPRRDLTTLLNSGYAVLQVNFRGSLGFGDDFIRALPGNCGDMDVKDVHNAVLTVLDKNP-RISRDKVVLFGGSHGGFLVSHLIGQYPGFYKSCVALNPVVNIATMHDITDIPEWCYFEGTGEYPDWTKITTTEQREKMFNSSPIAHVENATTPYLLLIGEKDLRVVPHY-RAFIRALKARGVPARVLTYPPSNHPLDEVNVEADYAINMVRWF 731          
BLAST of SMED30008513 vs. Ensembl Celegans
Match: dpf-5 (Dipeptidyl Peptidase Four (IV) family [Source:UniProtKB/TrEMBL;Acc:Q9TYX1])

HSP 1 Score: 263.848 bits (673), Expect = 2.390e-76
Identity = 176/580 (30.34%), Postives = 275/580 (47.41%), Query Frame = -3
Query: 1123 FGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIE--IGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPY-NLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTD-------VVVDVVKEPIT--EFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNIL-NVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFISSKKEGSCPMILMLHGGPHSAFYTDFTVFG-AAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTE-CGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 2817
            FG   +      ++Y+AE        F  ++  D   K  E  +G +F+  + +GEQ   V  PVICI+D+    +  LD   +   +S       P   G+ F G E      LG IYC  R   L+YY L + ++ KI +   S    +FSPDG  ++W +  A GPH     ++  E              ++V +VKE  +  EF G          W+ DS  ++L+S+   + +++ ++I T N+  L N S  + + +LLD+ D  +L  VS+P+  P + +G+L       EM  V +      D      + +   EF + +     Y+ I I   +  + PM++  HGGPH A    +       +   G+  L VN+RGS G+G D I +L G  G MDVKD   A   ++ + P ++  +K+ L+GGSHGGFL SHL   Y    KS    NPV+N+ +M   TDIP+W + E  G    +  +   E    M+  SP++ V+    P L++IG+ D RV P       +AL+AR V   +  YP   HPL  V   +D  +N++ WF
Sbjct:    3 FGCLHFSYGEGHVLYVAERNSKTSQYFDADIEWDNETKVFESKVGKKFELTESWGEQNDGVKQPVICIVDISSGNVTALDQ--IPANISPSYTKWAPGDAGVVFFGLEEQDTPRLGRIYCNNRRGNLYYYELATAKLTKISEGEISAEELQFSPDGNTLVWFQRAADGPHQAVLEMVAVEWPLKVDSAENIEKRIIVPIVKEKRSADEFQGFTFPQTATRSWSTDSKRLILSSSWCSKLELLSVNIATGNIEKLTNHSICLGTWSLLDVYDNEVLAVVSAPNRPPNVLLGQLPGTGKAEEMVWVRIDEAKAVDK--RRHLFEFSWEFVNLERDGATYEGILIVPNEGNNLPMVVNPHGGPHGASMASWPRRDLTTLLNSGYAVLQVNFRGSLGFGDDFIRALPGNCGDMDVKDVHNAVLTVLDKNP-RISRDKVVLFGGSHGGFLVSHLIGQYPGFYKSCVALNPVVNIATMHDITDIPEWCYFEGTGEYPDWTKITTTEQREKMFNSSPIAHVENATTPYLLLIGEKDLRVVPHY-RAFIRALKARGVPARVLTYPPSNHPLDEVNVEADYAINMVRWF 576          
BLAST of SMED30008513 vs. Ensembl Celegans
Match: dpf-5 (Dipeptidyl Peptidase Four (IV) family [Source:UniProtKB/TrEMBL;Acc:Q9TYX1])

HSP 1 Score: 263.848 bits (673), Expect = 2.390e-76
Identity = 176/580 (30.34%), Postives = 275/580 (47.41%), Query Frame = -3
Query: 1123 FGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIE--IGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPY-NLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTD-------VVVDVVKEPIT--EFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNIL-NVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFISSKKEGSCPMILMLHGGPHSAFYTDFTVFG-AAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTE-CGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 2817
            FG   +      ++Y+AE        F  ++  D   K  E  +G +F+  + +GEQ   V  PVICI+D+    +  LD   +   +S       P   G+ F G E      LG IYC  R   L+YY L + ++ KI +   S    +FSPDG  ++W +  A GPH     ++  E              ++V +VKE  +  EF G          W+ DS  ++L+S+   + +++ ++I T N+  L N S  + + +LLD+ D  +L  VS+P+  P + +G+L       EM  V +      D      + +   EF + +     Y+ I I   +  + PM++  HGGPH A    +       +   G+  L VN+RGS G+G D I +L G  G MDVKD   A   ++ + P ++  +K+ L+GGSHGGFL SHL   Y    KS    NPV+N+ +M   TDIP+W + E  G    +  +   E    M+  SP++ V+    P L++IG+ D RV P       +AL+AR V   +  YP   HPL  V   +D  +N++ WF
Sbjct:    3 FGCLHFSYGEGHVLYVAERNSKTSQYFDADIEWDNETKVFESKVGKKFELTESWGEQNDGVKQPVICIVDISSGNVTALDQ--IPANISPSYTKWAPGDAGVVFFGLEEQDTPRLGRIYCNNRRGNLYYYELATAKLTKISEGEISAEELQFSPDGNTLVWFQRAADGPHQAVLEMVAVEWPLKVDSAENIEKRIIVPIVKEKRSADEFQGFTFPQTATRSWSTDSKRLILSSSWCSKLELLSVNIATGNIEKLTNHSICLGTWSLLDVYDNEVLAVVSAPNRPPNVLLGQLPGTGKAEEMVWVRIDEAKAVDK--RRHLFEFSWEFVNLERDGATYEGILIVPNEGNNLPMVVNPHGGPHGASMASWPRRDLTTLLNSGYAVLQVNFRGSLGFGDDFIRALPGNCGDMDVKDVHNAVLTVLDKNP-RISRDKVVLFGGSHGGFLVSHLIGQYPGFYKSCVALNPVVNIATMHDITDIPEWCYFEGTGEYPDWTKITTTEQREKMFNSSPIAHVENATTPYLLLIGEKDLRVVPHY-RAFIRALKARGVPARVLTYPPSNHPLDEVNVEADYAINMVRWF 576          
BLAST of SMED30008513 vs. Ensembl Celegans
Match: dpf-4 (Dipeptidyl Peptidase Four (IV) family [Source:UniProtKB/TrEMBL;Acc:Q19086])

HSP 1 Score: 88.5817 bits (218), Expect = 1.162e-17
Identity = 62/219 (28.31%), Postives = 103/219 (47.03%), Query Frame = -3
Query: 1180 SKKEGSCPMILML-HGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNK--EDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCH 1827
            S   G+ P +L+L HGGP +    +  +        G     VNYRGS G+G +    L    G  D  D +  ++ ++ +   KVD  K+ + G S GG+L         + +K+A     V +L+++   T   +  + E         L+ K  E  +   ERSP+  +DKI+ PI  + G++D  VP SQ + +Y+ +RA  V T L ++  + H
Sbjct:  395 SAPAGTLPPVLLLGHGGPTAPAQNNLDLKKQFFTSRGIAVFDVNYRGSTGFGTEFRRMLYKNCGVADRDDMLNGAKALVEQ--GKVDAEKVLITGSSSGGYLILSCLISPKNIIKAAVSVYGVADLLALDEDTHKLERCYNEM--------LIGKYPEQASIYEERSPIYHIDKIRTPIAFLHGREDTVVPMSQSITMYEKIRASGVTTALMLFDGEGH 603          
BLAST of SMED30008513 vs. Ensembl Fly
Match: CG11319 (gene:FBgn0031835 transcript:FBtr0343159)

HSP 1 Score: 53.5286 bits (127), Expect = 1.248e-6
Identity = 53/220 (24.09%), Postives = 95/220 (43.18%), Query Frame = -3
Query: 1162 PMILMLHGGPHSAFYTDFTVFGAAVAELG---FHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLS-LVDKIK-CPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVE 1806
            P IL ++ GP S   TD           G   +  + ++ RGS G G   +  +   +G ++V D ++ SE  +R+    +D  ++ ++G S+GG+ A+   A      +     +PV N            W   +     ++    N  D    +E S LS  VD ++    L++ G  D  V   Q + L ++L ++ V  +  IYP + H L+ V+
Sbjct:  693 PTILHVYSGPGSQLVTDHWHVDWNTYLSGSKDYIVVEIDGRGSAGQGYQLLHEVYKRLGSVEVSDQLEVSE-YLRDNLHFIDSRRMGVWGWSYGGYTAALALAGQQSIFQCGISVSPVTN------------WKLYDSTYAERYLSFPNVTDNYKGYEESDLSKYVDNLRDRQFLLVHGTADDNVHVQQSMVLARSLTSKGVLYKQQIYPDEGHSLSGVK 899          
BLAST of SMED30008513 vs. Ensembl Fly
Match: CG11319 (gene:FBgn0031835 transcript:FBtr0343160)

HSP 1 Score: 53.1434 bits (126), Expect = 1.440e-6
Identity = 53/220 (24.09%), Postives = 95/220 (43.18%), Query Frame = -3
Query: 1162 PMILMLHGGPHSAFYTDFTVFGAAVAELG---FHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLS-LVDKIK-CPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVE 1806
            P IL ++ GP S   TD           G   +  + ++ RGS G G   +  +   +G ++V D ++ SE  +R+    +D  ++ ++G S+GG+ A+   A      +     +PV N            W   +     ++    N  D    +E S LS  VD ++    L++ G  D  V   Q + L ++L ++ V  +  IYP + H L+ V+
Sbjct:  693 PTILHVYSGPGSQLVTDHWHVDWNTYLSGSKDYIVVEIDGRGSAGQGYQLLHEVYKRLGSVEVSDQLEVSE-YLRDNLHFIDSRRMGVWGWSYGGYTAALALAGQQSIFQCGISVSPVTN------------WKLYDSTYAERYLSFPNVTDNYKGYEESDLSKYVDNLRDRQFLLVHGTADDNVHVQQSMVLARSLTSKGVLYKQQIYPDEGHSLSGVK 899          
BLAST of SMED30008513 vs. Ensembl Fly
Match: CG11319 (gene:FBgn0031835 transcript:FBtr0089641)

HSP 1 Score: 53.1434 bits (126), Expect = 1.440e-6
Identity = 53/220 (24.09%), Postives = 95/220 (43.18%), Query Frame = -3
Query: 1162 PMILMLHGGPHSAFYTDFTVFGAAVAELG---FHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLS-LVDKIK-CPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVE 1806
            P IL ++ GP S   TD           G   +  + ++ RGS G G   +  +   +G ++V D ++ SE  +R+    +D  ++ ++G S+GG+ A+   A      +     +PV N            W   +     ++    N  D    +E S LS  VD ++    L++ G  D  V   Q + L ++L ++ V  +  IYP + H L+ V+
Sbjct:  693 PTILHVYSGPGSQLVTDHWHVDWNTYLSGSKDYIVVEIDGRGSAGQGYQLLHEVYKRLGSVEVSDQLEVSE-YLRDNLHFIDSRRMGVWGWSYGGYTAALALAGQQSIFQCGISVSPVTN------------WKLYDSTYAERYLSFPNVTDNYKGYEESDLSKYVDNLRDRQFLLVHGTADDNVHVQQSMVLARSLTSKGVLYKQQIYPDEGHSLSGVK 899          
BLAST of SMED30008513 vs. Ensembl Zebrafish
Match: apeh (acylaminoacyl-peptide hydrolase [Source:ZFIN;Acc:ZDB-GENE-030131-9870])

HSP 1 Score: 383.259 bits (983), Expect = 4.052e-118
Identity = 240/733 (32.74%), Postives = 380/733 (51.84%), Query Frame = -3
Query: 1117 ITSVYKSYARYPNLNSAKFLNNADPYIIS----------STWTVNDLVTSKTKNLNLNFYY---EKDKNLILKSPQVLMDE--EIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQN-------------VSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDH--IPEFDHPKFGKKKYQSIFISSK---KEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 3213
            I  +Y+   R+P+L  A    +  P I S          + WT  DL   + +N+     Y     DK+++   P     E    ++ V S S + +A+  E   N + G+E +   + +W     +K +NL  ++ HG V++    FG   W      L+YIAE K+PK  S+FQ              +  D+  + +  G+QF+Y +D+GE L +  +PV+C+LD++   I VL+       +S G     P   GL F G+ + P+ LGL  C  R   LFY  L S +  ++  ++ S  SP+ SPD   I++LE+  S  H+QC RL  ++  T  T VVVDVV+    + FTG+Y+  L+  CW+ DS  +L  SA + + ++ ++D  ++ +  L       S  LL+++   ++V  SSP++ P L +G L     E+++  V L       ++ + Q L+    PE D+ ++    + ++ +  K    +G  P+I+M HGGPHS   +++ +  A + ++GF  L+VNYRGS G+GQD++ SL G  G  DVKD   A + ++++     D  K+ + GGSHGGFLA HL   Y    K+   RNP  NL SM   TDIPDW   E G  +K D  L    +  M  +SP+  V K+K P+L+M+G+ DKRVP  QG+E YKAL++  V   +  YP + H L+ V+A SD F+N   W  +
Sbjct:   28 IAQLYRDQCRFPSLCRA----DVGPVITSGYGGQYSNIYTEWTQRDL--ERMENVKFCRQYIVFHHDKSVVYSGPSGNCTEIRGELLSVDSPSGEMKAVLRE---NTTEGEEKQ--FLEIWHKNRKLKCLNLTTLNKHGKVYEDD-QFGCLVWSHSETHLLYIAEKKRPKTESYFQQGPETSLTPDEEEPIKTDKKEETVP-GHQFEYYEDWGENLVSKSSPVLCVLDIEGSNISVLEGIPA--AISPGQAFWAPADTGLLFVGWWHEPFRLGLKSCGNRRSSLFYVDLASGKCDQLSSDSISVCSPRLSPDHCRIVYLESGVSCSHLQCHRLCVFDWYTKQTSVVVDVVQRARDDGFTGIYSFLLSPRCWSADSERVLFCSAQRSRKELFVVDTSSREITRLTSQSQEGSWNLLNIHRDLMVVSCSSPNSPPDLRVGFLPGKGSESKISWVTLEESQPQSDI-SWQTLNFSPPPEQDNTQYPGLDFDALLLKPKDTPADGKLPLIVMPHGGPHSVLVSEWILSTAVLCKMGFSVLLVNYRGSLGFGQDNVFSLPGNCGTQDVKDVQFAVDSVLKQ--GGFDEQKVAVIGGSHGGFLACHLIGQYPGFYKACVARNPT-NLASMVCCTDIPDWCIVEAGFDYKPDIQLEPAILEQMLIKSPIKHVAKVKTPVLLMLGEGDKRVPNKQGIEYYKALKSLQVPVRVLWYPGNNHSLSKVDAESDGFMNGALWMIQ 741          
BLAST of SMED30008513 vs. Ensembl Zebrafish
Match: zgc:136971 (zgc:136971 [Source:ZFIN;Acc:ZDB-GENE-060421-3674])

HSP 1 Score: 343.199 bits (879), Expect = 1.373e-103
Identity = 199/617 (32.25%), Postives = 330/617 (53.48%), Query Frame = -3
Query: 1117 ESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKK--PKKLSFFQNVSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEP-ITEFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVS-------ETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP-EFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 2925
            E+    + +W      KS++L  ++ HG V++ +  FG   W    +KL+Y+AE K+  P   S F + + D     +E  ++  Y +D+GE L    +PV+C+ D+++  + +       P +S       PNG G+ F G  N P+ LGL +C  R   L+Y  +     + +  +  S  SP+ SPD  +I++L+ +  GPH QC  +M Y++    + V+VDV++     +F G+Y   L  +CW+ DS  +  +SA  C+NK  +  +      I+ V        +   S  LL +    +++  SSP+  P L  G L       +M+L  L     ++      +L   P + ++ +F    + +I +   S  +    P+++ +HGGPH+ F  D+    AA+ +LGF  LMVNYRGS G+GQDSI+SLLG +G  DVKD  +A    ++   + +D +++ + GGSHGGFLA HL   Y D  ++ A RNPVIN  ++   +DI DW ++  G+++ FD L   + + +M ++SP+    +I+ P+L+M+G  D+RV P QGLELY+AL++R+    L  +  + H L+ V   SD F+N+L WF E
Sbjct:  103 EAGHQYLEVWGQNGLEKSLDLTALNKHGRVYEDA-QFGCLAWSPCEKKLLYVAEKKRVEPSVHSSFGSANEDGGLVLLEEQDKNVYVEDWGEGLVGKSSPVLCVADLNKATVIIYAGVP--PHISPAQALWAPNGRGVVFVGLWNEPFRLGLKFCSNRRSALYYLDMKGN-CECLSSDGMSVSSPRMSPDSCWIVYLQGEVFGPHHQCLSMMLYDMKNRSSSVLVDVIRRAEKGQFAGIYE-SLPSHCWSADSERVFFSSA--CENKKAVFSVDRTTGKIIQVCGLDVLRLDDFGSVQLLTIQKDLMVLSCSSPNQPPCLRAGFLSKVNRAEDMQLSNLGGADVYEGFDWQPMLITPPSQEENHQFSGLNFGAILLKPYSPPERRKTPLVVNIHGGPHAHFAADWNATAAALTKLGFAVLMVNYRGSTGFGQDSIESLLGNVGSQDVKDVQRAVLCALQN-ETTLDPDRVVVMGGSHGGFLACHLIGQYPDFYRACAARNPVINAATLLGTSDIVDWRYSSVGLQYAFDRLPTSQSLISMLDKSPIIHAPQIRAPVLLMLGGRDRRVSPHQGLELYRALKSRNTPVRLLWFSDEGHTLSKVNTQSDCFLNILLWFKE 711          
BLAST of SMED30008513 vs. Ensembl Zebrafish
Match: zgc:136971 (zgc:136971 [Source:ZFIN;Acc:ZDB-GENE-060421-3674])

