DNA topoisomerase

Overview
NameDNA topoisomerase
Smed IDSMED30008509
Length (bp)2104
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA topoisomerase (SMED30008509) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA topoisomerase (SMED30008509) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA topoisomerase (SMED30008509) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA topoisomerase (SMED30008509) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008509

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30008509h1SMcG0021826 SmedASXL_018637SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30008509h1SMcG0021826 SmedASXL_007957SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gamma neoblastSMED30008509h1SMcG0021826 dd_Smed_v6_20479_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008509h1SMcG0021826 dd_Smed_v6_20479_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA topoisomerase vs. Ensembl Human
Match: TOP3A (DNA topoisomerase III alpha [Source:HGNC Symbol;Acc:HGNC:11992])

HSP 1 Score: 379.793 bits (974), Expect = 1.705e-118
Identity = 246/679 (36.23%), Postives = 333/679 (49.04%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACL-YCDKSFCEALNIRF-----HTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSS--TVMNSANTPQS-----------SNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDE---PNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K    L  DE R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC+G K    VL   +  YK+++     K  KL E +A+Y      G+  + A    + P   E +R CP C   ++++  K   ++L C  +P C+ A+WLPD+V    L  S+++     C  H  +   L   + S+       F+             C+  CD +  E L++RF       S+PS   Q       +NQ+  ++  S  P       QP + S     + +  Q L         ++  C+CGQ A    V KEGPN+ + F+ C+   C  F W +S +     P   +   +  S   P              + + S  +C C +P    TV+K+  NKGRQF++C+     QC FFQW DE   P   G  S   +  R+ +S  E    +  A +S++            K  R C LC QPGHT   CP  +
Sbjct:  367 FAQSILERGGPTPRNGNKSDQAHPPIHPTKYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLMILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLT-PDKRFL-PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYF-----GNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSV----LEASRDSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFV------------CCIGGCDDTLREILDLRFSGGPPRASQPSGRLQ-------ANQSLNRMDNSQHP-------QP-ADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNGGSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLES--EARSKRPRASSSDM--------GSTAKKPRKCSLCHQPGHTRPFCPQNR 976          

HSP 2 Score: 62.3882 bits (150), Expect = 2.613e-9
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  120 IWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEIT 157          
BLAST of DNA topoisomerase vs. Ensembl Human
Match: TOP3A (DNA topoisomerase III alpha [Source:HGNC Symbol;Acc:HGNC:11992])

HSP 1 Score: 379.793 bits (974), Expect = 1.705e-118
Identity = 246/679 (36.23%), Postives = 333/679 (49.04%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACL-YCDKSFCEALNIRF-----HTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSS--TVMNSANTPQS-----------SNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDE---PNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K    L  DE R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC+G K    VL   +  YK+++     K  KL E +A+Y      G+  + A    + P   E +R CP C   ++++  K   ++L C  +P C+ A+WLPD+V    L  S+++     C  H  +   L   + S+       F+             C+  CD +  E L++RF       S+PS   Q       +NQ+  ++  S  P       QP + S     + +  Q L         ++  C+CGQ A    V KEGPN+ + F+ C+   C  F W +S +     P   +   +  S   P              + + S  +C C +P    TV+K+  NKGRQF++C+     QC FFQW DE   P   G  S   +  R+ +S  E    +  A +S++            K  R C LC QPGHT   CP  +
Sbjct:  367 FAQSILERGGPTPRNGNKSDQAHPPIHPTKYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLMILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLT-PDKRFL-PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYF-----GNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSV----LEASRDSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFV------------CCIGGCDDTLREILDLRFSGGPPRASQPSGRLQ-------ANQSLNRMDNSQHP-------QP-ADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNGGSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLES--EARSKRPRASSSDM--------GSTAKKPRKCSLCHQPGHTRPFCPQNR 976          

HSP 2 Score: 62.3882 bits (150), Expect = 2.613e-9
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  120 IWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEIT 157          
BLAST of DNA topoisomerase vs. Ensembl Human
Match: TOP3A (DNA topoisomerase III alpha [Source:HGNC Symbol;Acc:HGNC:11992])

HSP 1 Score: 379.407 bits (973), Expect = 3.714e-118
Identity = 246/679 (36.23%), Postives = 333/679 (49.04%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACL-YCDKSFCEALNIRF-----HTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSS--TVMNSANTPQS-----------SNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDE---PNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K    L  DE R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC+G K    VL   +  YK+++     K  KL E +A+Y      G+  + A    + P   E +R CP C   ++++  K   ++L C  +P C+ A+WLPD+V    L  S+++     C  H  +   L   + S+       F+             C+  CD +  E L++RF       S+PS   Q       +NQ+  ++  S  P       QP + S     + +  Q L         ++  C+CGQ A    V KEGPN+ + F+ C+   C  F W +S +     P   +   +  S   P              + + S  +C C +P    TV+K+  NKGRQF++C+     QC FFQW DE   P   G  S   +  R+ +S  E    +  A +S++            K  R C LC QPGHT   CP  +
Sbjct:  392 FAQSILERGGPTPRNGNKSDQAHPPIHPTKYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLMILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLT-PDKRFL-PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYF-----GNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSV----LEASRDSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFV------------CCIGGCDDTLREILDLRFSGGPPRASQPSGRLQ-------ANQSLNRMDNSQHP-------QP-ADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNGGSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLES--EARSKRPRASSSDM--------GSTAKKPRKCSLCHQPGHTRPFCPQNR 1001          

HSP 2 Score: 62.3882 bits (150), Expect = 2.635e-9
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  145 IWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEIT 182          
BLAST of DNA topoisomerase vs. Ensembl Human
Match: TOP3A (DNA topoisomerase III alpha [Source:HGNC Symbol;Acc:HGNC:11992])