HSP 1 Score: 343.199 bits (879), Expect = 1.373e-103
Identity = 199/617 (32.25%), Postives = 330/617 (53.48%), Query Frame = -3
Query: 1117 ESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKK--PKKLSFFQNVSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEP-ITEFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVS-------ETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP-EFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 2925
            E+    + +W      KS++L  ++ HG V++ +  FG   W    +KL+Y+AE K+  P   S F + + D     +E  ++  Y +D+GE L    +PV+C+ D+++  + +       P +S       PNG G+ F G  N P+ LGL +C  R   L+Y  +     + +  +  S  SP+ SPD  +I++L+ +  GPH QC  +M Y++    + V+VDV++     +F G+Y   L  +CW+ DS  +  +SA  C+NK  +  +      I+ V        +   S  LL +    +++  SSP+  P L  G L       +M+L  L     ++      +L   P + ++ +F    + +I +   S  +    P+++ +HGGPH+ F  D+    AA+ +LGF  LMVNYRGS G+GQDSI+SLLG +G  DVKD  +A    ++   + +D +++ + GGSHGGFLA HL   Y D  ++ A RNPVIN  ++   +DI DW ++  G+++ FD L   + + +M ++SP+    +I+ P+L+M+G  D+RV P QGLELY+AL++R+    L  +  + H L+ V   SD F+N+L WF E
Sbjct:  103 EAGHQYLEVWGQNGLEKSLDLTALNKHGRVYEDA-QFGCLAWSPCEKKLLYVAEKKRVEPSVHSSFGSANEDGGLVLLEEQDKNVYVEDWGEGLVGKSSPVLCVADLNKATVIIYAGVP--PHISPAQALWAPNGRGVVFVGLWNEPFRLGLKFCSNRRSALYYLDMKGN-CECLSSDGMSVSSPRMSPDSCWIVYLQGEVFGPHHQCLSMMLYDMKNRSSSVLVDVIRRAEKGQFAGIYE-SLPSHCWSADSERVFFSSA--CENKKAVFSVDRTTGKIIQVCGLDVLRLDDFGSVQLLTIQKDLMVLSCSSPNQPPCLRAGFLSKVNRAEDMQLSNLGGADVYEGFDWQPMLITPPSQEENHQFSGLNFGAILLKPYSPPERRKTPLVVNIHGGPHAHFAADWNATAAALTKLGFAVLMVNYRGSTGFGQDSIESLLGNVGSQDVKDVQRAVLCALQN-ETTLDPDRVVVMGGSHGGFLACHLIGQYPDFYRACAARNPVINAATLLGTSDIVDWRYSSVGLQYAFDRLPTSQSLISMLDKSPIIHAPQIRAPVLLMLGGRDRRVSPHQGLELYRALKSRNTPVRLLWFSDEGHTLSKVNTQSDCFLNILLWFKE 711          
BLAST of SMED30008513 vs. Ensembl Zebrafish
Match: zgc:136971 (zgc:136971 [Source:ZFIN;Acc:ZDB-GENE-060421-3674])

HSP 1 Score: 313.538 bits (802), Expect = 9.205e-93
Identity = 192/619 (31.02%), Postives = 322/619 (52.02%), Query Frame = -3
Query: 1117 ESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKK--PKKLSFFQNVSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSK-EIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEP-ITEFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVS-------ETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP-EFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHG-GPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 2925
            E+    + +W      KS++L  ++ HG V++ +  FG   W    +KL+Y+AE K+  P   S F + + D     +E  ++  Y +D+GE L    +PV+C+ D+++  + +       P +S       PNG G+ F G  N P+ LGL +C  R   L+Y  LD K   + +  +  S  SP+ SPD  +I++L+ +  GPH QC  +M Y++    + V+VDV++     +F G+Y   L  +CW+ DS  +  +SA  C+NK  +  +      I+ V        +   S  LL +    +++  SSP+  P L  G L       +M+L  L     ++      +L   P + ++ +F    + +I +   S  +    P+++ +H    HS+   +      A+       + VNYRGS G+GQDSI+SLLG +G  DVKD  +A    ++   + +D +++ + GGSHGGFLA HL   Y D  ++ A RNPVIN  ++   +DI DW ++  G+++ FD L   + + +M ++SP+    +I+ P+L+M+G  D+RV P QGLELY+AL++R+    L  +  + H L+ V   SD F+N+L WF E
Sbjct:  103 EAGHQYLEVWGQNGLEKSLDLTALNKHGRVYEDA-QFGCLAWSPCEKKLLYVAEKKRVEPSVHSSFGSANEDGGLVLLEEQDKNVYVEDWGEGLVGKSSPVLCVADLNKATVIIYAGVP--PHISPAQALWAPNGRGVVFVGLWNEPFRLGLKFCSNRRSALYY--LDMKGNCECLSSDGMSVSSPRMSPDSCWIVYLQGEVFGPHHQCLSMMLYDMKNRSSSVLVDVIRRAEKGQFAGIYE-SLPSHCWSADSERVFFSSA--CENKKAVFSVDRTTGKIIQVCGLDVLRLDDFGSVQLLTIQKDLMVLSCSSPNQPPCLRAGFLSKVNRAEDMQLSNLGGADVYEGFDWQPMLITPPSQEENHQFSGLNFGAILLKPYSPPERRKTPLVVNIHVFKCHSSSSDNIKSRKRALVYSVILYIAVNYRGSTGFGQDSIESLLGNVGSQDVKDVQRAVLCALQN-ETTLDPDRVVVMGGSHGGFLACHLIGQYPDFYRACAARNPVINAATLLGTSDIVDWRYSSVGLQYAFDRLPTSQSLISMLDKSPIIHAPQIRAPVLLMLGGRDRRVSPHQGLELYRALKSRNTPVRLLWFSDEGHTLSKVNTQSDCFLNILLWFKE 712          
BLAST of SMED30008513 vs. Ensembl Xenopus
Match: APEH (acylaminoacyl-peptide hydrolase [Source:NCBI gene;Acc:100491896])

HSP 1 Score: 411.379 bits (1056), Expect = 7.950e-129
Identity = 246/723 (34.02%), Postives = 379/723 (52.42%), Query Frame = -3
Query: 1126 KNITSVYKSYARYPNLNSAKFLNNADPYI------ISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEI---IMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIE----------IGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPIT-EFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETV-NSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP-EFDHPKFGKKKYQSIFISSKK---EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWW 3219
            K+I ++Y+ ++++P+L+S                 I + W+  DL  S+       +    D N ++ S       EI   ++   S S   +A+  E K+     K   T  + +W     +KSINL  +D HG V++    FG   W      L+YIAE K+PK  SFFQ  + + S    E           G+QF   +D+GE L N   P +C+LD++   I VL+   +   +S G     P+  G+ F G+ + P+ +GL YC  R   LF+  L   + + +  ++ +  SP+ SPD   I++L+ +  GPH QC +L+ Y+  T  T VVVD V   I  +F+G+Y   L   CW+ DS  ++L++A   Q  + ++D  T NV  L   E+   S  L+ ++   L+V  SSPS  P L +G L S+  E E+  + L       ++       H P E ++PK+    ++SI +  K    E   P+++  HGGPHS F +++ +F A + ++GF   +VNYRGS G+GQDSI SL G IG  DVKD   A E +++E P  +D +KI L GGSHGGFL+ HL   Y     +   RNPV N+ +M  +TDIPDW   E G+ +  + L +      M ++SP+  V ++K P+L+M+G++D+RVP  QGLE Y+AL+A  V   L  YP + H LA V+A SD F+N+  W
Sbjct:    6 KDIAALYREFSQFPSLSSVSIGPEVTTQYGGKYSNIYTEWSQRDLDRSEQVKFCRQYIVFHDNNTVVYSGACGNGSEIKGELLSKESPSGTLKAVLRETKNI----KGEDTQFLEIWERNRKVKSINLTALDKHGKVYEDE-QFGCLSWSHSETHLLYIAERKRPKAESFFQAATGELSTGASEEEEDGINKPIKGDQFVLHEDWGEGLVNKSVPALCVLDIEGSNISVLEG--IPDHISPGQAFWSPDDTGVVFVGWWHSPFRVGLKYCANRRSALFFVDLTGGKCEMLSSDSSAVFSPRLSPDKCRIVYLKCNVYGPHQQCCQLVMYDWYTKVTSVVVDTVPRSIEGKFSGIYTSLLAPFCWSADSQRVILSTAQHSQENLFVVDTMTGNVTHLFSKESSPGSWKLMAIDRDLLVVSFSSPSCPPTLKVGFLPSSGREEEITWISLEEESPIVDIEWSFKTHHPPQEQENPKYPGLVFESILLKPKNSPPESKIPLVVYPHGGPHSTFVSEWMLFPAVLCKMGFAVQLVNYRGSLGFGQDSILSLPGNIGDQDVKDVQFAVEQVLKEDP--IDPHKIVLCGGSHGGFLSCHLIGQYPGFYVACIARNPVTNVPAMVGSTDIPDWCLVESGLPYSSETLPDPAQWGDMLKKSPIGYVSQVKTPVLLMLGEEDRRVPNKQGLEYYRALKAHGVPARLLWYPGNNHSLAKVDAESDGFMNIALW 719          
BLAST of SMED30008513 vs. Ensembl Xenopus
Match: APEH (acylaminoacyl-peptide hydrolase [Source:NCBI gene;Acc:100491896])

HSP 1 Score: 410.994 bits (1055), Expect = 2.127e-128
Identity = 246/723 (34.02%), Postives = 379/723 (52.42%), Query Frame = -3
Query: 1126 KNITSVYKSYARYPNLNSAKFLNNADPYI------ISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEI---IMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIE----------IGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPIT-EFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETV-NSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP-EFDHPKFGKKKYQSIFISSKK---EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWW 3219
            K+I ++Y+ ++++P+L+S                 I + W+  DL  S+       +    D N ++ S       EI   ++   S S   +A+  E K+     K   T  + +W     +KSINL  +D HG V++    FG   W      L+YIAE K+PK  SFFQ  + + S    E           G+QF   +D+GE L N   P +C+LD++   I VL+   +   +S G     P+  G+ F G+ + P+ +GL YC  R   LF+  L   + + +  ++ +  SP+ SPD   I++L+ +  GPH QC +L+ Y+  T  T VVVD V   I  +F+G+Y   L   CW+ DS  ++L++A   Q  + ++D  T NV  L   E+   S  L+ ++   L+V  SSPS  P L +G L S+  E E+  + L       ++       H P E ++PK+    ++SI +  K    E   P+++  HGGPHS F +++ +F A + ++GF   +VNYRGS G+GQDSI SL G IG  DVKD   A E +++E P  +D +KI L GGSHGGFL+ HL   Y     +   RNPV N+ +M  +TDIPDW   E G+ +  + L +      M ++SP+  V ++K P+L+M+G++D+RVP  QGLE Y+AL+A  V   L  YP + H LA V+A SD F+N+  W
Sbjct:   25 KDIAALYREFSQFPSLSSVSIGPEVTTQYGGKYSNIYTEWSQRDLDRSEQVKFCRQYIVFHDNNTVVYSGACGNGSEIKGELLSKESPSGTLKAVLRETKNI----KGEDTQFLEIWERNRKVKSINLTALDKHGKVYEDE-QFGCLSWSHSETHLLYIAERKRPKAESFFQAATGELSTGASEEEEDGINKPIKGDQFVLHEDWGEGLVNKSVPALCVLDIEGSNISVLEG--IPDHISPGQAFWSPDDTGVVFVGWWHSPFRVGLKYCANRRSALFFVDLTGGKCEMLSSDSSAVFSPRLSPDKCRIVYLKCNVYGPHQQCCQLVMYDWYTKVTSVVVDTVPRSIEGKFSGIYTSLLAPFCWSADSQRVILSTAQHSQENLFVVDTMTGNVTHLFSKESSPGSWKLMAIDRDLLVVSFSSPSCPPTLKVGFLPSSGREEEITWISLEEESPIVDIEWSFKTHHPPQEQENPKYPGLVFESILLKPKNSPPESKIPLVVYPHGGPHSTFVSEWMLFPAVLCKMGFAVQLVNYRGSLGFGQDSILSLPGNIGDQDVKDVQFAVEQVLKEDP--IDPHKIVLCGGSHGGFLSCHLIGQYPGFYVACIARNPVTNVPAMVGSTDIPDWCLVESGLPYSSETLPDPAQWGDMLKKSPIGYVSQVKTPVLLMLGEEDRRVPNKQGLEYYRALKAHGVPARLLWYPGNNHSLAKVDAESDGFMNIALW 738          
BLAST of SMED30008513 vs. Ensembl Xenopus
Match: APEH (acylaminoacyl-peptide hydrolase [Source:NCBI gene;Acc:100491896])

HSP 1 Score: 407.527 bits (1046), Expect = 2.605e-127
Identity = 245/727 (33.70%), Postives = 378/727 (51.99%), Query Frame = -3
Query: 1126 KNITSVYKSYARYPNLNSAKFLNNADPYI------ISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEI---IMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIE---------------IGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPIT-EFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP-EFDHPKFGKKKYQSIFISSKK---EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWW 3219
            K+I ++Y+ ++++P+L+S                 I + W+  DL  S+       +    D N ++ S       EI   ++   S S   +A+  E K+     K   T  + +W     +KSINL  +D HG V++    FG   W      L+YIAE K+PK  SFFQ  + + S    E                G+QF   +D+GE L N   P +C+LD++   I VL+   +   +S G     P+  G+ F G+ + P+ +GL YC  R   LF+  L   + + +  ++ +  SP+ SPD   I++L+ +  GPH QC +L+ Y+  T  T VVVD V   I  +F+G+Y   L   CW+ DS  ++L++A   Q  + ++D  T NV  L    +  S  L+ ++   L+V  SSPS  P L +G L S+  E E+  + L       ++       H P E ++PK+    ++SI +  K    E   P+++  HGGPHS F +++ +F A + ++GF   +VNYRGS G+GQDSI SL G IG  DVKD   A E +++E P  +D +KI L GGSHGGFL+ HL   Y     +   RNPV N+ +M  +TDIPDW   E G+ +  + L +      M ++SP+  V ++K P+L+M+G++D+RVP  QGLE Y+AL+A  V   L  YP + H LA V+A SD F+N+  W
Sbjct:    8 KDIAALYREFSQFPSLSSVSIGPEVTTQYGGKYSNIYTEWSQRDLDRSEQVKFCRQYIVFHDNNTVVYSGACGNGSEIKGELLSKESPSGTLKAVLRETKNI----KGEDTQFLEIWERNRKVKSINLTALDKHGKVYEDE-QFGCLSWSHSETHLLYIAERKRPKAESFFQAATGELSTGASEEEEDGINKPIKVRDGSGDQFVLHEDWGEGLVNKSVPALCVLDIEGSNISVLEG--IPDHISPGQAFWSPDDTGVVFVGWWHSPFRVGLKYCANRRSALFFVDLTGGKCEMLSSDSSAVFSPRLSPDKCRIVYLKCNVYGPHQQCCQLVMYDWYTKVTSVVVDTVPRSIEGKFSGIYTSLLAPFCWSADSQRVILSTAQHSQENLFVVDTMTGNVTHLF---SKGSWKLMAIDRDLLVVSFSSPSCPPTLKVGFLPSSGREEEITWISLEEESPIVDIEWSFKTHHPPQEQENPKYPGLVFESILLKPKNSPPESKIPLVVYPHGGPHSTFVSEWMLFPAVLCKMGFAVQLVNYRGSLGFGQDSILSLPGNIGDQDVKDVQFAVEQVLKEDP--IDPHKIVLCGGSHGGFLSCHLIGQYPGFYVACIARNPVTNVPAMVGSTDIPDWCLVESGLPYSSETLPDPAQWGDMLKKSPIGYVSQVKTPVLLMLGEEDRRVPNKQGLEYYRALKAHGVPARLLWYPGNNHSLAKVDAESDGFMNIALW 722          
BLAST of SMED30008513 vs. Ensembl Xenopus
Match: APEH (acylaminoacyl-peptide hydrolase [Source:NCBI gene;Acc:100491896])

HSP 1 Score: 387.111 bits (993), Expect = 8.430e-120
Identity = 236/721 (32.73%), Postives = 366/721 (50.76%), Query Frame = -3
Query: 1126 KNITSVYKSYARYPNLNSAKFLNNADPYI------ISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEI---IMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIE----------IGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITEFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP-EFDHPKFGKKKYQSIFISSKK---EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWW 3219
            K+I ++Y+ ++++P+L+S                 I + W+  DL  S+       +    D N ++ S       EI   ++   S S   +A+  E K+     K   T  + +W     +KSINL  +D HG V++    FG   W      L+YIAE K+PK  SFFQ  + + S    E           G+QF   +D+GE L N   P +C+LD++   I VL+   +   +S G     P+  G+ F G+ + P+ +GL YC  R   LF+  L   + + +  ++ +  SP+ SPD   I++L+ +  GPH QC                    K    +F+G+Y   L   CW+ DS  ++L++A   Q  + ++D  T NV  L    +  S  L+ ++   L+V  SSPS  P L +G L S+  E E+  + L       ++       H P E ++PK+    ++SI +  K    E   P+++  HGGPHS F +++ +F A + ++GF   +VNYRGS G+GQDSI SL G IG  DVKD   A E +++E P  +D +KI L GGSHGGFL+ HL   Y     +   RNPV N+ +M  +TDIPDW   E G+ +  + L +      M ++SP+  V ++K P+L+M+G++D+RVP  QGLE Y+AL+A  V   L  YP + H LA V+A SD F+N+  W
Sbjct:    8 KDIAALYREFSQFPSLSSVSIGPEVTTQYGGKYSNIYTEWSQRDLDRSEQVKFCRQYIVFHDNNTVVYSGACGNGSEIKGELLSKESPSGTLKAVLRETKNI----KGEDTQFLEIWERNRKVKSINLTALDKHGKVYEDE-QFGCLSWSHSETHLLYIAERKRPKAESFFQAATGELSTGASEEEEDGINKPIKGDQFVLHEDWGEGLVNKSVPALCVLDIEGSNISVLEG--IPDHISPGQAFWSPDDTGVVFVGWWHSPFRVGLKYCANRRSALFFVDLTGGKCEMLSSDSSAVFSPRLSPDKCRIVYLKCNVYGPHQQCCH---------------SYTKLQCRKFSGIYTSLLAPFCWSADSQRVILSTAQHSQENLFVVDTMTGNVTHLF---SKGSWKLMAIDRDLLVVSFSSPSCPPTLKVGFLPSSGREEEITWISLEEESPIVDIEWSFKTHHPPQEQENPKYPGLVFESILLKPKNSPPESKIPLVVYPHGGPHSTFVSEWMLFPAVLCKMGFAVQLVNYRGSLGFGQDSILSLPGNIGDQDVKDVQFAVEQVLKEDP--IDPHKIVLCGGSHGGFLSCHLIGQYPGFYVACIARNPVTNVPAMVGSTDIPDWCLVESGLPYSSETLPDPAQWGDMLKKSPIGYVSQVKTPVLLMLGEEDRRVPNKQGLEYYRALKAHGVPARLLWYPGNNHSLAKVDAESDGFMNIALW 701          
BLAST of SMED30008513 vs. Ensembl Xenopus
Match: APEH (acylaminoacyl-peptide hydrolase [Source:NCBI gene;Acc:100491896])

HSP 1 Score: 376.711 bits (966), Expect = 4.312e-116
Identity = 230/687 (33.48%), Postives = 354/687 (51.53%), Query Frame = -3
Query: 1126 ISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEI---IMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIE----------IGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPIT-EFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP-EFDHPKFGKKKYQSIFISSK---KEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWW 3132
            I + W+  DL  S+       +    D N ++ S       EI   ++   S S   +A+  E K+     K   T  + +W     +KSINL  +D HG V++    FG   W      L+YIAE K+PK  SFFQ  + + S    E           G+QF   +D+GE L N   P +C+LD++   I VL+   +   +S G     P+  G+ F G+ + P+ +GL YC  R   LF+  L   + + +  ++ +  SP+ SPD   I++L+ +  GPH QC +L+ Y+  T  T VVVD V   I  +F+G+Y   L   CW+ DS  ++L++A   Q  + ++D  T N        +  S  L+ ++   L+V  SSPS  P L +G L S+  E E+  + L       ++       H P E ++PK+    ++SI +  K    E   P+++  HGGPHS F +++ +F A + ++GF   +VNYRGS G+GQDSI SL           C+   E +++E P  +D +KI L GGSHGGFL+ HL   Y     +   RNPV N+ +M  +TDIPDW   E G+ +  + L +      M ++SP+  V ++K P+L+M+G++D+RVP  QGLE Y+AL+A  V   L  YP + H LA V+A SD F+N+  W
Sbjct:   32 IYTEWSQRDLDRSEQVKFCRQYIVFHDNNTVVYSGACGNGSEIKGELLSKESPSGTLKAVLRETKNI----KGEDTQFLEIWERNRKVKSINLTALDKHGKVYEDE-QFGCLSWSHSETHLLYIAERKRPKAESFFQAATGELSTGASEEEEDGINKPIKGDQFVLHEDWGEGLVNKSVPALCVLDIEGSNISVLEG--IPDHISPGQAFWSPDDTGVVFVGWWHSPFRVGLKYCANRRSALFFVDLTGGKCEMLSSDSSAVFSPRLSPDKCRIVYLKCNVYGPHQQCCQLVMYDWYTKVTSVVVDTVPRSIEGKFSGIYTSLLAPFCWSADSQRVILSTAQHSQENLFVVDTMTGN-------SSPGSWKLMAIDRDLLVVSFSSPSCPPTLKVGFLPSSGREEEITWISLEEESPIVDIEWSFKTHHPPQEQENPKYPGLVFESILLKPKNSPPESKIPLVVYPHGGPHSTFVSEWMLFPAVLCKMGFAVQLVNYRGSLGFGQDSILSLPD-----TYTLCL---EQVLKEDP--IDPHKIVLCGGSHGGFLSCHLIGQYPGFYVACIARNPVTNVPAMVGSTDIPDWCLVESGLPYSSETLPDPAQWGDMLKKSPIGYVSQVKTPVLLMLGEEDRRVPNKQGLEYYRALKAHGVPARLLWYPGNNHSLAKVDAESDGFMNIALW 694          
BLAST of SMED30008513 vs. Ensembl Mouse
Match: Apeh (acylpeptide hydrolase [Source:MGI Symbol;Acc:MGI:88041])

HSP 1 Score: 406.371 bits (1043), Expect = 6.262e-127
Identity = 233/730 (31.92%), Postives = 382/730 (52.33%), Query Frame = -3
Query: 1123 MSVLKNITSVYKSYARYPNLNSAKFLNNADPY------IISSTWTVNDLVTSKTKNLNLNFYY---EKDKNLILKSP--QVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNV-LNCQILDHIPEFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3231
            +S  +   ++Y+  +R P+L++A                + + WT  DL   + +N+     Y       +++   P    +     ++   S S   +A+   RK+  +   E K   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D SA   E+           G+QF + +D+GE + +   PV+C+LD++   I VL+       +S G     P   G+ F G+ + P+ LG+ YC  R   L+Y  L   + + + DE+ +  SP+ SPD   +++L+  +  PH QC +L  Y+  T  T +VVD+V   + E F+G+Y   L   CW+ DS  ++  S  + +  +  +D +T +V  L    +  S  LL ++   ++ + S+P+  P L +G L  A  E  +  V L       ++    ++L   P+ ++ ++    +++I +   +S  +   PM++M HGGPHS+F T + +F A + ++GF  L+VNYRGS G+GQDSI SL G +G  DVKD   A + +++E     D  ++ L GGSHGGFL+ HL   Y +   +   RNPVIN++SM   TDIPDW   E G  +  DYL +   +  M ++SP+  + ++K P+L+M+GQ+D+RVP  QGLE Y AL+AR+V   L +YPK  H L+ VE  SDSF+N + W 
Sbjct:    7 LSEPQEAAALYRGLSRQPSLSAACLGPEVTTQYGGLYRTVHTEWTQRDL--DRMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVL--RKAGGAVSGEEK-QFLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDEEMARPKKPDQAIKGDQFVFYEDWGETMVSKSIPVLCVLDIESGNISVLEGVP--ENVSPGQAFWAPGDTGVVFVGWWHEPFRLGIRYCTNRRSALYYVDLSGGKCELLSDESLAVCSPRLSPDQCRVVYLQYPSLAPHHQCSQLFLYDWYTKVTSLVVDIVPRQLGESFSGIYCSLLPLGCWSADSQRVVFDSVQRSRQDLFAVDTQTGSVTSLTAGGSAGSWKLLTIDRDLMVAQFSTPNLPPSLKVGFLPPAGKEQSVSWVSLEEAEPIPDIHWGIRVLHPPPDQENVQYADLDFEAILLQPSNSPDKSQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVQQVLQE--EHFDARRVALMGGSHGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVETGFPYSNDYLPDLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYPKSTHALSEVEVESDSFMNTVLWL 726          
BLAST of SMED30008513 vs. Ensembl Mouse
Match: Apeh (acylpeptide hydrolase [Source:MGI Symbol;Acc:MGI:88041])

HSP 1 Score: 377.867 bits (969), Expect = 1.765e-116
Identity = 225/730 (30.82%), Postives = 371/730 (50.82%), Query Frame = -3
Query: 1123 MSVLKNITSVYKSYARYPNLNSAKFLNNADPY------IISSTWTVNDLVTSKTKNLNLNFYY---EKDKNLILKSP--QVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNV-LNCQILDHIPEFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3231
            +S  +   ++Y+  +R P+L++A                + + WT  DL   + +N+     Y       +++   P    +     ++   S S   +A+   RK+  +   E K   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D SA   E+           G+QF + +D+GE + +   PV+C+LD++   I VL+       +S G     P   G+ F G+ + P+ LG+ YC  R   L+Y  L   + + + DE+ +  SP+ SPD   +++L+  +  PH QC +L  Y+  T  T +VVD+V   + E F+G+Y   L   CW+ DS  ++  S  + +  +  +D +T +V  L    +  S  LL ++   ++ + S+P+  P L +G L  A  E  +  V L       ++    ++L   P+ ++ ++    +++I +   +S  +   PM++M H               A + ++GF  L+VNYRGS G+GQDSI SL G +G  DVKD   A + +++E     D  ++ L GGSHGGFL+ HL   Y +   +   RNPVIN++SM   TDIPDW   E G  +  DYL +   +  M ++SP+  + ++K P+L+M+GQ+D+RVP  QGLE Y AL+AR+V   L +YPK  H L+ VE  SDSF+N + W 
Sbjct:    6 LSEPQEAAALYRGLSRQPSLSAACLGPEVTTQYGGLYRTVHTEWTQRDL--DRMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVL--RKAGGAVSGEEK-QFLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDEEMARPKKPDQAIKGDQFVFYEDWGETMVSKSIPVLCVLDIESGNISVLEGVP--ENVSPGQAFWAPGDTGVVFVGWWHEPFRLGIRYCTNRRSALYYVDLSGGKCELLSDESLAVCSPRLSPDQCRVVYLQYPSLAPHHQCSQLFLYDWYTKVTSLVVDIVPRQLGESFSGIYCSLLPLGCWSADSQRVVFDSVQRSRQDLFAVDTQTGSVTSLTAGGSAGSWKLLTIDRDLMVAQFSTPNLPPSLKVGFLPPAGKEQSVSWVSLEEAEPIPDIHWGIRVLHPPPDQENVQYADLDFEAILLQPSNSPDKSQVPMVVMPH---------------AMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVQQVLQE--EHFDARRVALMGGSHGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVETGFPYSNDYLPDLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYPKSTHALSEVEVESDSFMNTVLWL 710          
BLAST of SMED30008513 vs. UniProt/SwissProt
Match: sp|Q8R146|APEH_MOUSE (Acylamino-acid-releasing enzyme OS=Mus musculus OX=10090 GN=Apeh PE=1 SV=3)

HSP 1 Score: 406.371 bits (1043), Expect = 4.380e-126
Identity = 233/730 (31.92%), Postives = 382/730 (52.33%), Query Frame = -3
Query: 1123 MSVLKNITSVYKSYARYPNLNSAKFLNNADPY------IISSTWTVNDLVTSKTKNLNLNFYY---EKDKNLILKSP--QVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNV-LNCQILDHIPEFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3231
            +S  +   ++Y+  +R P+L++A                + + WT  DL   + +N+     Y       +++   P    +     ++   S S   +A+   RK+  +   E K   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D SA   E+           G+QF + +D+GE + +   PV+C+LD++   I VL+       +S G     P   G+ F G+ + P+ LG+ YC  R   L+Y  L   + + + DE+ +  SP+ SPD   +++L+  +  PH QC +L  Y+  T  T +VVD+V   + E F+G+Y   L   CW+ DS  ++  S  + +  +  +D +T +V  L    +  S  LL ++   ++ + S+P+  P L +G L  A  E  +  V L       ++    ++L   P+ ++ ++    +++I +   +S  +   PM++M HGGPHS+F T + +F A + ++GF  L+VNYRGS G+GQDSI SL G +G  DVKD   A + +++E     D  ++ L GGSHGGFL+ HL   Y +   +   RNPVIN++SM   TDIPDW   E G  +  DYL +   +  M ++SP+  + ++K P+L+M+GQ+D+RVP  QGLE Y AL+AR+V   L +YPK  H L+ VE  SDSF+N + W 
Sbjct:    7 LSEPQEAAALYRGLSRQPSLSAACLGPEVTTQYGGLYRTVHTEWTQRDL--DRMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVL--RKAGGAVSGEEK-QFLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDEEMARPKKPDQAIKGDQFVFYEDWGETMVSKSIPVLCVLDIESGNISVLEGVP--ENVSPGQAFWAPGDTGVVFVGWWHEPFRLGIRYCTNRRSALYYVDLSGGKCELLSDESLAVCSPRLSPDQCRVVYLQYPSLAPHHQCSQLFLYDWYTKVTSLVVDIVPRQLGESFSGIYCSLLPLGCWSADSQRVVFDSVQRSRQDLFAVDTQTGSVTSLTAGGSAGSWKLLTIDRDLMVAQFSTPNLPPSLKVGFLPPAGKEQSVSWVSLEEAEPIPDIHWGIRVLHPPPDQENVQYADLDFEAILLQPSNSPDKSQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVQQVLQE--EHFDARRVALMGGSHGGFLSCHLIGQYPETYSACIARNPVINIVSMMGTTDIPDWCMVETGFPYSNDYLPDLNVLEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYPKSTHALSEVEVESDSFMNTVLWL 726          
BLAST of SMED30008513 vs. UniProt/SwissProt
Match: sp|P19205|ACPH_PIG (Acylamino-acid-releasing enzyme OS=Sus scrofa OX=9823 GN=APEH PE=1 SV=2)