HSP 1 Score: 379.407 bits (973), Expect = 3.714e-118
Identity = 246/679 (36.23%), Postives = 333/679 (49.04%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACL-YCDKSFCEALNIRF-----HTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSS--TVMNSANTPQS-----------SNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDE---PNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K    L  DE R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC+G K    VL   +  YK+++     K  KL E +A+Y      G+  + A    + P   E +R CP C   ++++  K   ++L C  +P C+ A+WLPD+V    L  S+++     C  H  +   L   + S+       F+             C+  CD +  E L++RF       S+PS   Q       +NQ+  ++  S  P       QP + S     + +  Q L         ++  C+CGQ A    V KEGPN+ + F+ C+   C  F W +S +     P   +   +  S   P              + + S  +C C +P    TV+K+  NKGRQF++C+     QC FFQW DE   P   G  S   +  R+ +S  E    +  A +S++            K  R C LC QPGHT   CP  +
Sbjct:  392 FAQSILERGGPTPRNGNKSDQAHPPIHPTKYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLMILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLT-PDKRFL-PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYF-----GNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSV----LEASRDSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFV------------CCIGGCDDTLREILDLRFSGGPPRASQPSGRLQ-------ANQSLNRMDNSQHP-------QP-ADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNGGSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLES--EARSKRPRASSSDM--------GSTAKKPRKCSLCHQPGHTRPFCPQNR 1001          

HSP 2 Score: 62.3882 bits (150), Expect = 2.635e-9
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  145 IWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEIT 182          
BLAST of DNA topoisomerase vs. Ensembl Human
Match: TOP3A (DNA topoisomerase III alpha [Source:HGNC Symbol;Acc:HGNC:11992])

HSP 1 Score: 379.407 bits (973), Expect = 3.714e-118
Identity = 246/679 (36.23%), Postives = 333/679 (49.04%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACL-YCDKSFCEALNIRF-----HTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSS--TVMNSANTPQS-----------SNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDE---PNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K    L  DE R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC+G K    VL   +  YK+++     K  KL E +A+Y      G+  + A    + P   E +R CP C   ++++  K   ++L C  +P C+ A+WLPD+V    L  S+++     C  H  +   L   + S+       F+             C+  CD +  E L++RF       S+PS   Q       +NQ+  ++  S  P       QP + S     + +  Q L         ++  C+CGQ A    V KEGPN+ + F+ C+   C  F W +S +     P   +   +  S   P              + + S  +C C +P    TV+K+  NKGRQF++C+     QC FFQW DE   P   G  S   +  R+ +S  E    +  A +S++            K  R C LC QPGHT   CP  +
Sbjct:  392 FAQSILERGGPTPRNGNKSDQAHPPIHPTKYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLMILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLT-PDKRFL-PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYF-----GNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSV----LEASRDSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFV------------CCIGGCDDTLREILDLRFSGGPPRASQPSGRLQ-------ANQSLNRMDNSQHP-------QP-ADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNGGSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLES--EARSKRPRASSSDM--------GSTAKKPRKCSLCHQPGHTRPFCPQNR 1001          

HSP 2 Score: 62.3882 bits (150), Expect = 2.635e-9
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  145 IWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEIT 182          
BLAST of DNA topoisomerase vs. Ensembl Celegans
Match: top-3 (DNA topoisomerase 3 [Source:UniProtKB/Swiss-Prot;Acc:O61660])

HSP 1 Score: 226.868 bits (577), Expect = 6.602e-64
Identity = 117/270 (43.33%), Postives = 164/270 (60.74%), Query Frame = 3
Query:  123 FATRLLSEGIHPHNGKKSDQAHPPIHPLK--QGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDE 926
            FA  +L  G++P NG+KSD+AHPPIHPLK  +   L  D+ +++EL+ RHFLAC+S+DA G ET V +   +                     E F  +GL + +  YL VY Y+KW ++ +P Y  GE F    + I   +T AP  LTEADL+ LMDK+GIGTDATHAEHIEK+K R+Y+G    G   LIP  LG+ LV+GY  +G  +S+PDLR+  E  L+ IC+G +Q  EVL+  +  Y+ I+  +  KI  L + + +YLD+
Sbjct:  364 FANEVLQNGVNPRNGRKSDEAHPPIHPLKFTEKHQLQGDDWKVYELVVRHFLACVSQDAQGEETMVNLTVGT---------------------EKFHASGLRIRDMGYLKVYVYEKWGNRLLPTYTEGERFTDFELKIGDGKTQAPDFLTEADLISLMDKYGIGTDATHAEHIEKIKTREYIGVRPDGK--LIPSFLGLALVDGYDDMGFAMSKPDLRANLEIGLKEICDGRRQKQEVLDEQIGKYRAIFVESERKIGVLSQSLQRYLDK 610          
BLAST of DNA topoisomerase vs. Ensembl Celegans
Match: Y48C3A.14 (DNA topoisomerase [Source:UniProtKB/TrEMBL;Acc:H1UBJ8])

HSP 1 Score: 121.324 bits (303), Expect = 3.854e-28
Identity = 89/261 (34.10%), Postives = 134/261 (51.34%), Query Frame = 3
Query:  126 ATRLLSEGI-HPHNG-KKSDQAHPPIHPLKQG-IGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPV----YGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKI 887
             +++L++GI  P +G  K D  HPPI P++    GL+ D +RI+E +++HF+A L K  +   T V + C             G+        E F+L G +V+E  +  V P+   V++E  V      IG   E  +  I   ET+ P  LTEA+L+ LM+KHGIGTDA+   HI  +  R+YV  T      L+P +LG  LV GY  V   L  P +R++ E  L L+ +G    L+V NH L  ++  ++   T I
Sbjct:  369 VSQVLADGIKRPKSGVDKGD--HPPITPMRPNHGGLSGDMSRIYEYVSQHFVATLMKQCVYEVTTVKMSC-------------GD--------EQFTLQGKNVVEPGFTAVMPWLS-VEEECSVPKSLQQIGAKIELQNAEIQARETTPPGYLTEAELITLMEKHGIGTDASIPVHINTITQRNYV--TVESGRRLVPTRLGQCLVRGYWKVDPELVLPTMRAELEEQLNLVASGKADYLDVKNHALKMFEMKFQYFVTNI 603          
BLAST of DNA topoisomerase vs. Ensembl Celegans
Match: Y48C3A.14 (DNA topoisomerase [Source:UniProtKB/TrEMBL;Acc:H1UBJ8])