HSP 1 Score: 402.134 bits (1032), Expect = 1.854e-124
Identity = 232/730 (31.78%), Postives = 379/730 (51.92%), Query Frame = -3
Query: 1123 MSVLKNITSVYKSYARYPNLNSAKFLNNADPY------IISSTWTVNDLVTSKTKNLNLNFYY---EKDKNLILKSPQ--VLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNV-LNCQILDHIPEFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3231
            +S  +   ++Y+  +R P L++A                + + WT  DL   + +N+     Y       +++   P    +     ++   S S   +A+   RK+  +   E K   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+A+ K+PK  SFFQ  + D +    E+           G+QF + +D+GE + +   PV+C+LD++   I VL+       +S G     P   G+ F G+ + P+ LG+ +C  R   L+Y  L   + + + DE+ +  SP+ SPD   I++L   +  PH QC +L  Y+  T  T VVVD+V   + E F+G+Y   L   CW+ DS  ++  S  + +  +  +D +  +V  L    +  S  LL ++   ++V+ S+PS  P L +G L  A  E  +  V L     F ++  + ++L   P+ +H ++    +++I +   +S ++   PM++M HGGPHS+F T + +F A + ++GF  L+VNYRGS G+GQDSI SL G +G  DVKD   A E +++E     D  ++ L GGSHGGFL+ HL   Y +   +   RNPVIN+ SM  +TDIPDW   E G  +  D L +      M ++SP+    ++K P+L+M+GQ+D+RVP  QG+E Y+ L+AR+V   L +YPK  H L+ VE  SDSF+N + W 
Sbjct:    7 LSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGRYRTVHTEWTQRDL--ERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVL--RKAGGTGTAEEK-QFLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVADKKRPKAESFFQTKALDVTGSDDEMARTKKPDQAIKGDQFLFYEDWGENMVSKSTPVLCVLDIESGNISVLEGVP--ESVSPGQAFWAPGDTGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLTGGKCELLSDESVAVTSPRLSPDQCRIVYLRFPSLVPHQQCGQLCLYDWYTRVTSVVVDIVPRQLGEDFSGIYCSLLPLGCWSADSQRVVFDSPQRSRQDLFAVDTQMGSVTSLTAGGSGGSWKLLTIDRDLMVVQFSTPSVPPSLKVGFLPPAGKEQAVSWVSLEEAEPFPDISWSIRVLQPPPQQEHVQYAGLDFEAILLQPSNSPEKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQE--EHFDAGRVALMGGSHGGFLSCHLIGQYPETYSACVVRNPVINIASMMGSTDIPDWCMVEAGFSYSSDCLPDLSVWAAMLDKSPIKYAPQVKTPLLLMLGQEDRRVPFKQGMEYYRVLKARNVPVRLLLYPKSTHALSEVEVESDSFMNAVLWL 726          
BLAST of SMED30008513 vs. UniProt/SwissProt
Match: sp|P13676|ACPH_RAT (Acylamino-acid-releasing enzyme OS=Rattus norvegicus OX=10116 GN=Apeh PE=1 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 2.510e-123
Identity = 233/730 (31.92%), Postives = 378/730 (51.78%), Query Frame = -3
Query: 1123 MSVLKNITSVYKSYARYPNLNSAKFLNNADPY------IISSTWTVNDLVTSKTKNLNLNFYY---EKDKNLILKSP--QVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNV-LNCQILDHIPEFDHPKFGKKKYQSIFISSKK---EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3231
            +S  +   ++Y+  +R P+L++A                + + WT  DL   + +N+     Y       +++   P    +     ++   S S   +A+ L +     SG+E +   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D SA   E+           G+QF + +D+GE + +   PV+C+LD+D   I VL+       +S G     P   G+ F G+ + P+ LG+ YC  R   L+Y  L   + + + D + +  SP+ SPD   I++L+     PH QC +L  Y+  T  T VVVD+V   + E F+G+Y   L   CW+ DS  ++  SA + +  +  +D +T ++  L  + +  S  LL ++   ++ + S+PS  P L +G L     E  +  V L        +    ++L   P+ ++ ++    +++I +       +   PM++M HGGPHS+F T + +F A + ++GF  L+VNYRGS G+GQDSI SL G +G  DVKD   A E +++E     D  ++ L GGSHGGFL+ HL   Y +   +   RNPVIN+ SM  +TDIPDW   E G  +    L +      M ++SP+  + ++K P+L+M+GQ+D+RVP  QG+E Y+AL+AR+V   L +YPK  H L+ VEA SDSF+N + W 
Sbjct:    7 LSEPQEAAALYRGLSRQPSLSAACLGPEVTTQYGGLYRTVHTEWTQRDL--ERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAV-LRKAGGTVSGEEKQ--FLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDISASDDEMARPKKPDQAIKGDQFVFYEDWGETMVSKSIPVLCVLDIDSGNISVLEGVP--ENVSPGQAFWAPGDTGVVFVGWWHEPFRLGIRYCTNRRSALYYVDLSGGKCELLSDGSLAICSPRLSPDQCRIVYLQYPCLAPHHQCSQLCLYDWYTKVTSVVVDIVPRQLGESFSGIYCSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQTGSITSLTAAGSAGSWKLLTIDKDLMVAQFSTPSLPPSLKVGFLPPPGKEQSVSWVSLEEAEPIPGIHWGVRVLHPPPDQENVQYADLDFEAILLQPSNPPDKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQE--EHFDARRVALMGGSHGGFLSCHLIGQYPETYSACIARNPVINIASMMGSTDIPDWCMVETGFPYSNSCLPDLNVWEEMLDKSPIKYIPQVKTPVLLMLGQEDRRVPFKQGMEYYRALKARNVPVRLLLYPKSNHALSEVEAESDSFMNAVLWL 726          
BLAST of SMED30008513 vs. UniProt/SwissProt
Match: sp|P80227|ACPH_BOVIN (Acylamino-acid-releasing enzyme OS=Bos taurus OX=9913 GN=APEH PE=1 SV=2)

HSP 1 Score: 385.956 bits (990), Expect = 1.777e-118
Identity = 231/725 (31.86%), Postives = 375/725 (51.72%), Query Frame = -3
Query: 1123 MSVLKNITSVYKSYARYPNLNSAKFLNNADPY------IISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNV-LNCQILDHIPEFDHPKFGKKKYQSIFISSKK---EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3231
            +S  +   ++Y+  +R P L++A                + + WT  DL   +       +    D + ++ +       E   ++ S       +    +   S+G+E +   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D S    E+           G+QF + +D+GE + + G+PV+C+LD++   I VL+       +S G     P   G+ F G+ + P+ LG+ +C  R   L+Y  L     + + D++ +  SP+ SPD   I++L+  +  PH QC +L  Y+  T  T VVVDVV   + E F+G+Y   L   CW+ DS  ++  +A + +  +  +D +   V  L    +  S  LL ++   ++ + S+P+  P L +G L  A +E E+  V L       ++  + ++L   PE +H ++    +++I I       +   PM++M HGGPHS+F T + +  A + ++GF AL+VNYRGS G+GQDSI SL G +G  DVKD   A E +++E     D  ++ L GGSHGGFL+ HL   Y +   +   RNPVIN+ SM  +TDIPDW   E G  +  D L +    + M  +SP+    ++K P+L+M+GQ+D+RVP  QG+E Y+AL+AR+V   L +YPK  H L+ VE  SDSF+N + W 
Sbjct:    7 LSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGRYRTVHTEWTQRDLERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGSTGEEKQ--FLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDISGSDDEMARPKKPDQAIKGDQFLFYEDWGENMVSKGSPVLCVLDIESGNISVLEGVP--ESVSPGQAFWAPGDTGVVFAGWWHEPFRLGIRFCTNRRSALYYVDLTGGNCELLSDDSLAVTSPRLSPDQCRIVYLQFPSLVPHQQCGQLCLYDWYTRVTVVVVDVVPRQLGENFSGIYCSLLPLGCWSADSQRVVFDTAQRSRQDLFAVDTQMGTVTPLTAGGSGGSWKLLTIDRDLMVAQFSTPNLPPCLKVGFLPPAGMEQEVVWVSLEEAEPIPDISWSIRVLQPPPEQEHAQYVGLDFEAILIQPSNPPDKTQVPMVVMPHGGPHSSFVTSWMLLPAMLCKMGFAALLVNYRGSTGFGQDSILSLPGNVGSQDVKDVQFAVEQVLQE--EHFDAGRVALLGGSHGGFLSCHLIGQYPETYGACVVRNPVINIASMMGSTDIPDWCVVEAGYLYSSDCLPDPNVWSEMLNKSPIKYTPQVKTPVLLMLGQEDRRVPFKQGMEYYRALKARNVPVRLLLYPKSTHSLSEVEVESDSFMNAVIWM 724          
BLAST of SMED30008513 vs. UniProt/SwissProt
Match: sp|P13798|ACPH_HUMAN (Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4)

HSP 1 Score: 383.645 bits (984), Expect = 1.265e-117
Identity = 236/730 (32.33%), Postives = 379/730 (51.92%), Query Frame = -3
Query: 1123 MSVLKNITSVYKSYARYPNLNSAKF------LNNADPYIISSTWTVNDLVTSKTKNLNLNFYY---EKDKNLILKSP--QVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEI-----------GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNV-LNCQILDHIPEFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWF 3231
            +S  +   ++Y+  +R P L++A                + + WT  DL   + +N+     Y       +++   P    +     ++   S S   +A+   RK+  +   E K   + +W     +KS NL+ ++ HG V++    FG   W      L+Y+AE K+PK  SFFQ  + D SA   EI           G+QF + +D+GE + +   PV+C+LDV+   I VL+       +S G     P   G+ F G+ + P+ LG+ +C  R   L+Y  L   + + + D++ +  SP+ SPD   I++L+  +  PH QC +L  Y+  T  T VVVDVV   + E F+G+Y   L   CW+ DS  ++  SA + +  +  +D +   V  L    +  S  LL ++   ++ + S+PS  P L +G L SA  E  +  V L       ++    ++L   PE ++ ++    +++I +   S   +   PM++M HGGPHS+F T + +F A + ++GF  L+VNYRGS G+GQDSI SL G +G  DVKD   A E +++E     D + + L GGSHGGF++ HL   Y +  ++   RNPVIN+ SM  +TDIPDW   E G  +  D L +      M ++SP+  + ++K P+L+M+GQ+D+RVP  QG+E Y+AL+ R+V   L +YPK  H L+ VE  SDSF+N + W 
Sbjct:    7 LSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEWTQRDL--ERMENIRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVL--RKAGGTGPGEEK-QFLEVWEKNRKLKSFNLSALEKHGPVYEDDC-FGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVP--ENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSALYYVDLIGGKCELLSDDSLAVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPRQLGENFSGIYCSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTSLTAGGSGGSWKLLTIDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDVKDVQFAVEQVLQE--EHFDASHVALMGGSHGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVLWL 726          
BLAST of SMED30008513 vs. TrEMBL
Match: V4A709 (Peptidase_S9 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_201138 PE=4 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 2.299e-147
Identity = 259/712 (36.38%), Postives = 400/712 (56.18%), Query Frame = -3
Query: 1117 LKNITSVYKSYARYPNLNSAKFLNNADPYI-ISSTWTVNDLVTSKTKNLNLNFYYE-KDKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHD---QSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITEF-TGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFD--HPKFGKKKYQSIFISSKK--EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 3222
            ++ I  VY+  A      SA+  +  D ++ +++ W+  DL  S+  N  +N+    +D ++++K+P   +  EI     S S K+ A+    K+     K+     I +W  +  IK+ ++   + HG V+ K   FG  QW  +  KL+Y +E K PK  SFF   + +   +  K I +G +    +D+GEQL      VICILD+    IEVLD+      LS G  C  P    + FTG+ N P+ LGL YC QR   ++ Y L +++I  I D+ +S  SP  SPD   +++ +    G H QC RL  Y+  T    V++D+V  P  E   G+Y   L   CW++DS  I+L+++ + +  +  I+++TK V  LN      S +++D+    +++  +SP+T  +L +G+L S   E E++   L+     DN ++  +  H P  D  H K+G   Y++I +  K   +   P+IL  HGGPH+ F T + ++ A   + GF  LMVNYRGS G+GQDS++S+LG IG  DVKDC  A++++I +    VDG K+F++GGSHGGFL +HL   Y D  ++  CRNPV NL  MT  TDIPDW + E G  +    LLN      MW+RSP+  VD++K P+L+MIG+DD RVPPSQ  E Y+AL+ R++KT L  Y  +CHP+  V++ +D+FVN++ W+ E
Sbjct:   13 VEEIVGVYRDLASISLPTSAQVRSVDDQFLAVTTQWSQRDLEKSEKTNFTVNYILNAQDYSVLIKTPSQEVKNEI-WKKESPSGKYHAVVTSWKNKKGEEKQ----FIEIWNSQGKIKNYDVCSQEKHGKVNNKDDTFGCLQWSNNEEKLLYTSERKLPKTKSFFGTTNGNDDKKEEKDIVLGKEHYTVEDWGEQLVKKSCSVICILDIKSGTIEVLDTPA---DLSCGQACWGPEDNTVVFTGWNNDPFRLGLKYCTQRQSAVYTYDLKTQKITSISDKTQSSRSPNISPDQSKLVYFDQPIGGAHKQCSRLKMYDFKTQTNQVILDIVHRPKDEVCNGIYEDVLMSRCWSHDSKQIILSTSYRSRTVLYCINVETKTVRQLNGGIKDGSSSIVDIYKDIIIISCTSPNTPQHLMVGKLLSNPGE-EIKWHYLNQP-EIDNNISFHLSSHQPTTDRKHSKYGYLDYETILVLPKTTDDKKPPLILFPHGGPHTTFDTLYMMYVAGFCKCGFAVLMVNYRGSLGFGQDSVESILGNIGDQDVKDCKAAADEIISK--GLVDGQKVFMFGGSHGGFLTTHLIGQYPDFFQAGCCRNPVTNLTVMTGVTDIPDWVYVESGFDYNHSCLLNPSYSEEMWKRSPIRYVDQVKAPLLLMIGKDDLRVPPSQAKEYYRALKTRNIKTRLIEYEDNCHPIVKVDSEADAFVNIMLWYKE 712          
BLAST of SMED30008513 vs. TrEMBL
Match: A0A1I8GHA1 (Peptidase_S9 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.423e-138
Identity = 252/741 (34.01%), Postives = 401/741 (54.12%), Query Frame = -3
Query: 1108 KNITSVYKSYARYPNLNSAKFLNN---ADPYIISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGI-----EIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGEL-KSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFI-------------------SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPS--------KVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTERYL 3219
            K +  VY   A YP   SA+ L     +D       + V DL + K + L          +L+   P VL D   + DVY S   HRA+ L+ K+  S    +   ++H++ +  FIKSI+L++   HG V+      G  QW  +   L+Y+AE K+PK  S+F   +  + + G       +G Q+   + FGEQL+    PV+C LDVD E + VLD   +  G+     C  P+  G+ F GY+ +PY LG+IYC QR   ++Y    S E   IG + ++  SP+FSP    ++WL+ + SGPH QC+RL+  + AT     ++D V +  +  F G+Y   L   CW+ +   ++L+S  + ++ ++ ID+KTK   +L++    +S  +LD +  +L+V+ S+P+  P++A G +  S  L + ++   L+  ++ +++   ++  H  +  HP+FG + ++SI +                   ++  E   P+I   HGGP+++F   +  +   +A  G+  LM+NYRGS G+G+ ++DSLLG IG+ DV DCI+A E+ + E  S        ++DG K+  +GGSHGGFL  HL        K+A  RNPVINL +M   +DIPDW + + G+ +  D LL+ E +  +W +SPLS   K+  P L+ +G  D RVPP QG ELY+ALRAR+V T L + P DCHP++SV   S  FV+++ WF    +
Sbjct:   11 KEVAQVYSDLAAYPVPQSAQLLPQYPFSDAIRTRCAYQVQDLASQKNRTLVKTAVVLPTGDLVDSDP-VLRDPTTLWDVYCSVGDHRAVLLKLKAEGSGSDNADKFIVHVYNESRFIKSIDLSEKAKHGAVYGP--ELGACQWSYNEGHLLYVAEKKQPKNASYFAADTFSEESAGKPGEAKSVGKQYDSVEHFGEQLSEYKRPVLCTLDVDSEVVTVLDDGGILDGVLPTEPCWAPDDAGVVFVGYKELPYQLGVIYCNQRPSAIYYLDFRSGECAVIGHDTRAVSSPRFSPCQTQLVWLQNEPSGPHKQCRRLIWCDWATKDIRFIIDFVNQAGSAGFPGIYADSLPSRCWSSNCRTVVLSSINRSKDCLLAIDVKTKIGELLSLPPDASSAKVLDFHRDWLVVEASAPNVPPFIAAGFIDASKPLTSNIKWTCLTDCFKLNDI-AWRVKQHTAKLAHPEFGNQLFESILVWPVDSSKKKDSKKGDEEKPAAITELPLPLIAFPHGGPNTSFTATYMRYVCGLARCGYAVLMINYRGSLGFGKSTVDSLLGGIGERDVSDCIQAVEETLAESASSADNSALPRLDGEKLAAFGGSHGGFLGGHLIGQRPGMFKAAVLRNPVINLATMVGGSDIPDWVYEQSGLPFSHDRLLDAETLALLWSKSPLSHASKVNTPTLVAVGLKDLRVPPQQGRELYRALRARNVPTRLLVCPDDCHPMSSVPVQSSVFVDIVLWFNRHVM 747          
BLAST of SMED30008513 vs. TrEMBL
Match: A0A267GS90 (Peptidase_S9 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010596g3 PE=4 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 1.799e-138
Identity = 252/741 (34.01%), Postives = 401/741 (54.12%), Query Frame = -3
Query: 1108 KNITSVYKSYARYPNLNSAKFLNN---ADPYIISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGI-----EIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGEL-KSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFI-------------------SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPS--------KVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTERYL 3219
            K +  VY   A YP   SA+ L     +D       + V DL + K + L          +L+   P VL D   + DVY S   HRA+ L+ K+  S    +   ++H++ +  FIKSI+L++   HG V+      G  QW  +   L+Y+AE K+PK  S+F   +  + + G       +G Q+   + FGEQL+    PV+C LDVD E + VLD   +  G+     C  P+  G+ F GY+ +PY LG+IYC QR   ++Y    S E   IG + ++  SP+FSP    ++WL+ + SGPH QC+RL+  + AT     ++D V +  +  F G+Y   L   CW+ +   ++L+S  + ++ ++ ID+KTK   +L++    +S  +LD +  +L+V+ S+P+  P++A G +  S  L + ++   L+  ++ +++   ++  H  +  HP+FG + ++SI +                   ++  E   P+I   HGGP+++F   +  +   +A  G+  LM+NYRGS G+G+ ++DSLLG IG+ DV DCI+A E+ + E  S        ++DG K+  +GGSHGGFL  HL        K+A  RNPVINL +M   +DIPDW + + G+ +  D LL+ E +  +W +SPLS   K+  P L+ +G  D RVPP QG ELY+ALRAR+V T L + P DCHP++SV   S  FV+++ WF    +
Sbjct:   33 KEVAQVYSDLAAYPVPQSAQLLPQYPFSDAIRTRCAYQVQDLASQKNRTLVKTAVVLPTGDLVDSDP-VLRDPTTLWDVYCSVGDHRAVLLKLKAEGSGSDNADKFIVHVYNESRFIKSIDLSEKAKHGAVYGP--ELGACQWSYNEGHLLYVAEKKQPKNASYFAADTFSEESAGKPGEAKSVGKQYDSVEHFGEQLSEYKRPVLCTLDVDSEVVTVLDDGGILDGVLPTEPCWAPDDAGVVFVGYKELPYQLGVIYCNQRPSAIYYLDFRSGECAVIGHDTRAVSSPRFSPCQTQLVWLQNEPSGPHKQCRRLIWCDWATKDIRFIIDFVNQAGSAGFPGIYADSLPSRCWSSNCRTVVLSSINRSKDCLLAIDVKTKIGELLSLPPDASSAKVLDFHRDWLVVEASAPNVPPFIAAGFIDASKPLTSNIKWTCLTDCFKLNDI-AWRVKQHTAKLAHPEFGNQLFESILVWPVDSSKKKDSKKGDEEKPAAITELPLPLIAFPHGGPNTSFTATYMRYVCGLARCGYAVLMINYRGSLGFGKSTVDSLLGGIGERDVSDCIQAVEETLAESASSADNSALPRLDGEKLAAFGGSHGGFLGGHLIGQRPGMFKAAVLRNPVINLATMVGGSDIPDWVYEQSGLPFSHDRLLDAETLALLWSKSPLSHASKVNTPTLVAVGLKDLRVPPQQGRELYRALRARNVPTRLLVCPDDCHPMSSVPVQSSVFVDIVLWFNRHVM 769          
BLAST of SMED30008513 vs. TrEMBL
Match: A0A098M0X3 (Acylamino-acid-releasing enzyme OS=Hypsiglena sp. JMG-2014 OX=1550645 PE=4 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 1.159e-136
Identity = 246/727 (33.84%), Postives = 392/727 (53.92%), Query Frame = -3
Query: 1117 KNITSVYKSYARYPNLNSAKFLNNADPYI------ISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEI---IMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFF----------QNVSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTT--LCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNV-LNCQILDHIPEFDHPKFGKKKYQSIFISSKK---EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 3219
            + I ++Y+  ++YP+L+ A                I + W+  DL  ++       +    D   I+ S       E+   ++   S S   +A+   RK  +S G+E   + + +W     +KSI L  ++ HG V+     FG   W      L+Y+AE K+PK  SFF          + ++  +  K ++ G QF + +D+GE L     PV+CILD++   + VL+     + PG +  T    PN  G+ FTG+ + P+ LGL YCI R   LF+  L   + + + ++NK+  SP+ SPD   I++LE  ASGPH QC R+  Y+  T  T V+VD+V   I   F G+Y+  L E+CW  DS  ++L +  + + ++I++D+ TK+V  L  S  + S  LL ++   ++ K S+P++ P L +  L  A  E ++  V L        +  +  +L   P+ D+P++    +++I +   +   +   P+++  HGGPHS F T + ++ A +  +GF  L+VNYRGS G+GQDS+DSL G +G  DVKD     E M+++ P  +D  ++ L GGSHGGFL+ HL   Y    K+   RNPV+N+ SM  +TDIPDW  TE G+ +    L   E    M   SP+  VDK++ P+L++IG++D+RVPP QGLE Y+ALR+R + T +  YP D H L+SVEA +D F+N+  W  +
Sbjct:   10 EEIAALYRDLSQYPSLSHACIGPEVTTQYGGRHCNIYTEWSQRDLERAENVKFCRQYLVFHDNQSIIYSGPSGNCTEVKGELLSRDSPSGTQKAVV--RKMKNSKGEEK--HFLEVWEKNRKVKSIELTALEKHGQVYDDD-QFGCLAWSHSETHLLYVAEKKRPKAESFFKPRASELNTEEELAKTERDKAVK-GEQFVFYEDWGETLVAKSIPVLCILDIESSNVSVLEGVPEYISPGQAFWT----PNDTGVVFTGWYHEPFRLGLKYCINRRSSLFHVDLTGGQCELLSEDNKAIWSPRLSPDQCRIVYLENQASGPHQQCSRICMYDWYTKLTSVIVDIVPRQIQGGFAGIYSTALPEHCWAADSQRVVLDTTQRSRQELIVVDMATKSVCSLTKSSFLGSWVLLTIDRDLMVAKFSTPNSPPMLMVAFLPPAGKEADVNWVCLEETSPIQGISWDVHVLQPSPDQDNPQYRGLDFEAILLKPTQVSEQAKLPLVVSPHGGPHSVFTTAWMLYPAVLCRMGFAVLLVNYRGSLGFGQDSVDSLPGNVGCQDVKDVQFCVEQMLQKEP--LDSKRVALLGGSHGGFLSCHLIGQYPSTYKACVTRNPVVNMASMIGSTDIPDWCITEVGLSYDQAALPVPEQWEKMLLHSPMQYVDKVQAPVLLLIGEEDRRVPPKQGLEYYRALRSRGIPTRMLQYPSDNHALSSVEAEADGFMNIALWLLQ 724          
BLAST of SMED30008513 vs. TrEMBL
Match: A0A267FM49 (Peptidase_S9 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009883g1 PE=4 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 1.031e-135
Identity = 251/741 (33.87%), Postives = 401/741 (54.12%), Query Frame = -3
Query: 1108 KNITSVYKSYARYPNLNSAKFLNN---ADPYIISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGI-----EIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGEL-KSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFI-------------------SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPS--------KVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTERYL 3219
            K +  VY + A YP   SA+ L     +D       + V DL + K + L          +L+   P VL D   + DVY S   HRA+ L+ K+  S    +   ++H++ +  FIKSI+L++   HG V+      G  QW  +   L+Y+AE K+PK  S+F   +  + + G       +G Q+   + FGEQL+    PV+C LDVD E + VLD   +  G+     C  P+  G+ F GY+ +PY LG+IYC QR   ++Y    S E   IG + ++  SP+FSP    ++WL+ + SGPH QC+RL+  + AT     ++D V +  +  F G+Y   L   CW+ +   ++L+S  + ++ ++ ID+KTK   +L +    +S  +LD +  +L+V+ S+P+  P++A G +  S  L + ++   L+  ++ +++   ++  H  +  HP+FG + ++SI +                   ++  E   P+I   HGGP+++F   +  +   +A  G+  L++NYRGS G+G+ ++DSLLG IG+ DV DCI+A E+ + E  S        ++DG K+  +GGSHGGFL  HL        K+A  RNPVINL +M   +DIPDW + + G+ +  D LL+ E +  +W +SPLS   K+  P L+ +G  D RVPP QG ELY+ALRAR+V T L + P DCHP++SV   S  FV+++ WF    +
Sbjct:   33 KEVAQVYSNLAAYPVPQSAQLLPQYPFSDAIRTRCVYQVQDLASQKNRTLVKTAVVLPTGDLVDSDP-VLRDPTTLWDVYCSGGDHRAVLLKLKAEGSGSDNADKFVVHVYNESRFIKSIDLSEKAKHGAVYGP--ELGACQWSCNEGHLLYVAEKKQPKNASYFAADAFSEESAGKPGEAKSVGKQYDSVEHFGEQLSEYKRPVLCTLDVDSEVVTVLDDG-IPDGVLPTEPCWAPDDAGVVFVGYKELPYQLGVIYCNQRPSAIYYLDFRSGECAVIGHDTRAVSSPRFSPCQTQLVWLQNEPSGPHKQCRRLIWCDWATKDIRFIIDFVNQAGSAGFPGIYADSLPSRCWSSNCRTVVLSSINRSKDCLLAIDVKTKIGELLPLPPDASSAKVLDFHRDWLVVEASAPNVPPFIAAGFIDASKPLTSNIKWTCLTDCFKLNDI-AWRVKQHTAKLAHPEFGNQLFESILVWPVGSSKKKDSKKGDEEKPAAITELPLPLIAFPHGGPNTSFTATYMRYVCGLARCGYAVLVINYRGSLGFGKSTVDSLLGGIGERDVSDCIQAVEETLAESASSADNSALPRLDGEKLAAFGGSHGGFLGGHLIGQRPGMFKAAVLRNPVINLATMVGGSDIPDWVYEQSGLPFSHDRLLDAETLALLWSKSPLSHASKVNTPTLVAVGLKDLRVPPQQGRELYRALRARNVPTRLLVCPDDCHPMSSVPVQSSVFVDIVLWFNRHVM 768          
BLAST of SMED30008513 vs. Ensembl Cavefish
Match: apeh (acylaminoacyl-peptide hydrolase [Source:NCBI gene;Acc:103034957])

HSP 1 Score: 397.897 bits (1021), Expect = 1.384e-123
Identity = 252/768 (32.81%), Postives = 401/768 (52.21%), Query Frame = -3
Query: 1117 IFAFKSGLFIYLIYSIFKFFD*NMSVLKNITSVYKSYARYPNLNSAKFLNNADPYI----------ISSTWTVNDLVTSKTKNLNLNF-----YYEKDKNLILKSPQVLMDE--EIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHD----------QSAKGIEI--GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP--EFDHPKFGKKKYQSIFISSK--KEGS-CPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDY-----LLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 3300
            IF+ +  + +       +  D  ++  ++I  +Y+  +++P+L+ A    +  P I          IS+ WT  DL     +N N+ F      +  DK+++   P     E    ++   S S   +A+    ++    G+E +   + +W     IKS+NL  +  HG V++    FG   W      L+Y+AE K+PK  S+F++ S            ++ K  E+  G+QF + +D+GE L +   PV+C+LD++   + VL+   L   +S G     PN  G+ F G+ + P+ LGL YC  R   LFY  L   + +++  ++ +  SP+ SPD   I++LE    GPH QC +L  Y+  T  T VVVDVVK    + FTG+Y+  L   CW+ DS  +L++ A + +  ++++D  +  V  +     + S  LL ++   ++V  SSP+  P L +G L ++  E+E+  V L    +     + QIL   P  E D+ ++    + +I +  K  KEG+  P+I+  HGGPHS F  ++ +  A +  +GF  L VNYRGS GYGQDSI SL G +G  DVKD   A E ++++     +  K+ + GGSHGGFLA HL   Y D  K    +NPVINL SM  +TDIPDW   E G    FDY     L++   +  M  +SP+  V ++K P+L+ +G+DDKRVP  QG+E Y++L+A  V   L  YP++ H L+ V+A SD F+N+  W  +
Sbjct:   11 IFSARRIVLLNWCVRFSRVCDKVLTTPEDIAKLYREQSQFPSLSRA----DVGPVITSQYGGKYSNISTEWTQRDL----ERNENVKFCRQYILFHDDKSIVYSGPSGNCTEIKGELLSQDSPSGDMKAVV---RACTIKGEEKQ--FLEIWHKNSKIKSLNLTALKKHGKVYEDD-QFGCLVWSHSETHLLYVAEKKRPKAESYFESGSEPSLLGDEEEPIKTDKKEEVVKGDQFVFYEDWGEALVSKSTPVLCVLDIEGNNVSVLEG--LPDNISPGQAFWAPNDTGVVFVGWWHEPFRLGLKYCPNRRSSLFYVDLTGGKCEQLSSDSAAVCSPRLSPDLCRIVYLECGVYGPHQQCSKLCMYDWYTKKTSVVVDVVKRAGEDGFTGIYSSMLPHQCWSADSQRVLVSCAQRSRKDLLVVDTSSGQVTSITSKSEMGSWCLLTIHSDLMVVGCSSPNCPPSLRVGFLPASGSESEVAWVTLEEAQK-QAEFDWQILTFTPPSEEDNSQYPGLDFDAILLKPKGVKEGTKLPLIVTPHGGPHSVFVAEWFLSEAVLCRMGFGVLQVNYRGSIGYGQDSILSLPGNVGTQDVKDVQFAVESVLKQ--GDFNREKVAISGGSHGGFLACHLIGQYPDFYKVCIAQNPVINLASMVGSTDIPDWCMVEAG----FDYNTNNALMSPAILEQMLNKSPIKFVTQVKTPVLLTLGEDDKRVPNKQGIEYYRSLKALQVPVRLLWYPENNHSLSKVDAESDGFMNIALWIIQ 755          
BLAST of SMED30008513 vs. Ensembl Cavefish
Match: apeh (acylaminoacyl-peptide hydrolase [Source:NCBI gene;Acc:103034957])

HSP 1 Score: 397.127 bits (1019), Expect = 1.656e-123
Identity = 249/745 (33.42%), Postives = 393/745 (52.75%), Query Frame = -3
Query: 1117 MSVLKNITSVYKSYARYPNLNSAKFLNNADPYI----------ISSTWTVNDLVTSKTKNLNLNF-----YYEKDKNLILKSPQVLMDE--EIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHD----------QSAKGIEI--GNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP--EFDHPKFGKKKYQSIFISSK--KEGS-CPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDY-----LLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 3231
            ++  ++I  +Y+  +++P+L+ A    +  P I          IS+ WT  DL     +N N+ F      +  DK+++   P     E    ++   S S   +A+    ++    G+E +   + +W     IKS+NL  +  HG V++    FG   W      L+Y+AE K+PK  S+F++ S            ++ K  E+  G+QF + +D+GE L +   PV+C+LD++   + VL+   L   +S G     PN  G+ F G+ + P+ LGL YC  R   LFY  L   + +++  ++ +  SP+ SPD   I++LE    GPH QC +L  Y+  T  T VVVDVVK    + FTG+Y+  L   CW+ DS  +L++ A + +  ++++D  +  V  +     + S  LL ++   ++V  SSP+  P L +G L ++  E+E+  V L    +     + QIL   P  E D+ ++    + +I +  K  KEG+  P+I+  HGGPHS F  ++ +  A +  +GF  L VNYRGS GYGQDSI SL G +G  DVKD   A E ++++     +  K+ + GGSHGGFLA HL   Y D  K    +NPVINL SM  +TDIPDW   E G    FDY     L++   +  M  +SP+  V ++K P+L+ +G+DDKRVP  QG+E Y++L+A  V   L  YP++ H L+ V+A SD F+N+  W  +
Sbjct:   12 LTTPEDIAKLYREQSQFPSLSRA----DVGPVITSQYGGKYSNISTEWTQRDL----ERNENVKFCRQYILFHDDKSIVYSGPSGNCTEIKGELLSQDSPSGDMKAVV---RACTIKGEEKQ--FLEIWHKNSKIKSLNLTALKKHGKVYEDD-QFGCLVWSHSETHLLYVAEKKRPKAESYFESGSEPSLLGDEEEPIKTDKKEEVVKGDQFVFYEDWGEALVSKSTPVLCVLDIEGNNVSVLEG--LPDNISPGQAFWAPNDTGVVFVGWWHEPFRLGLKYCPNRRSSLFYVDLTGGKCEQLSSDSAAVCSPRLSPDLCRIVYLECGVYGPHQQCSKLCMYDWYTKKTSVVVDVVKRAGEDGFTGIYSSMLPHQCWSADSQRVLVSCAQRSRKDLLVVDTSSGQVTSITSKSEMGSWCLLTIHSDLMVVGCSSPNCPPSLRVGFLPASGSESEVAWVTLEEAQK-QAEFDWQILTFTPPSEEDNSQYPGLDFDAILLKPKGVKEGTKLPLIVTPHGGPHSVFVAEWFLSEAVLCRMGFGVLQVNYRGSIGYGQDSILSLPGNVGTQDVKDVQFAVESVLKQ--GDFNREKVAISGGSHGGFLACHLIGQYPDFYKVCIAQNPVINLASMVGSTDIPDWCMVEAG----FDYNTNNALMSPAILEQMLNKSPIKFVTQVKTPVLLTLGEDDKRVPNKQGIEYYRSLKALQVPVRLLWYPENNHSLSKVDAESDGFMNIALWIIQ 733          
BLAST of SMED30008513 vs. Ensembl Cavefish
Match: apeh (acylaminoacyl-peptide hydrolase [Source:NCBI gene;Acc:103034957])