HSP 1 Score: 120.939 bits (302), Expect = 3.943e-28
Identity = 90/263 (34.22%), Postives = 134/263 (50.95%), Query Frame = 3
Query:  126 ATRLLSEGI-HPHNG-KKSDQAHPPIHPLKQG-IGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKE----VP--VYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKI 887
             +++L++GI  P +G  K D  HPPI P++    GL+ D +RI+E +++HF+A L K  +   T V + C             G+        E F+L G +V+E  +  V P   W+  E    VP  +  IG   E  +  I   ET+ P  LTEA+L+ LM+KHGIGTDA+   HI  +  R+YV  T      L+P +LG  LV GY  V   L  P +R++ E  L L+ +G    L+V NH L  ++  ++   T I
Sbjct:  233 VSQVLADGIKRPKSGVDKGD--HPPITPMRPNHGGLSGDMSRIYEYVSQHFVATLMKQCVYEVTTVKMSC-------------GD--------EQFTLQGKNVVEPGFTAVMP---WLSVEEECSVPKSLQQIGAKIELQNAEIQARETTPPGYLTEAELITLMEKHGIGTDASIPVHINTITQRNYV--TVESGRRLVPTRLGQCLVRGYWKVDPELVLPTMRAELEEQLNLVASGKADYLDVKNHALKMFEMKFQYFVTNI 467          
BLAST of DNA topoisomerase vs. Ensembl Celegans
Match: Y48C3A.14 (DNA topoisomerase [Source:UniProtKB/TrEMBL;Acc:H1UBJ8])

HSP 1 Score: 65.855 bits (159), Expect = 3.233e-11
Identity = 38/100 (38.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  588 MDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKI 887
            M+KHGIGTDA+   HI  +  R+YV  T      L+P +LG  LV GY  V   L  P +R++ E  L L+ +G    L+V NH L  ++  ++   T I
Sbjct:    1 MEKHGIGTDASIPVHINTITQRNYV--TVESGRRLVPTRLGQCLVRGYWKVDPELVLPTMRAELEEQLNLVASGKADYLDVKNHALKMFEMKFQYFVTNI 98          
BLAST of DNA topoisomerase vs. Ensembl Fly
Match: Top3alpha (gene:FBgn0040268 transcript:FBtr0081246)

HSP 1 Score: 302.368 bits (773), Expect = 1.412e-88
Identity = 165/411 (40.15%), Postives = 226/411 (54.99%), Query Frame = 3
Query:  123 FATRLLSEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDE--NDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNV--WFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFHTSK 1343
            FA R++  G +P NG KSDQAHPPIHP K    L  +EAR++EL+ RHFLAC+SKDA+G ET V ID                       GE F+  GL + ERNYLDVY YDKW  K++  Y  G+ FEPT VS+ +  T+AP LLTEADL+ LM+KHGIGTDATHAEHI  +K R Y+G    G  FL+PG +GMGL EGY  +   L++P LR++FE DL+LIC G K P  VL   +  YK+ Y+    KI  +   ++  ++E P  +    + A  ++ +    +++  CP C    L  K KKN   W++GC N+P CK+A+WLP   +   +      E   TC + +            +K + +  +   +F      +  CL CD  F    NI   + K
Sbjct:  386 FAQRVIEWGPNPRNGNKSDQAHPPIHPTKLAENLQGNEARVYELVVRHFLACVSKDAVGSETLVHIDIA---------------------GEKFTANGLVIHERNYLDVYVYDKWSAKQIHHYENGQRFEPTEVSLHEGATTAPPLLTEADLIALMEKHGIGTDATHAEHINTIKERGYIGVLDKG--FLVPGVIGMGLYEGYDAMELALAKPQLRAEFELDLKLICQGQKDPKVVLTEQIAKYKQAYQQITDKITAMDAKISARINETPAANSAVQEGADGSAPSHGIIQSIFQCPKCNEAPLALKPKKNQQGWYIGCNNFPDCKNAVWLPTECKDASVLD----ECCPTCGDGYRM----------LKFRLSTPYYRGVFGTPSGWYKTCLPCDNLFRTTFNINLDSVK 759          

HSP 2 Score: 78.1814 bits (191), Expect = 1.690e-14
Identity = 63/228 (27.63%), Postives = 84/228 (36.84%), Query Frame = 3
Query: 1548 CGQIAATRKVSKEGPNKNKFFYTCSS-SKCQMFAWVES---------------------------------------GDVRNQNPHCSSTVMNSANTPQSSNNTRS-----DVNCNCGKPVNLLTVRKENQNKGRQFYSC----SQCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPP----PAHINKGKPKSVRSCLLCRQPGHTSRKCPSK 2072
            C Q A    V K GPN  + +Y C    +C  F W +                                        G    ++   S+  +    T Q   NT +     +V CNCG+  + LTVRK+  N+GR FY+C      C FF+W DE    G +ST                      ++N  PP    P  I    PK+ R C LCR+ GHT  KCP K
Sbjct: 1038 CQQPARQNTVRKNGPNLGRLYYKCPKPDECNFFQWADEPPSSAKSKNSTGSAPQSTTSWGSNRVVTLPSIQQSNSQRGQSSMRSNSSSTVTITQTKTKQQERNTATPGDGEEVMCNCGQLASQLTVRKDGPNQGRPFYACPTREKSCGFFKWGDEDQNQGASSTSWG-------------------SANRNPPGRSQPTAITSDGPKT-RRCGLCRKEGHTRNKCPRK 1245          

HSP 3 Score: 65.855 bits (159), Expect = 1.141e-10
Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+D C AIKPNI+V RA FSEIT
Sbjct:  137 IWTDCDREGENIGYEIIDVCRAIKPNISVYRATFSEIT 174          