HSP 1 Score: 386.341 bits (991), Expect = 8.593e-120
Identity = 249/737 (33.79%), Postives = 386/737 (52.37%), Query Frame = -3
Query: 1117 MSVLKNITSVYKSYARYPNLNSAKFLNNADPYI----------ISSTWTVNDLVTSKTKNLNLNF-----YYEKDKNLILKSPQVLMDE--EIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQ----NKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP--EFDHPKFGKKKYQSIFISSK--KEGS-CPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDY-----LLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 3231
            ++  ++I  +Y+  +++P+L+ A    +  P I          IS+ WT  DL     +N N+ F      +  DK+++   P     E    ++   S S   +A+    ++    G+E +   + +W     IKS+NL  +  HG V++    FG   W      L+Y+AE K+PK  S+F+   H        +G+QF + +D+GE L +   PV+C+LD++   + VL+   L   +S G     PN  G+ F G+ + P+ LGL YC  R   LFY  L   + +++  ++ +  SP+ SPD   I++LE    GPH QC +L  Y+  T  T VVVDVVK    + FTG+Y+  L   CW+ DS  +L++ A + +    +   L D    N   L +   + S  LL ++   ++V  SSP+  P L +G L ++  E+E+  V L    +     + QIL   P  E D+ ++    + +I +  K  KEG+  P+I+  HGGPHS F  ++ +  A +  +GF  L VNYRGS GYGQDSI SL G +G  DVKD   A E ++++     +  K+ + GGSHGGFLA HL   Y D  K    +NPVINL SM  +TDIPDW   E G    FDY     L++   +  M  +SP+  V ++K P+L+ +G+DDKRVP  QG+E Y++L+A  V   L  YP++ H L+ V+A SD F+N+  W  +
Sbjct:    7 LTTPEDIAKLYREQSQFPSLSRA----DVGPVITSQYGGKYSNISTEWTQRDL----ERNENVKFCRQYILFHDDKSIVYSGPSGNCTEIKGELLSQDSPSGDMKAVV---RACTIKGEEKQ--FLEIWHKNSKIKSLNLTALKKHGKVYEDD-QFGCLVWSHSETHLLYVAEKKRPKAESYFEVRDH--------LGDQFVFYEDWGEALVSKSTPVLCVLDIEGNNVSVLEG--LPDNISPGQAFWAPNDTGVVFVGWWHEPFRLGLKYCPNRRSSLFYVDLTGGKCEQLSSDSAAVCSPRLSPDLCRIVYLECGVYGPHQQCSKLCMYDWYTKKTSVVVDVVKRAGEDGFTGIYSSMLPHQCWSADSQRVLVSCAQRSRKVFNSSRCLGDSHHSN---LCLGSEMGSWCLLTIHSDLMVVGCSSPNCPPSLRVGFLPASGSESEVAWVTLEEAQK-QAEFDWQILTFTPPSEEDNSQYPGLDFDAILLKPKGVKEGTKLPLIVTPHGGPHSVFVAEWFLSEAVLCRMGFGVLQVNYRGSIGYGQDSILSLPGNVGTQDVKDVQFAVESVLKQ--GDFNREKVAISGGSHGGFLACHLIGQYPDFYKVCIAQNPVINLASMVGSTDIPDWCMVEAG----FDYNTNNALMSPAILEQMLNKSPIKFVTQVKTPVLLTLGEDDKRVPNKQGIEYYRSLKALQVPVRLLWYPENNHSLSKVDAESDGFMNIALWIIQ 709          
BLAST of SMED30008513 vs. Ensembl Cavefish
Match: zgc:136971 (zgc:136971 [Source:ZFIN;Acc:ZDB-GENE-060421-3674])

HSP 1 Score: 313.538 bits (802), Expect = 4.496e-93
Identity = 197/639 (30.83%), Postives = 318/639 (49.77%), Query Frame = -3
Query: 1117 IMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEIGNQFK--YKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEP-ITEFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVN-ILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSS---IYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFI---SSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 3003
            ++  +S S   RA+  E     +S        + +W      KS +L  +  HG V++ +  F    W     KL+Y+AE K+          S +QS + I +  + K  Y +D+GE L     PV+C+ D+ + ++ V   T + P +S G       G G+ F G+ N P+ LGL +C  R    F+  L     + +  ++ S  SP+ SPD R++++L+    GPH QC  +M Y+I    + V++DV++     +F G+Y+  L   CW  +S  I  +S       +  +D +T  +  + +      S  LL + +  L++  SSP+  P L +G + S   + E++   L       +FD      I+   PE ++ +F    + ++ +   SS K G  P+++ +H                           VNYRGS G+GQDSIDSLLG +G  DVKD  +A   +++     +D +++ + GGSHGGFLA HL   Y +  ++ A RNPVIN  ++   +DI DW ++  G+ + FD L   E + TM E+SP++   +I  P+L+M+G  DKRV P QGLELYKAL++R     L  Y  D H L+ +E  SD F+N+  WF +
Sbjct:   82 LLSSHSPSGTRRAVIRE-----ASAHGVGHQYLEVWGCRGLEKSFDLTALSKHGKVYEDA-QFACLAWSPCEEKLLYVAEKKRVGSSEKASPSSANQSGELIVLEEEDKNVYMEDWGEGLVGKSVPVLCVADLSKREVNVC--TGVPPHVSPGQALWAEGGRGVVFVGWWNEPFRLGLKFCSNRRSARFHIDLKGN-CELLSADSGSVSSPRLSPDHRWLVYLQGRVFGPHHQCLLMMLYDIEKRSSSVLIDVIRRAGKGQFAGVYD-PLPPQCWASNSEEIFFSSPCGNSKVVFSVDRQTGRIRPVYDTKREFGSARLLTVINDLLVISCSSPNHPPSLVVGFVSSRENKQEVQWTHLGGADVCEKFD--WQDIIITPPPEEENHQFSGLTFGAVLLKPDSSSKSGKIPLVVFIH---------------------------VNYRGSTGFGQDSIDSLLGNVGSQDVKDVQRAVLHILQS-DQALDADRVAVMGGSHGGFLACHLIGQYPEFYRACAARNPVINAATLVGTSDIVDWRYSSVGLHYSFDQLPTPEALITMLEKSPIAHAAQICAPVLLMLGGKDKRVSPYQGLELYKALKSRKSPVRLLWYDGDGHSLSRLETQSDCFLNIALWFQQ 680          
BLAST of SMED30008513 vs. Ensembl Cavefish
Match: ENSAMXT00000041345.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:32334536:32339002:1 gene:ENSAMXG00000029230.1 transcript:ENSAMXT00000041345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 42.3578 bits (98), Expect = 3.116e-12
Identity = 26/76 (34.21%), Postives = 44/76 (57.89%), Query Frame = 2
Query:  524 VKNAS*KFQRCMDKIISPLREFSG-TYIGDIIVLSTSKKEHEKNLDLIREALKQENLSIKEEKSNIESISRQLDYL 748
            +KNA+  FQR MD ++  L+  S   YI DI+V S++ ++H  +L+ +   L Q  L++   K N+  + R L +L
Sbjct:  754 IKNAAATFQRLMDSVLVNLKGKSCFVYINDIVVYSSTIEQHLGHLEEVFRCLHQAGLTLNLRKCNL--LQRSLIFL 827          

HSP 2 Score: 36.5798 bits (83), Expect = 3.116e-12
Identity = 17/36 (47.22%), Postives = 22/36 (61.11%), Query Frame = 3
Query:  423 KKAYHQIPIALDYIPKTAVITHYGLYEYVKMTFALK 530
            K  Y Q+ +  D IPKTA IT  GLYE+  + F +K
Sbjct:  720 KSGYWQVGLEPDSIPKTAFITCQGLYEFTVLPFGIK 755          

HSP 3 Score: 32.7278 bits (73), Expect = 3.116e-12
Identity = 14/33 (42.42%), Postives = 22/33 (66.67%), Query Frame = 1
Query:  328 VQTCGDYRGLNA-LRVDRYPLPRITGILDQLRG 423
            V+ C DYR +N+   +D YP+P++  IL+ L G
Sbjct:  678 VRFCVDYRRMNSKTHLDAYPMPQVQEILESLHG 710          
BLAST of SMED30008513 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001392.1 (pep scaffold:Pmarinus_7.0:GL482689:14672:17070:1 gene:ENSPMAG00000001250.1 transcript:ENSPMAT00000001392.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 4.402e-15
Identity = 62/252 (24.60%), Postives = 113/252 (44.84%), Query Frame = -3
Query: 2551 NMSVLKNITSVYKSYARYPNLNSAKF-----LNNADPY-IISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEIIMDVYSS-SYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQN-----------------VSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIG 3234
            N+  +K + + ++  A+ P    A+        +   Y ++ + W+  D+  +++   +L++   +D   I+ +       E+  ++  S S       + RK     G + K   + +W   L  K+I+L  ++ HG  +     FG   W      L+Y+AE K+PK  +FFQ+                  +  Q AKG    ++F +++D+GE L N  +PV+CILDV    + VLD   L P +S G
Sbjct:    6 NLKHVKVVMAAFRDVAKQPVALRARIGPQMRSRHGGAYSLVHTEWSYRDVERAESVVCSLSYSVFRDGATIVDTSPAGGPTEMHAELKRSVSPSGTLTAILRKIGGKGGADEK-QFLEIWNGNLKEKNIDLEALEQHGKFYDDG-QFGVLAWSNSESHLLYVAEKKRPKGTTFFQSRPPSANTAQTDAPTDPGTTDRQKAKG----DKFLFREDWGEALVNKSDPVLCILDVVSGTVSVLDG--LPPHISPG 249          
BLAST of SMED30008513 vs. Ensembl Nematostella
Match: EDO40564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q1])

HSP 1 Score: 377.481 bits (968), Expect = 9.051e-117
Identity = 224/730 (30.68%), Postives = 378/730 (51.78%), Query Frame = -3
Query: 1117 VLKNITSVYKSYARYPNLNSAKFLNNAD-----PYIISSTWTVNDLVTSKTKNLNLNFYYEKDKNLIL---KSPQVLMD--EEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQ------SAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPG----LSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNL-GLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENE-MRLVPLSSIYRFDNVLNCQI---LDHIPEFDHPKFGKKKYQSIFISS-KKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 3225
            VL+    V++  A  P L  A  L+N        +I++S WT  DL      + N N  +++   + L   K P +L       +  V S S K++ I   R  ++S   E K   + +W     I+SI++ + D HG+++  S  F  F W    + ++Y+AE KKPK+LS+F+            +      G+ + Y++D+GEQL     PV+ +L V   +I      T+ PG    LS+G  C   +  G+ F+G+ + PY LGL+YC  R   +F+  +D   ++++    ++   P  +P    + +L  D  G H  C +L++Y   T     ++D V  P  + F G Y    L+  CW+ D   ++L S  +    I+ +D+      ++ +++      +LD+    LL   SSPS    + +  + + L   E +    ++S     + L   I   ++  P  +  +     Y+ + +    KE   P+I++ HGGP S + + + +   A+ +LGF  L VNY+GS G+G+ S+ S++G +G  DV++ + A+E+++       D + +F+ GGSHGGFL++HL   Y D+ ++ A RNPVI++ SM T TDIPDW F ECG  + ++   + + +  MWE+SP++ V K++ P+L+ IG  D+RVPPSQG+  ++ LR R V+T+L +YP+D HPL  V   SD FVN + WF E
Sbjct:   13 VLERAAHVFRELAAIPYLTKANILSNTQNEKPASFIVTSQWTQRDL------DRNENRVFQRSHCVTLSEGKEPSILETGFPAELHKVTSPSRKYQLIL--RGVSESKQYEDK-QFLEIWSQNNIIRSIDVKEADKHGLIYTDSL-FSCFNWSASEKYVLYVAEKKKPKRLSYFEKDKEGNIKIFFNNYSSSSSGDHYLYEEDWGEQLVKKNCPVLAMLAVHSGEI------TIIPGIPDYLSVGQACWTLDDKGVVFSGWWHKPYRLGLVYCSNRRGGVFHVKVDGSGLEQLSSPEETVAYPNINPITGKLYYLARDCIGVHQTCWKLVEYNWKTKANTTIIDYVDVPGDDGFPGFYMFNSLSSRCWSKDGTKLILASIWRSSQHILCVDVN--KCTLVRLTKAPGCWDVLDVYQDLLLASFSSPSQPHQIYLMHIPTELSSMEDLGCTEIASSANGSSDLFNDIEWKIETFPSLETGEGFNADYEGVLVQPIGKETKPPLIVLPHGGPQSVYNSSYIISSVAMCKLGFAILWVNYKGSVGFGRKSLQSIIGKVGTQDVREVMAAAENVLSR--GAHDPHNLFVMGGSHGGFLSAHLIGQYPDKFRACAARNPVIDISSMVTVTDIPDWCFVECGFDFDYNLATDSKTMTDMWEKSPIAHVHKVRTPVLLCIGAVDRRVPPSQGIHFHRVLRERGVETKLLLYPEDAHPLDKVGTESDVFVNTVRWFHE 722          
BLAST of SMED30008513 vs. Ensembl Medaka
Match: apeh (acylamino-acid-releasing enzyme [Source:NCBI gene;Acc:101160809])

HSP 1 Score: 402.134 bits (1032), Expect = 1.746e-125
Identity = 243/736 (33.02%), Postives = 377/736 (51.22%), Query Frame = -3
Query: 1117 KNITSVYKSYARYPNLNSAKFLNNADPYIIS----------STWTVNDLVTSKTKNLNLNF-----YYEKDKNLILKSPQVLMDE--EIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSA------------KGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITE-FTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP--EFDHPKFGKKKYQSIFISSKK---EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 3219
            + I  +Y+  + YP+L+ A    +  P I S          + W+  DL     +N N+ F      +  DK+L+         E    ++   S S + +A+  E      + K  +   + +W   + +KSINL  +  HG V++    FG   W      L+Y+AE K+ K  SFFQ V  + S+            K    G QF Y +D+GE L N   PV+C+LD++ + + VL+       +S G     P   G+ F G+ + P+ LGL +C  R   LFY  L   + +++   + +  SP+ SPD   II+LE    GPHMQC ++  Y+  T  T VVVD VK    + F G+Y   L+  CW+ DS  +L++   + +  ++ +DI T +V  L     + S  LL++    ++V  SSP+  PYL +G L S   + ++  V L       ++   QI+   P  E D+ ++    ++++ I  K+   EG  P++++ HGGPHS    ++ +  + +  +GF  L+VNYRGS G+GQD+I SLLG +G  DVKD   A E +++    + DG K+ + GGSHGGFLA HL   Y    K+   RNPV NL SM  +TDIPDW   E G  +  D L        M  +SP+  V +++ P+L+ +G+DDKRVP  QG+E YKAL+AR +   L  YP + H L+ V+A SD F+N+  W  +
Sbjct:   10 EEIAKLYRELSLYPSLSRA----DVGPVITSQYGGKYSNIYTEWSQRDL----ERNENVKFCRQYIVFHDDKSLVYSGASGNCTEIRGEVLSKDSPSGEMKAVVRE-----CTIKGEEKQFLEIWSKNIKMKSINLTALKKHGKVYEDE-QFGCLVWSHSETHLLYVAEKKRLKAESFFQMVPPELSSSIDEEETTRLDKKETVKGEQFAYHEDWGEALVNKSCPVLCVLDIEGDNVSVLEGVP--DDISPGQAFWAPGDTGVVFVGWWHEPFRLGLKFCPNRRSSLFYVDLTGGKCEQLSSGSSAVCSPRLSPDQCRIIYLECSVYGPHMQCSKVCMYDWYTKKTSVVVDEVKRSKEDGFAGIYCSQLSPKCWSADSQRVLISCPQRSRKDLLTVDISTGSVTSLTAESDIGSWCLLNIERDLMVVSCSSPNCPPYLRVGFLPSRDSQEKVVWVTLEGSQMLPDI-GWQIMTFTPPPEQDNSQYPGIDFEALLIKPKEVKAEGKLPLVVIPHGGPHSVIVAEWILSSSVLCSMGFAVLLVNYRGSLGFGQDNILSLLGNVGSQDVKDVQFAVESVLKN--GEFDGQKVAVSGGSHGGFLACHLIGQYPGFYKACVARNPVTNLASMVGSTDIPDWCVVEAGYDYSHDCLPEPSVWEQMLNKSPIKHVTQVQTPVLLTLGEDDKRVPNKQGIEYYKALKARQIPVRLLWYPGNNHSLSKVDAESDGFMNIALWIIQ 726          
BLAST of SMED30008513 vs. Ensembl Medaka
Match: zgc:136971 (acylamino-acid-releasing enzyme [Source:NCBI gene;Acc:101170588])