HSP 4 Score: 51.2174 bits (121), Expect = 4.118e-6
Identity = 33/88 (37.50%), Postives = 46/88 (52.27%), Query Frame = 3
Query: 1713 NTPQSSNNTRSDVNC-NCGKPVNLLTVRKENQNKGRQFYSC---SQCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTS 1964
            +TP SS      V C  C +P    TVRK   N GR +Y C    +C+FFQW+DEP    +A +K +   + QS   +G N+ + L S
Sbjct: 1021 STPPSSVPESETVLCTGCQQPARQNTVRKNGPNLGRLYYKCPKPDECNFFQWADEPP--SSAKSKNSTGSAPQSTTSWGSNRVVTLPS 1106          
BLAST of DNA topoisomerase vs. Ensembl Fly
Match: Top3beta (gene:FBgn0026015 transcript:FBtr0340028)

HSP 1 Score: 100.138 bits (248), Expect = 2.203e-21
Identity = 74/248 (29.84%), Postives = 116/248 (46.77%), Query Frame = 3
Query:  126 ATRLLSEGIHPHNGKKSDQAHPPIHPLKQG--IGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIG-EGFSLTGLSVLERNYLDVYPYDKW-VDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYK 857
            A  +L +   P  GK +   HPPI P+K G     + D  R++E I RHF+  +S+D     T   +                       +G E FS T   +++  +  V  +  +  D+  P +  G       V + +S+T  P  LTE++L+ LM++HGIGTDA+   HI  +  R+YV +   G   L+P  LG+ LV GY  +   L  P +R++ E  L LI  G+    +VL H +  +K
Sbjct:  363 ARSILGDIQTPRKGKDAGD-HPPITPMKLGNRSDFDRDTWRVYEFICRHFMGTVSRDLKYRVTTAKL----------------------SVGMETFSCTASVLIDAGFTKVMTWSAFGKDEPQPPFVQGTQVAINDVRLIESQTGPPDYLTESELITLMEEHGIGTDASIPVHINNICQRNYV-HIENGRK-LMPTTLGIVLVHGYQKIDPELVLPTMRTEVERMLTLIAQGSANFQDVLRHAIKIFK 585          
BLAST of DNA topoisomerase vs. Ensembl Fly
Match: Top3beta (gene:FBgn0026015 transcript:FBtr0070930)

HSP 1 Score: 100.138 bits (248), Expect = 2.203e-21
Identity = 74/248 (29.84%), Postives = 116/248 (46.77%), Query Frame = 3
Query:  126 ATRLLSEGIHPHNGKKSDQAHPPIHPLKQG--IGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIG-EGFSLTGLSVLERNYLDVYPYDKW-VDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYK 857
            A  +L +   P  GK +   HPPI P+K G     + D  R++E I RHF+  +S+D     T   +                       +G E FS T   +++  +  V  +  +  D+  P +  G       V + +S+T  P  LTE++L+ LM++HGIGTDA+   HI  +  R+YV +   G   L+P  LG+ LV GY  +   L  P +R++ E  L LI  G+    +VL H +  +K
Sbjct:  363 ARSILGDIQTPRKGKDAGD-HPPITPMKLGNRSDFDRDTWRVYEFICRHFMGTVSRDLKYRVTTAKL----------------------SVGMETFSCTASVLIDAGFTKVMTWSAFGKDEPQPPFVQGTQVAINDVRLIESQTGPPDYLTESELITLMEEHGIGTDASIPVHINNICQRNYV-HIENGRK-LMPTTLGIVLVHGYQKIDPELVLPTMRTEVERMLTLIAQGSANFQDVLRHAIKIFK 585          
BLAST of DNA topoisomerase vs. Ensembl Zebrafish
Match: top3a (DNA topoisomerase III alpha [Source:ZFIN;Acc:ZDB-GENE-071212-2])

HSP 1 Score: 378.252 bits (970), Expect = 6.461e-118
Identity = 251/672 (37.35%), Postives = 337/672 (50.15%), Query Frame = 3
Query:  123 FATRLL-SEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLC-EGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFHTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWV----ESG-DVRNQNPHCSSTVM------NSANTPQSSNNTR------SDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCP 2066
            FA R+L S G  P NG KSDQAHPPIHP K   GL  +E R++E I RHFLAC SKDA G E  V ID                        E FS +GL+++ RNYL+VYPYDKW +K +P Y     F+PT++ + + +TS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T     FL PG+LGMGLVEGY+ +G  +S+PDLR++ EADL+L+  G K    VL++++  YK ++  +  K  KL E ++ YL  A    E +        P     VR CP C   M+L +K       L C  YPACK A+W PDTV    L  S++     TC  H  H       + S+       F+G I             CD +  E LN+++   + + +   + ++  S+Q       S PP  + ++N  I   +         Q   + Q  ++    VC+CGQ A    V KEGPN+ + FY C++  C+ F W     E G   RN+ P  S  V          N  Q   N R       +  CNC +P    TV KE  NKGR F++C      QC FFQW++E      A +  N  +          NK+ A T++V PP A       K  R+C +C +PGHT   CP
Sbjct:  390 FAQRILESGGPTPRNGNKSDQAHPPIHPTKYTNGLQGNEKRLYEFIVRHFLACCSKDAQGQEVTVEIDIAE---------------------ERFSASGLTIIARNYLEVYPYDKWYNKVIPSYSPNTTFQPTAIEMVEGQTSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLTA-DQRFL-PGELGMGLVEGYNSMGYEMSKPDLRAELEADLKLVSEGRKNKASVLSYHVAKYKAVFIESVRKAKKLDEALSNYLGPAQEIAEQEQVELEIPLP-----VRKCPQCNRDMVLKKKKDSTGMLLSCLGYPACKAAVWFPDTV----LEVSRDESICPTCRPHPVHMLKFKFKRGSLPPMMPLEFVGCIG-----------GCDDTLREVLNLKYLRGRDAESAPQANNSSRSSQHHIHRTSSAPPPSR-VEN--IRPPAPRPRADPGLQPPPSTQGGAI----VCNCGQDALLLTVRKEGPNQGRQFYKCNTGDCKFFLWADQPPEQGVPERNRGP-LSQNVQPPRPSNGFGNVSQQRQNHRGSGGDEGETMCNCNEPSVTRTVMKEGPNKGRMFHTCGKPRDQQCGFFQWANENVAPATAFSGGNGGKP-------SGNKK-ASTTSVKPPTA-------KRQRTCGICHEPGHTRVTCP 995          

HSP 2 Score: 65.4698 bits (158), Expect = 1.924e-10
Identity = 27/38 (71.05%), Postives = 31/38 (81.58%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+D C A+KPNI V RA+FSEIT
Sbjct:  142 VWTDCDREGENIGFEIIDVCKAVKPNIQVFRARFSEIT 179          
BLAST of DNA topoisomerase vs. Ensembl Zebrafish
Match: top3b (DNA topoisomerase III beta [Source:ZFIN;Acc:ZDB-GENE-070705-37])

HSP 1 Score: 121.709 bits (304), Expect = 5.156e-28
Identity = 86/248 (34.68%), Postives = 125/248 (50.40%), Query Frame = 3
Query:  135 LLSEGIH-PHNGKKSDQAHPPIHPLKQGIG--LNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKE-VPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIY 866
            LLSEGI+ P  G  +   HPPI P++      L  D  R+++ ITRHF+A +S D      K L   IS + +                 EGF+ +G +++   Y +V P+     +E +PV   GE+F    + + + +T+ P  LTEA+L+ LM+KHGIGTDA+   HI  +  R+YV  T      L P  LG+ LV GY  +   L  P +RS  E  L LI  G     +VL H L+ +K  +
Sbjct:  370 LLSEGINRPRKGADAGD-HPPITPMRAASENELGSDGWRLYDYITRHFIATVSPDC-----KYLQTTISFSIAT----------------EGFTCSGKTLISAGYTEVMPWQGIAQEEALPVCERGEMFTVDEIKLLEKQTNPPDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYV--TVESGRKLKPTNLGIVLVHGYYKIDADLVLPTIRSAVEKQLTLIALGKANFQQVLQHTLDIFKRKF 593          
BLAST of DNA topoisomerase vs. Ensembl Zebrafish
Match: top3b (DNA topoisomerase III beta [Source:ZFIN;Acc:ZDB-GENE-070705-37])

HSP 1 Score: 121.709 bits (304), Expect = 5.156e-28
Identity = 86/248 (34.68%), Postives = 125/248 (50.40%), Query Frame = 3
Query:  135 LLSEGIH-PHNGKKSDQAHPPIHPLKQGIG--LNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKE-VPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIY 866
            LLSEGI+ P  G  +   HPPI P++      L  D  R+++ ITRHF+A +S D      K L   IS + +                 EGF+ +G +++   Y +V P+     +E +PV   GE+F    + + + +T+ P  LTEA+L+ LM+KHGIGTDA+   HI  +  R+YV  T      L P  LG+ LV GY  +   L  P +RS  E  L LI  G     +VL H L+ +K  +
Sbjct:  370 LLSEGINRPRKGADAGD-HPPITPMRAASENELGSDGWRLYDYITRHFIATVSPDC-----KYLQTTISFSIAT----------------EGFTCSGKTLISAGYTEVMPWQGIAQEEALPVCERGEMFTVDEIKLLEKQTNPPDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYV--TVESGRKLKPTNLGIVLVHGYYKIDADLVLPTIRSAVEKQLTLIALGKANFQQVLQHTLDIFKRKF 593          
BLAST of DNA topoisomerase vs. Ensembl Zebrafish
Match: BX005237.1 (DNA topoisomerase III beta [Source:NCBI gene;Acc:793414])

HSP 1 Score: 121.324 bits (303), Expect = 5.213e-28
Identity = 86/248 (34.68%), Postives = 125/248 (50.40%), Query Frame = 3
Query:  135 LLSEGIH-PHNGKKSDQAHPPIHPLKQGIG--LNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKE-VPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIY 866
            LLSEGI+ P  G  +   HPPI P++      L  D  R+++ ITRHF+A +S D      K L   IS + +                 EGF+ +G +++   Y +V P+     +E +PV   GE+F    + + + +T+ P  LTEA+L+ LM+KHGIGTDA+   HI  +  R+YV  T      L P  LG+ LV GY  +   L  P +RS  E  L LI  G     +VL H L+ +K  +
Sbjct:  327 LLSEGINRPRKGADAGD-HPPITPMRAASENELGSDGWRLYDYITRHFIATVSPDC-----KYLQTTISFSIAT----------------EGFTCSGKTLISAGYTEVMPWQGIAQEEALPVCERGEMFTVDEIKLLEKQTNPPDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYV--TVESGRKLKPTNLGIVLVHGYYKIDADLVLPTIRSAVEKQLTLIALGKANFQQVLQHTLDIFKRKF 550          
BLAST of DNA topoisomerase vs. Ensembl Zebrafish
Match: neil3 (nei-like DNA glycosylase 3 [Source:ZFIN;Acc:ZDB-GENE-041114-18])

HSP 1 Score: 53.9138 bits (128), Expect = 5.534e-7
Identity = 49/180 (27.22%), Postives = 73/180 (40.56%), Query Frame = 3
Query: 1380 PSNQAQPKVMKSTPPFKKEIK------NQPISQSSFDFPTSSFR----QELENLQDTSVKSTPVCHCGQIAAT-RKVSKEGPNKNKFFYTCS---SSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSC-----SQCSFFQWSD 1862
            PSN       K   P+K+E        N+ +  ++  F   + +    +  +   D S+ +TP C       T R V+KEG NK + FYTCS    ++C  F W +                   + P           C+ GK   + TV K   N GR FY+C      QC+FFQW++
Sbjct:  406 PSNGVSGMQFKGNEPYKRESPTDHSQPNKRMKTTNGTFSGGNIKHISSRGTQQSNDASLPTTPCCKSHHRPCTQRVVTKEGENKGRQFYTCSLPRETQCNFFEWAD------------------LHFPM----------CHHGKRTVMKTVLKLGPNNGRNFYTCPVKMGKQCNFFQWAE 557          
BLAST of DNA topoisomerase vs. Ensembl Xenopus
Match: cryba1 (crystallin beta A1 [Source:Xenbase;Acc:XB-GENE-956128])