HSP 1 Score: 338.961 bits (868), Expect = 2.367e-102
Identity = 219/724 (30.25%), Postives = 357/724 (49.31%), Query Frame = -3
Query: 1117 NITSVYKSYARYPNLNSAKFLNNADP----YIISSTWTVNDLVTSKTKNLNLNFYYEKDKN-------LILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEIGNQFK--YKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEP-ITEFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNV-----NILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGEL--KSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFISSKK---EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 3216
             I  VY   + +P   SA       P    Y +++ W+ +DLV     + +  +    D N       ++   P   +  E++   +S     +AI  E      SG +    L+ +W      K +NL  ++IHG V+  +  FG+  W +   KL+Y+AE             S + SA G     + +  Y +D+GE LT+   PV+C++D+    ++VL        +S G     P+   + F G+ + P+ LGL +C  R   LF   ++ +  +++   N S   P+ SPDG  +I+L+    GPH QC  L + ++ +  T  ++DV+  P   EF G+Y   L+  CW+ DS  ++ +SA +    + ++D K+K V     N+   S    S  LL +    ++V  SSP+T P L +G L  KS  +  +    P  +   FD       +   PE D+ ++    + S+ +   +   +   P+++ +HGGPHS F  ++    A + +LG   LMVNYRGS G+GQDSI SL+G IG  DVKD  +     +      +D  ++ + GGSHGGFL  HL   Y D  K+ A RNPVIN  ++   +DI DW +T  G ++ +D +   E +  + ++SP++   +IK  +L+M+G  D+RV P QGLELYK L+ R+    L  +P+D H L+ V+  +D FVN   W  +
Sbjct:    5 QIAGVYAEVSGFPTPVSAHVKVEELPEYRVYSVTADWSQSDLVRGSRLHYSQQWTLIADTNNHKTVRTVLPPGPFTPVSGELLR-AFSPIRGLKAIVRE------SGNQ---QLLEIWDCHGLRKCLNLTALNIHGRVYDDA-QFGSLSWSECEDKLLYVAEK------------SRNSSAGGESACREDRNVYCEDWGEALTSKSVPVVCVVDLHSGVVDVLQGVP--EDVSPGQALWAPDYQSVFFVGWYHEPFRLGLKFCSNRSSSLFVLDMEGR-CERLSGANLSVSCPRLSPDGSTLIFLQGRVFGPHHQCLSLQQLDLKSRKTSALIDVLNRPQAGEFAGVYET-LSPCCWSADSQRVVFSSACRNWKDLFVVDRKSKKVLSLSDNLSAASRDCGSWKLLTIQRDLMVVCCSSPNTPPTLRVGFLPEKSEAMTWQTLQQPAMT---FDFSWTSLDIKPPPEEDNTQYPGLDFGSVLVKPSRPFCDSRIPLVVFIHGGPHSQFPAEWNSTTAGLVKLGCAVLMVNYRGSTGFGQDSILSLIGNIGSQDVKDVQRGVLAALWS-DETLDPKRVAVIGGSHGGFLCCHLVGQYPDFYKACAARNPVINAATLLGTSDIVDWRYTSAGFQFSYDSVPTAEVLAALLQKSPITHAVQIKAAVLLMLGGKDRRVSPHQGLELYKVLKTRASPVRLLWFPEDGHSLSRVDTQADCFVNTALWLQQ 697          
BLAST of SMED30008513 vs. Ensembl Medaka
Match: zgc:136971 (acylamino-acid-releasing enzyme [Source:NCBI gene;Acc:101170588])

HSP 1 Score: 211.846 bits (538), Expect = 9.049e-57
Identity = 118/338 (34.91%), Postives = 181/338 (53.55%), Query Frame = -3
Query: 1117 KTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGEL--KSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFISSKK---EGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTE 2115
            KT   ++   S    S  LL +    ++V  SSP+T P L +G L  KS  +  +    P  +   FD       +   PE D+ ++    + S+ +   +   +   P+++ +HGGPHS F  ++    A + +LG   LMVNYRGS G+GQDSI SL+G IG  DVKD  +     +      +D  ++ + GGSHGGFL  HL   Y D  K+ A RNPVIN  ++   +DI DW +T  G ++ +D +   E +  + ++SP++   +IK  +L+M+G  D+RV P QGLELYK L+ R+    L  +P+D H L+ V+  +D FVN   W  +
Sbjct:  422 KTDVEDLSAASRDCGSWKLLTIQRDLMVVCCSSPNTPPTLRVGFLPEKSEAMTWQTLQQPAMT---FDFSWTSLDIKPPPEEDNTQYPGLDFGSVLVKPSRPFCDSRIPLVVFIHGGPHSQFPAEWNSTTAGLVKLGCAVLMVNYRGSTGFGQDSILSLIGNIGSQDVKDVQRGVLAALWS-DETLDPKRVAVIGGSHGGFLCCHLVGQYPDFYKACAARNPVINAATLLGTSDIVDWRYTSAGFQFSYDSVPTAEVLAALLQKSPITHAVQIKAAVLLMLGGKDRRVSPHQGLELYKVLKTRASPVRLLWFPEDGHSLSRVDTQADCFVNTALWLQQ 755          

HSP 2 Score: 141.354 bits (355), Expect = 5.561e-34
Identity = 108/400 (27.00%), Postives = 187/400 (46.75%), Query Frame = -3
Query: 2059 NITSVYKSYARYPNLNSAKFLNNADP----YIISSTWTVNDLVTSKTKNLNLNFYYEKDKN-------LILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEIGNQFK--YKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEP-ITEFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETL 3216
             I  VY   + +P   SA       P    Y +++ W+ +DLV     + +  +    D N       ++   P   +  E++   +S     +AI  E      SG +    L+ +W      K +NL  ++IHG V+  +  FG+  W +   KL+Y+AE             S + SA G     + +  Y +D+GE LT+   PV+C++D+    ++VL        +S G     P+   + F G+ + P+ LGL +C  R   LF   ++ +  +++   N S   P+ SPDG  +I+L+    GPH QC  L + ++ +  T  ++DV+  P   EF G+Y   L+  CW+ DS  ++ +SA +    + ++D K+K V  L++S+TV   TL
Sbjct:    5 QIAGVYAEVSGFPTPVSAHVKVEELPEYRVYSVTADWSQSDLVRGSRLHYSQQWTLIADTNNHKTVRTVLPPGPFTPVSGELLR-AFSPIRGLKAIVRE------SGNQ---QLLEIWDCHGLRKCLNLTALNIHGRVYDDA-QFGSLSWSECEDKLLYVAEK------------SRNSSAGGESACREDRNVYCEDWGEALTSKSVPVVCVVDLHSGVVDVLQGVP--EDVSPGQALWAPDYQSVFFVGWYHEPFRLGLKFCSNRSSSLFVLDMEGR-CERLSGANLSVSCPRLSPDGSTLIFLQGRVFGPHHQCLSLQQLDLKSRKTSALIDVLNRPQAGEFAGVYET-LSPCCWSADSQRVVFSSACRNWKDLFVVDRKSKKV--LSLSDTVPLSTL 375          
BLAST of SMED30008513 vs. Ensembl Medaka
Match: ENSORLT00000040051.1 (pep primary_assembly:ASM223467v1:1:37354481:37359289:-1 gene:ENSORLG00000026212.1 transcript:ENSORLT00000040051.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 1.634e-12
Identity = 27/76 (35.53%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  524 VKNAS*KFQRCMDKIISPLR-EFSGTYIGDIIVLSTSKKEHEKNLDLIREALKQENLSIKEEKSNIESISRQLDYL 748
            +KNA   FQR M+K++  LR      YI D+I+ S S ++H K+L  +   L   NL +  +K       RQL +L
Sbjct:  858 LKNAGATFQRLMEKVLGELRGRLCCVYIDDVIIFSPSAEQHLKDLQAVFGKLHSANLVLNLKKCTF--FQRQLRFL 931          

HSP 2 Score: 36.5798 bits (83), Expect = 1.634e-12
Identity = 18/36 (50.00%), Postives = 22/36 (61.11%), Query Frame = 3
Query:  423 KKAYHQIPIALDYIPKTAVITHYGLYEYVKMTFALK 530
            K  Y Q+ +A D   KTAVIT  GLY++  M F LK
Sbjct:  824 KSGYWQVAMAEDSKAKTAVITPVGLYQFKSMPFGLK 859          

HSP 3 Score: 30.4166 bits (67), Expect = 1.634e-12
Identity = 14/32 (43.75%), Postives = 19/32 (59.38%), Query Frame = 1
Query:  337 CGDYRGLNA-LRVDRYPLPRITGILDQLRGKK 429
            C DYR LNA    D YP+P I  +L+ + G +
Sbjct:  785 CVDYRRLNAKTTADAYPMPLIHDLLESMHGAE 816          
BLAST of SMED30008513 vs. Ensembl Medaka
Match: ENSORLT00000037906.1 (pep primary_assembly:ASM223467v1:16:28643737:28647831:-1 gene:ENSORLG00000027277.1 transcript:ENSORLT00000037906.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 2.997e-12
Identity = 24/61 (39.34%), Postives = 37/61 (60.66%), Query Frame = 2
Query:  530 NAS*KFQRCMDKIISPLREFSGT-YIGDIIVLSTSKKEHEKNLDLIREALKQENLSIKEEK 709
            NA   FQR M+++    R  S   Y+ DII+ S+S ++H + LDL+   LKQ NL ++ +K
Sbjct:  480 NAPGTFQRLMERLFGDQRYQSLLLYLDDIIIFSSSFEQHLERLDLVFSRLKQYNLKVRLQK 540          

HSP 2 Score: 36.1946 bits (82), Expect = 2.997e-12
Identity = 19/35 (54.29%), Postives = 22/35 (62.86%), Query Frame = 1
Query:  328 VQTCGDYRGLNA-LRVDRYPLPRITGILDQLRGKK 429
            ++ C DYR LNA  R D +PLPRI   LD L G K
Sbjct:  402 LRLCVDYRQLNANTRKDAFPLPRIDESLDALHGAK 436          

HSP 3 Score: 31.9574 bits (71), Expect = 2.997e-12
Identity = 14/33 (42.42%), Postives = 20/33 (60.61%), Query Frame = 3
Query:  429 AYHQIPIALDYIPKTAVITHYGLYEYVKMTFAL 527
             YHQ+ +A     KTA  T +GL+E+ +M F L
Sbjct:  446 GYHQVGMAEKDRCKTAFCTPFGLFEFTRMPFGL 478          
BLAST of SMED30008513 vs. Planmine SMEST
Match: SMESG000008541.1 (SMESG000008541.1)

HSP 1 Score: 1474.14 bits (3815), Expect = 0.000e+0
Identity = 710/710 (100.00%), Postives = 710/710 (100.00%), Query Frame = -3
Query: 1102 MSVLKNITSVYKSYARYPNLNSAKFLNNADPYIISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITEFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFISSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTERYLDE 3231
            MSVLKNITSVYKSYARYPNLNSAKFLNNADPYIISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITEFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFISSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTERYLDE
Sbjct:    1 MSVLKNITSVYKSYARYPNLNSAKFLNNADPYIISSTWTVNDLVTSKTKNLNLNFYYEKDKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSSGKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRKLVYIAESKKPKKLSFFQNVSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNPVICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNLGLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETDASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITEFTGLYNLGLTENCWTYDSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLLVKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIPEFDHPKFGKKKYQSIFISSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVLWWFTERYLDE 710          
BLAST of SMED30008513 vs. Planmine SMEST
Match: SMESG000049836.1 (SMESG000049836.1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.572e-14
Identity = 59/215 (27.44%), Postives = 102/215 (47.44%), Query Frame = -3
Query: 1162 PMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVE 1806
            P++++ HGGP S+      +        GF  L V+YRGS GYG+   + L    G  D  DC + ++ ++ E    VD   + + G S GG+  +  +  YSD  ++      V +L S+   T   +  + +  I    DY   ++  +   ERSP++    IKC ++   G +DK VP  Q  ++Y+A++A+ +   L +Y  + H     E
Sbjct:  404 PLLVLAHGGPTSSAKLSLNLNIQYYTSRGFAVLDVDYRGSTGYGKQYRNLLQHKWGLFDRIDCCEGAQYLVSE--HLVDRTMLAISGKSAGGY-TTLCSLTYSDIFRTGCSIYGVGDLKSLVEDTHKFESRYLDILIG---DYQQCQQLYH---ERSPINYPANIKCAMVFYQGDEDKVVPKEQSEKMYEAVKAQGIPCSLVMYKGERHGFRKAE 609          
BLAST of SMED30008513 vs. Planmine SMEST
Match: SMESG000049836.1 (SMESG000049836.1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.603e-14
Identity = 59/215 (27.44%), Postives = 102/215 (47.44%), Query Frame = -3
Query: 1162 PMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVE 1806
            P++++ HGGP S+      +        GF  L V+YRGS GYG+   + L    G  D  DC + ++ ++ E    VD   + + G S GG+  +  +  YSD  ++      V +L S+   T   +  + +  I    DY   ++  +   ERSP++    IKC ++   G +DK VP  Q  ++Y+A++A+ +   L +Y  + H     E
Sbjct:  406 PLLVLAHGGPTSSAKLSLNLNIQYYTSRGFAVLDVDYRGSTGYGKQYRNLLQHKWGLFDRIDCCEGAQYLVSE--HLVDRTMLAISGKSAGGY-TTLCSLTYSDIFRTGCSIYGVGDLKSLVEDTHKFESRYLDILIG---DYQQCQQLYH---ERSPINYPANIKCAMVFYQGDEDKVVPKEQSEKMYEAVKAQGIPCSLVMYKGERHGFRKAE 611          
BLAST of SMED30008513 vs. Planmine SMEST
Match: SMESG000049836.1 (SMESG000049836.1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.787e-14
Identity = 59/215 (27.44%), Postives = 102/215 (47.44%), Query Frame = -3
Query: 1162 PMILMLHGGPHSAFYTDFTVFGAAVAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTATDIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVE 1806
            P++++ HGGP S+      +        GF  L V+YRGS GYG+   + L    G  D  DC + ++ ++ E    VD   + + G S GG+  +  +  YSD  ++      V +L S+   T   +  + +  I    DY   ++  +   ERSP++    IKC ++   G +DK VP  Q  ++Y+A++A+ +   L +Y  + H     E
Sbjct:  423 PLLVLAHGGPTSSAKLSLNLNIQYYTSRGFAVLDVDYRGSTGYGKQYRNLLQHKWGLFDRIDCCEGAQYLVSE--HLVDRTMLAISGKSAGGY-TTLCSLTYSDIFRTGCSIYGVGDLKSLVEDTHKFESRYLDILIG---DYQQCQQLYH---ERSPINYPANIKCAMVFYQGDEDKVVPKEQSEKMYEAVKAQGIPCSLVMYKGERHGFRKAE 628          
BLAST of SMED30008513 vs. Planmine SMEST
Match: SMESG000018885.1 (SMESG000018885.1)