HSP 1 Score: 387.497 bits (994), Expect = 2.473e-121
Identity = 245/686 (35.71%), Postives = 335/686 (48.83%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF---------HTSKPSSNFQ-NSLSTIPSNQA-----QPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAW---VESGDVRNQNPHCSSTVMNSANTPQSSNNTR-----------SDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA R+L  G   P NG K+DQAHPPIHP K    L  +E RI+E I RHFLAC S+DA G ET V ID  +                     E F   GL ++ RNYLDVYPYDKW  K +PVY +G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG+LGMGLVEGY  +G  +S+PDLR++ E+DL+LIC G K    VL   +  YK+++     K  KL E +++Y      G      P   +   T   VR CP C   ++++  +   +FL C  YP CK ++W P  V  V    S++     TC  H  +   +   + S+       F+G I             CD++  E L++++            + S++ Q N  S    N       QP+     PP  K   ++ ++ +    P+SS   E+            VC+CG  A    V KEGPN+ + FY C+   C  F W    +SG    Q  H +    N+ + P++S++ R               C C +P    TV+K+  NKGRQF++CS     QC FFQW+DE  P G+            +P  FG   + + +S   P          K  RSC +C QPGH    CP  +
Sbjct:  380 FAQRILERGGPTPRNGNKTDQAHPPIHPTKYTNSLQGNEQRIYEFIVRHFLACCSQDAQGQETTVEIDIAA---------------------ERFVAHGLMIIARNYLDVYPYDKWNTKIIPVYEMGARFQPSTVEMVDGETSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLT-PEQRFL-PGELGMGLVEGYDSMGFEMSKPDLRAELESDLKLICEGKKDKFSVLRLQVQKYKQVFVEAAAKATKLDEALSQYF-----GQAAQPVPQEEIYADTPLPVRKCPQCNKDMVLKTKRDGGFFLSCVGYPGCKSSVWFPSFVLEV----SRDESICGTCKPHPVYKLKMKFKRGSVPPLMPLEFVGCIG-----------GCDETLREILDLKYLHGGNRAPQAAPRESNHLQVNQTSNRMGNSGDGRGRQPQAKTLKPPVAKPSASRGVAPT----PSSSESNEV------------VCNCGVAAVQLTVRKEGPNQGRPFYKCNGGACNFFLWADQADSGSPNAQGGHSTGRPSNAFSNPRASDSFRPAGGGSEPGSEGQAVCMCNQPAVTRTVQKDGANKGRQFHTCSKPREQQCGFFQWADENVPPGSG-----------APRGFGKKNKRSESSFSGP--------VAKKQRSCGICHQPGHNRTNCPQNR 987          

HSP 2 Score: 60.8474 bits (146), Expect = 6.691e-9
Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C ++KPN+ V RA+FSEIT
Sbjct:  133 IWTDCDREGENIGFEIIHVCKSVKPNLQVFRARFSEIT 170          
BLAST of DNA topoisomerase vs. Ensembl Xenopus
Match: cryba1 (crystallin beta A1 [Source:Xenbase;Acc:XB-GENE-956128])

HSP 1 Score: 387.882 bits (995), Expect = 2.688e-121
Identity = 245/686 (35.71%), Postives = 337/686 (49.13%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF---------HTSKPSSNFQ-NSLSTIPSNQA-----QPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAW---VESGDVRNQNPHCSSTVMNSANTPQSSNNTR-----------SDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA R+L  G   P NG K+DQAHPPIHP K    L  +E RI+E I RHFLAC S+DA G ET V ID  +                     E F   GL ++ RNYLDVYPYDKW  K +PVY +G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG+LGMGLVEGY  +G  +S+PDLR++ E+DL+LIC G K    VL   +  YK+++     K  KL E +++Y  +A         P   +   T   VR CP C   ++++  +   +FL C  YP CK ++W P  V  V    S++     TC  H  +   +   + S+       F+G I             CD++  E L++++            + S++ Q N  S    N       QP+     PP  K   ++ ++ +    P+SS   E+            VC+CG  A    V KEGPN+ + FY C+   C  F W    +SG    Q  H +    N+ + P++S++ R               C C +P    TV+K+  NKGRQF++CS     QC FFQW+DE  P G  ++         +P  FG   + + +S   P          K  RSC +C QPGH    CP  +
Sbjct:  397 FAQRILERGGPTPRNGNKTDQAHPPIHPTKYTNSLQGNEQRIYEFIVRHFLACCSQDAQGQETTVEIDIAA---------------------ERFVAHGLMIIARNYLDVYPYDKWNTKIIPVYEMGARFQPSTVEMVDGETSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLT-PEQRFL-PGELGMGLVEGYDSMGFEMSKPDLRAELESDLKLICEGKKDKFSVLRLQVQKYKQVFVEAAAKATKLDEALSQYFGQAA-----QPVPQEEIYADTPLPVRKCPQCNKDMVLKTKRDGGFFLSCVGYPGCKSSVWFPSFVLEV----SRDESICGTCKPHPVYKLKMKFKRGSVPPLMPLEFVGCIG-----------GCDETLREILDLKYLHGGNRAPQAAPRESNHLQVNQTSNRMGNSGDGRGRQPQAKTLKPPVAKPSASRGVAPT----PSSSESNEV------------VCNCGVAAVQLTVRKEGPNQGRPFYKCNGGACNFFLWADQADSGSPNAQGGHSTGRPSNAFSNPRASDSFRPAGGGSEPGSEGQAVCMCNQPAVTRTVQKDGANKGRQFHTCSKPREQQCGFFQWADENVPPGKEASNPG------APRGFGKKNKRSESSFSGP--------VAKKQRSCGICHQPGHNRTNCPQNR 1009          