HSP 1 Score: 61.6178 bits (148), Expect = 3.048e-9
Identity = 57/218 (26.15%), Postives = 102/218 (46.79%), Query Frame = -3
Query: 1171 PMILMLHGGPHS-AFYTDFTVFGAA--VAELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMPSKVDGNKIFLYGGSHGGFLASHLAAHYSDR-VKSAACRNPVINLISMTTATDIPDWNFTE--CGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQDDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLA 1806
            P++L ++ GP S A  T FT   A   V+ L    L V+ RG+   G++   ++   +G +++ D IKA+E+++ +    ++  +I  YG S+GGF   H+     ++ ++      PV       T+ D  D  +TE   G+K K      + DI+   +   L     IK   L++ G  D  V      +L ++L  +    ++ +YP + H LA
Sbjct:  591 PLLLSVYAGPSSQAVTTKFTFDWATYLVSSLNIINLQVDGRGTLNRGREFERAVYKNMGVIEIHDQIKATEEIVSKY-HFINKTQIGAYGWSYGGFAVGHILRTIDNKMIRCGVSVAPV-------TSFDYYDTAYTERYLGLKEKNPLAYQQTDISNFAKSFDLG----IKKKYLLIHGTKDDNVHFLNSAKLIRSLVEKGFDFDVMVYPDEAHTLA 796          
The following BLAST results are available for this feature:
BLAST of SMED30008513 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
APEH2.634e-11832.33acylaminoacyl-peptide hydrolase [Source:HGNC Symbo... [more]
APEH1.178e-11431.97acylaminoacyl-peptide hydrolase [Source:HGNC Symbo... [more]
APEH5.560e-3633.10acylaminoacyl-peptide hydrolase [Source:HGNC Symbo... [more]
APEH7.517e-3131.88acylaminoacyl-peptide hydrolase [Source:HGNC Symbo... [more]
APEH1.497e-1722.98acylaminoacyl-peptide hydrolase [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30008513 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpf-57.928e-7828.02Dipeptidyl Peptidase Four (IV) family [Source:Uni... [more]
dpf-57.928e-7828.02Dipeptidyl Peptidase Four (IV) family [Source:Uni... [more]
dpf-52.390e-7630.34Dipeptidyl Peptidase Four (IV) family [Source:Uni... [more]
dpf-52.390e-7630.34Dipeptidyl Peptidase Four (IV) family [Source:Uni... [more]
dpf-41.162e-1728.31Dipeptidyl Peptidase Four (IV) family [Source:Uni... [more]
back to top
BLAST of SMED30008513 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG113191.248e-624.09gene:FBgn0031835 transcript:FBtr0343159[more]
CG113191.440e-624.09gene:FBgn0031835 transcript:FBtr0343160[more]
CG113191.440e-624.09gene:FBgn0031835 transcript:FBtr0089641[more]
back to top
BLAST of SMED30008513 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
apeh4.052e-11832.74acylaminoacyl-peptide hydrolase [Source:ZFIN;Acc:Z... [more]
zgc:1369711.373e-10332.25zgc:136971 [Source:ZFIN;Acc:ZDB-GENE-060421-3674][more]
zgc:1369711.373e-10332.25zgc:136971 [Source:ZFIN;Acc:ZDB-GENE-060421-3674][more]
zgc:1369719.205e-9331.02zgc:136971 [Source:ZFIN;Acc:ZDB-GENE-060421-3674][more]
back to top
BLAST of SMED30008513 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
APEH7.950e-12934.02acylaminoacyl-peptide hydrolase [Source:NCBI gene;... [more]
APEH2.127e-12834.02acylaminoacyl-peptide hydrolase [Source:NCBI gene;... [more]
APEH2.605e-12733.70acylaminoacyl-peptide hydrolase [Source:NCBI gene;... [more]
APEH8.430e-12032.73acylaminoacyl-peptide hydrolase [Source:NCBI gene;... [more]
APEH4.312e-11633.48acylaminoacyl-peptide hydrolase [Source:NCBI gene;... [more]
back to top
BLAST of SMED30008513 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Apeh6.262e-12731.92acylpeptide hydrolase [Source:MGI Symbol;Acc:MGI:8... [more]
Apeh1.765e-11630.82acylpeptide hydrolase [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of SMED30008513 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R146|APEH_MOUSE4.380e-12631.92Acylamino-acid-releasing enzyme OS=Mus musculus OX... [more]
sp|P19205|ACPH_PIG1.854e-12431.78Acylamino-acid-releasing enzyme OS=Sus scrofa OX=9... [more]
sp|P13676|ACPH_RAT2.510e-12331.92Acylamino-acid-releasing enzyme OS=Rattus norvegic... [more]
sp|P80227|ACPH_BOVIN1.777e-11831.86Acylamino-acid-releasing enzyme OS=Bos taurus OX=9... [more]
sp|P13798|ACPH_HUMAN1.265e-11732.33Acylamino-acid-releasing enzyme OS=Homo sapiens OX... [more]
back to top
BLAST of SMED30008513 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A7092.299e-14736.38Peptidase_S9 domain-containing protein OS=Lottia g... [more]
A0A1I8GHA11.423e-13834.01Peptidase_S9 domain-containing protein OS=Macrosto... [more]
A0A267GS901.799e-13834.01Peptidase_S9 domain-containing protein (Fragment) ... [more]
A0A098M0X31.159e-13633.84Acylamino-acid-releasing enzyme OS=Hypsiglena sp. ... [more]
A0A267FM491.031e-13533.87Peptidase_S9 domain-containing protein (Fragment) ... [more]
back to top
BLAST of SMED30008513 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apeh1.384e-12332.81acylaminoacyl-peptide hydrolase [Source:NCBI gene;... [more]
apeh1.656e-12333.42acylaminoacyl-peptide hydrolase [Source:NCBI gene;... [more]
apeh8.593e-12033.79acylaminoacyl-peptide hydrolase [Source:NCBI gene;... [more]
zgc:1369714.496e-9330.83zgc:136971 [Source:ZFIN;Acc:ZDB-GENE-060421-3674][more]
ENSAMXT00000041345.13.116e-1234.21pep primary_assembly:Astyanax_mexicanus-2.0:25:323... [more]
back to top
BLAST of SMED30008513 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001392.14.402e-1524.60pep scaffold:Pmarinus_7.0:GL482689:14672:17070:1 g... [more]
back to top
BLAST of SMED30008513 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008513 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO405649.051e-11730.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30008513 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apeh1.746e-12533.02acylamino-acid-releasing enzyme [Source:NCBI gene;... [more]
zgc:1369712.367e-10230.25acylamino-acid-releasing enzyme [Source:NCBI gene;... [more]
zgc:1369719.049e-5734.91acylamino-acid-releasing enzyme [Source:NCBI gene;... [more]
ENSORLT00000040051.11.634e-1235.53pep primary_assembly:ASM223467v1:1:37354481:373592... [more]
ENSORLT00000037906.12.997e-1239.34pep primary_assembly:ASM223467v1:16:28643737:28647... [more]
back to top
BLAST of SMED30008513 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008541.10.000e+0100.00SMESG000008541.1[more]
SMESG000049836.12.572e-1427.44SMESG000049836.1[more]
SMESG000049836.12.603e-1427.44SMESG000049836.1[more]
SMESG000049836.12.787e-1427.44SMESG000049836.1[more]
SMESG000018885.13.048e-926.15SMESG000018885.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008513 ID=SMED30008513|Name=SMED30008513|organism=Schmidtea mediterranea sexual|type=transcript|length=3344bp
CACGGCCAACAACATTCAAATCAACAGTCATGGTCATGGAGATTCATCGT
TGCCGATGTTACGTGTCCAATCCTTGGGGATGATTTCCTAGTGAAACACA
ACATTATTGTAAATTACAGAAATTCCGAAAATTTCAAAAGATACCGAACA
CGATATTCAGACATCTATCAAGTGGCCAATGAAAATCTAAACAACTGGTC
CCTACTAGCACAACGAGCAAGATTCCTGGGAGGAATGATACTGGAATATG
TACGGAAAGAATTCGATGAGCTCATAAAGTCATTGTTCGAGAAAGCAAAC
CTGAATGGGCTGCACCACTAGTAACTAGTACAGACATGTGGGGATTACAG
AGGCTTGAACGCACTAAGAGTTGATCGGTATCCTCTTCCAAGAATAACGG
GCATTCTTGATCAATTACGAGGAAAAAAGCCTATCATCAAATCCCTATAG
CATTAGATTATATTCCCAAAACAGCAGTTATAACTCATTACGGTCTCTAC
GAATATGTCAAAATGACATTTGCGTTAAAAATGCCTCTTAGAAATTCCAA
AGATGCATGGACAAGATAATAAGTCCATTAAGAGAGTTCAGCGGCACCTA
CATAGGTGATATAATAGTATTATCAACATCCAAAAAAGAGCATGAGAAGA
ACCTGGATCTTATTCGTGAAGCTTTAAAACAGGAAAATCTTTCAATCAAG
GAAGAGAAATCCAATATCGAATCAATATCTCGTCAATTGGATTATCTGAC
CAAGAAGACAAAATCCAATCATTTTATTCATTCTCTCAACTAAGATGTAA
AAGATTTAGGAGGCTTTATTGGGCAGTGAAATTCTACCATTGGCTCATTC
CAAATTTGGCTAATACCATGGCAAAACGTCATTAATTATGAGAGTTCAAG
AAAATATTACCAAAAATCATTGCTGAAAGGCTGACAATAATTTTCATTTA
GCTCCCGTTCACAAATGAAAATGGAAAGCTTTCGACACAGGGTTAATTCT
GTTTCATTGGTTAGGATTTTATAAATTTATTAAAATCAAATAAAGCAATT
TTTCAACAAATAGGGCAAAACATCTCCTAAAACCATAATGAATTCATATC
ATTCATCTAAATATCGTTCAGTGAACCACCACAAAACATTGACAAAAGAG
TCCGACGAAGCTTCAACTGATGCTAGTGGATGACAGTCTTTGGGATAAAT
GTATAATTCCGTTTTGACAGATCTTGCTCGTAAAGCTTTGTATAACTCTA
ACCCCTGGGACGGAGGAACTCTTTTATCGTCTTGTCCAATCATGATAAGA
ATTGGACATTTGATTTTGTCTACTAAACTTAATGGAGACCTTTCCCACAT
AGTGTTTATATCTTCCTTGTTCAACAAATAATCAAATTTCCATTTTATAC
CACATTCAGTAAAATTCCAGTCAGGTATATCGGTAGCGGTTGTCATTGAT
ATGAGATTAATGACTGGGTTACGACATGCTGCAGATTTTACTCTATCAGA
GTAATGGGCTGCTAGATGACTTGCCAGGAAACCTCCGTGCGATCCTCCAT
AAAGAAATATTTTATTACCATCCACTTTTGATGGCATTTCTCTTATCATA
TCCTCTGATGCCTTTATGCAATCTTTGACATCCATTTGACCGATATAACC
CAGTAGAGAATCGATTGAATCCTGACCGTAACCCCAACTGCCACGATAAT
TAACCATCAATGCATGAAAACCTAATTCAGCAACTGCAGCACCAAAAACA
GTGAAATCCGTATAAAAAGCGCTATGAGGACCTCCATGAAGCATCAAAAT
CATTGGACAGCTTCCTTCTTTTTTTGACGAAATGAATATGGACTGATACT
TTTTCTTTCCGAATTTCGGGTGATCAAACTCAGGAATATGGTCCAATATC
TGACAATTTAAAACATTATCAAATCTGTAAATGGAACTCAGAGGAACTAA
TCTCATTTCATTTTCCAATAAAGCCGATTTTAATTCACCAATAGCGAGAT
AAGGCACAGTTGATGGTGATGAAACTTTAACCAATAGGAATCGATCATTC
AAATCTAATAAAGTTTCACTGTTTACAGTTTCGCTAACATTGAGAATGTT
AACATTTTTCGTTTTTATATCAATTAAAATAATTTTATTTTGACATTTCA
CGGCCGAAGTCAGCAAAATGTGATTCGAGTCATAAGTCCAACAATTTTCC
GTTAATCCGAGATTATATAAGCCTGTAAATTCGGTAATTGGCTCTTTAAC
AACATCAACTACTACATCAGTGAAACCTGTAGCAATTTCATATTTCATTA
ATCTTTGACACTGCATATGTGGACCAGATGCATCGGTTTCTAACCAAATT
ATGAATCTTCCATCAGGACTGAACTTTGGCGACATTTGTGATTTGTTTTC
ATCGCCTATTTTCTTAATTTCTTTGGAGTCGAGGCTATAGTAAAACAATT
CACAGTGCCTTTGAATACAGTATATCAATCCCAAATTGTATGGCATATTC
TCGTAGCCCGTAAATGCCAATCCTAAGCCGTTTGGATGACAGCATACTGT
GCCAATACTTAAACCAGGACACAATGTGGTCGAATCAAGAACTTCTATTT
GCTCTTCATCGACATCTAAGATACATATCACCGGATTTCCAACATTTGTT
AATTGTTCCCCGAAATCTTGTTTATATTTAAACTGGTTACCAATTTCAAT
GCCTTTGGCAGATTGGTCGTGTGAAACATTTTGGAAAAATGATAATTTCT
TTGGTTTTTTCGATTCAGCAATATAAACCAATTTTCTCCCATCCTTAAGC
CACTGGAAATTTCCAAAGTTAAAACTTTTCTTATGTACCATTCCGTGAAT
ATCCATGTCATTTAAATTTATAGACTTGATAAATAGCTCGTCAATCCACA
AGTGAATTAAATTTGTTTTTGATTCTTTGCCTGAAGAGTCATTACTTTTT
CTTTCTAAAAAGATTGCTCGATGTTTATAAGACGATGAGTATACGTCCAT
TATTATTTCTTCGTCCATTAAAACTTGCGGTGATTTCAAAATTAAATTTT
TATCCTTTTCATAATAAAAATTGAGGTTTAAATTTTTAGTTTTTGATGTT
ACTAGATCATTGACAGTCCATGTTGAGCTAATAATATAAGGATCTGCATT
GTTTAAAAATTTGGCAGAATTTAAATTTGGATATCTTGCGTAACTTTTAT
AAACTGAAGTAATATTTTTTAAAACTGACATATTTTAATCAAAAAATTTA
AATATCGAATAAATTAAATAGATAAATAAGCCACTTTTAAATGCAAAAAT
CTAAATTGATAATTTAATATTGAAGGTGAAACTTTCGTAATTTT
back to top

protein sequence of SMED30008513-orf-1

>SMED30008513-orf-1 ID=SMED30008513-orf-1|Name=SMED30008513-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
HGQQHSNQQSWSWRFIVADVTCPILGDDFLVKHNIIVNYRNSENFKRYRT
RYSDIYQVANENLNNWSLLAQRARFLGGMILEYVRKEFDELIKSLFEKAN
LNGLHH*
back to top

protein sequence of SMED30008513-orf-2

>SMED30008513-orf-2 ID=SMED30008513-orf-2|Name=SMED30008513-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=711bp
MSVLKNITSVYKSYARYPNLNSAKFLNNADPYIISSTWTVNDLVTSKTKN
LNLNFYYEKDKNLILKSPQVLMDEEIIMDVYSSSYKHRAIFLERKSNDSS
GKESKTNLIHLWIDELFIKSINLNDMDIHGMVHKKSFNFGNFQWLKDGRK
LVYIAESKKPKKLSFFQNVSHDQSAKGIEIGNQFKYKQDFGEQLTNVGNP
VICILDVDEEQIEVLDSTTLCPGLSIGTVCCHPNGLGLAFTGYENMPYNL
GLIYCIQRHCELFYYSLDSKEIKKIGDENKSQMSPKFSPDGRFIIWLETD
ASGPHMQCQRLMKYEIATGFTDVVVDVVKEPITEFTGLYNLGLTENCWTY
DSNHILLTSAVKCQNKIILIDIKTKNVNILNVSETVNSETLLDLNDRFLL
VKVSSPSTVPYLAIGELKSALLENEMRLVPLSSIYRFDNVLNCQILDHIP
EFDHPKFGKKKYQSIFISSKKEGSCPMILMLHGGPHSAFYTDFTVFGAAV
AELGFHALMVNYRGSWGYGQDSIDSLLGYIGQMDVKDCIKASEDMIREMP
SKVDGNKIFLYGGSHGGFLASHLAAHYSDRVKSAACRNPVINLISMTTAT
DIPDWNFTECGIKWKFDYLLNKEDINTMWERSPLSLVDKIKCPILIMIGQ
DDKRVPPSQGLELYKALRARSVKTELYIYPKDCHPLASVEASSDSFVNVL
WWFTERYLDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR001375Peptidase_S9
IPR0110426-blade_b-propeller_TolB-like
IPR000477RT_dom
Vocabulary: molecular function
TermDefinition
GO:0008236serine-type peptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001375Peptidase S9, prolyl oligopeptidase, catalytic domainPFAMPF00326Peptidase_S9coord: 500..705
e-value: 3.2E-31
score: 108.5
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 186..409
e-value: 1.6E-8
score: 36.2
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 462..708
e-value: 3.1E-56
score: 192.8
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 470..705
NoneNo IPR availablePANTHERPTHR42776:SF4ACYLAMINO-ACID-RELEASING ENZYMEcoord: 4..705
NoneNo IPR availablePANTHERPTHR42776FAMILY NOT NAMEDcoord: 4..705
NoneNo IPR availableSUPERFAMILYSSF82171DPP6 N-terminal domain-likecoord: 136..413