HSP 2 Score: 60.8474 bits (146), Expect = 6.738e-9
Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C ++KPN+ V RA+FSEIT
Sbjct:  150 IWTDCDREGENIGFEIIHVCKSVKPNLQVFRARFSEIT 187          
BLAST of DNA topoisomerase vs. Ensembl Xenopus
Match: cryba1 (crystallin beta A1 [Source:Xenbase;Acc:XB-GENE-956128])

HSP 1 Score: 386.726 bits (992), Expect = 2.825e-121
Identity = 245/686 (35.71%), Postives = 336/686 (48.98%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF---------HTSKPSSNFQ-NSLSTIPSNQA-----QPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAW---VESGDVRNQNPHCSSTVMNSANTPQSSNNTR-----------SDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA R+L  G   P NG K+DQAHPPIHP K    L  +E RI+E I RHFLAC S+DA G ET V ID  +                     E F   GL ++ RNYLDVYPYDKW  K +PVY +G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG+LGMGLVEGY  +G  +S+PDLR++ E+DL+LIC G K    VL   +  YK+++     K  KL E +++Y  +A         P   +   T   VR CP C   ++++  +   +FL C  YP CK ++W P  V  V    S++     TC  H  +   +   + S+       F+G I             CD++  E L++++            + S++ Q N  S    N       QP+     PP  K   ++ ++ +    P+SS   E+            VC+CG  A    V KEGPN+ + FY C+   C  F W    +SG    Q  H +    N+ + P++S++ R               C C +P    TV+K+  NKGRQF++CS     QC FFQW+DE  P G+            +P  FG   + + +S   P          K  RSC +C QPGH    CP  +
Sbjct:  368 FAQRILERGGPTPRNGNKTDQAHPPIHPTKYTNSLQGNEQRIYEFIVRHFLACCSQDAQGQETTVEIDIAA---------------------ERFVAHGLMIIARNYLDVYPYDKWNTKIIPVYEMGARFQPSTVEMVDGETSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLT-PEQRFL-PGELGMGLVEGYDSMGFEMSKPDLRAELESDLKLICEGKKDKFSVLRLQVQKYKQVFVEAAAKATKLDEALSQYFGQAA-----QPVPQEEIYADTPLPVRKCPQCNKDMVLKTKRDGGFFLSCVGYPGCKSSVWFPSFVLEV----SRDESICGTCKPHPVYKLKMKFKRGSVPPLMPLEFVGCIG-----------GCDETLREILDLKYLHGGNRAPQAAPRESNHLQVNQTSNRMGNSGDGRGRQPQAKTLKPPVAKPSASRGVAPT----PSSSESNEV------------VCNCGVAAVQLTVRKEGPNQGRPFYKCNGGACNFFLWADQADSGSPNAQGGHSTGRPSNAFSNPRASDSFRPAGGGSEPGSEGQAVCMCNQPAVTRTVQKDGANKGRQFHTCSKPREQQCGFFQWADENVPPGSG-----------APRGFGKKNKRSESSFSGP--------VAKKQRSCGICHQPGHNRTNCPQNR 975          

HSP 2 Score: 60.8474 bits (146), Expect = 6.665e-9
Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C ++KPN+ V RA+FSEIT
Sbjct:  121 IWTDCDREGENIGFEIIHVCKSVKPNLQVFRARFSEIT 158          
BLAST of DNA topoisomerase vs. Ensembl Xenopus
Match: cryba1 (crystallin beta A1 [Source:Xenbase;Acc:XB-GENE-956128])

HSP 1 Score: 385.571 bits (989), Expect = 1.008e-120
Identity = 246/690 (35.65%), Postives = 341/690 (49.42%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF---------HTSKPSSNFQ-NSLSTIPSNQA-----QPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAW---VESGDVRNQNPHCSSTVMNSANTPQSSNNTR-----------SDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTK----LNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA R+L  G   P NG K+DQAHPPIHP K    L  +E RI+E I RHFLAC S+DA G ET V ID  +                     E F   GL ++ RNYLDVYPYDKW  K +PVY +G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG+LGMGLVEGY  +G  +S+PDLR++ E+DL+LIC G K    VL   +  YK+++     K  KL E +++Y  +A         P   +   T   VR CP C   ++++  +   +FL C  YP CK ++W P  V  V    S++     TC  H  +   +   + S+       F+G I             CD++  E L++++            + S++ Q N  S    N       QP+     PP  K   ++ ++ +    P+SS   E+            VC+CG  A    V KEGPN+ + FY C+   C  F W    +SG    Q  H +    N+ + P++S++ R               C C +P    TV+K+  NKGRQF++CS     QC FFQW+DE  P G  ++     +++  S  +P  FG   + + +S   P          K  RSC +C QPGH    CP  +
Sbjct:  362 FAQRILERGGPTPRNGNKTDQAHPPIHPTKYTNSLQGNEQRIYEFIVRHFLACCSQDAQGQETTVEIDIAA---------------------ERFVAHGLMIIARNYLDVYPYDKWNTKIIPVYEMGARFQPSTVEMVDGETSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLT-PEQRFL-PGELGMGLVEGYDSMGFEMSKPDLRAELESDLKLICEGKKDKFSVLRLQVQKYKQVFVEAAAKATKLDEALSQYFGQAA-----QPVPQEEIYADTPLPVRKCPQCNKDMVLKTKRDGGFFLSCVGYPGCKSSVWFPSFVLEV----SRDESICGTCKPHPVYKLKMKFKRGSVPPLMPLEFVGCIG-----------GCDETLREILDLKYLHGGNRAPQAAPRESNHLQVNQTSNRMGNSGDGRGRQPQAKTLKPPVAKPSASRGVAPT----PSSSESNEV------------VCNCGVAAVQLTVRKEGPNQGRPFYKCNGGACNFFLWADQADSGSPNAQGGHSTGRPSNAFSNPRASDSFRPAGGGSEPGSEGQAVCMCNQPAVTRTVQKDGANKGRQFHTCSKPREQQCGFFQWADENVPPGKEASNPGDWVHVGGS-GAPRGFGKKNKRSESSFSGP--------VAKKQRSCGICHQPGHNRTNCPQNR 983          

HSP 2 Score: 60.8474 bits (146), Expect = 6.682e-9
Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C ++KPN+ V RA+FSEIT
Sbjct:  115 IWTDCDREGENIGFEIIHVCKSVKPNLQVFRARFSEIT 152          
BLAST of DNA topoisomerase vs. Ensembl Xenopus
Match: cryba1 (crystallin beta A1 [Source:Xenbase;Acc:XB-GENE-956128])

HSP 1 Score: 383.645 bits (984), Expect = 7.313e-120
Identity = 244/686 (35.57%), Postives = 335/686 (48.83%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF---------HTSKPSSNFQ-NSLSTIPSNQA-----QPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAW---VESGDVRNQNPHCSSTVMNSANTPQSSNNTR-----------SDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA R+L  G   P NG K+DQAHPPIHP K    L  +E RI+E I RHFLAC S+DA G ET V ID  +                     E F   GL ++ RNYLDVYPYDKW  K +PVY +G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG+LGMGLVEGY  +G  +S+PDLR++ E+DL+LIC G K    VL   +  YK+++     K  KL E +++Y  +A         P   +   T   VR CP C   ++++  +   +FL C  YP CK ++W P  V  V    S++     TC  H  +   +   + S+       F+G I             CD++  E L++++            + S++ Q N  S    N       QP+     PP  K   ++ ++ +    P+SS   E+            VC+CG  A    V KEGPN+ + FY C+   C  F W    +SG    Q  H +    N+ + P++S++ R               C C +P    TV+K+  NKGRQF++CS     QC FFQW+DE  P G  ++             FG   + + +S   P          K  RSC +C QPGH    CP  +
Sbjct:  387 FAQRILERGGPTPRNGNKTDQAHPPIHPTKYTNSLQGNEQRIYEFIVRHFLACCSQDAQGQETTVEIDIAA---------------------ERFVAHGLMIIARNYLDVYPYDKWNTKIIPVYEMGARFQPSTVEMVDGETSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLT-PEQRFL-PGELGMGLVEGYDSMGFEMSKPDLRAELESDLKLICEGKKDKFSVLRLQVQKYKQVFVEAAAKATKLDEALSQYFGQAA-----QPVPQEEIYADTPLPVRKCPQCNKDMVLKTKRDGGFFLSCVGYPGCKSSVWFPSFVLEV----SRDESICGTCKPHPVYKLKMKFKRGSVPPLMPLEFVGCIG-----------GCDETLREILDLKYLHGGNRAPQAAPRESNHLQVNQTSNRMGNSGDGRGRQPQAKTLKPPVAKPSASRGVAPT----PSSSESNEV------------VCNCGVAAVQLTVRKEGPNQGRPFYKCNGGACNFFLWADQADSGSPNAQGGHSTGRPSNAFSNPRASDSFRPAGGGSEPGSEGQAVCMCNQPAVTRTVQKDGANKGRQFHTCSKPREQQCGFFQWADENVPPGKEASNPG----------FGKKNKRSESSFSGP--------VAKKQRSCGICHQPGHNRTNCPQNR 995          

HSP 2 Score: 60.8474 bits (146), Expect = 6.708e-9
Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C ++KPN+ V RA+FSEIT
Sbjct:  140 IWTDCDREGENIGFEIIHVCKSVKPNLQVFRARFSEIT 177          
BLAST of DNA topoisomerase vs. Ensembl Mouse
Match: Top3a (topoisomerase (DNA) III alpha [Source:MGI Symbol;Acc:MGI:1197527])

HSP 1 Score: 383.259 bits (983), Expect = 8.670e-120
Identity = 246/688 (35.76%), Postives = 332/688 (48.26%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF-----HTSKPSSNFQ-----NSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVN------------------CNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIAL--TSNVWPPPAHINKGKP-KSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K   GL  D+ R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T       +PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K   +VL   +  YK+++     K  KL E +++YL     G+  + A    + P   E VR CP C   ++++  K   ++L C  +P C+ A+W PD+V    L  S++      C     +   L   + S+       F+G I             CD++  E   +RF       S+PS + Q     N + +   N +QP V + T P K       ++Q+    PT++              ++  C+CG+ A    V K+GPN+ + FY CS+  C  F W +S            T  +++  P SS    S V                   C CG+P    TV+K+  NKGRQF++C+     QC FFQW DE    G          SF +P   G   +      ++  P     + G   K  R C LC QPGHT   CP  +
Sbjct:  392 FAQTILERGGPTPRNGSKSDQAHPPIHPTKYTSGLQGDDRRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLIILARNYLDVYPYDHWSDKLLPVYEQGSHFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTSD--KRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKKDKFQVLRQQVQKYKQVFIEAVAKAKKLDEALSQYL-----GERTEMAQQEEIYPAMPEPVRKCPQCNKDMVLKTKKSGGFYLSCMGFPECRSAVWFPDSV----LEASRDNSVCSVCQPPPVYRLKLKFKRGSLPPAMPLEFVGCIG-----------GCDETLKEIFGLRFPRALPRASQPSGHLQASQALNRMDSSQHNLSQPLVNRHTRPSKT------VAQALLP-PTTA-----------GESNSVTCNCGREAVLLTVRKQGPNQGRHFYKCSNGDCNFFLWADSSHSTG-----GGTPTSASGPPGSSVGCPSSVGSHMDGFGSLGSDSDGGTPCLCGQPAVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENVAPG----------SFAAPAWPGGRGKAQRPEAASKRPRAGSSDAGSTVKKPRKCSLCHQPGHTRTFCPQNR 1003          

HSP 2 Score: 62.003 bits (149), Expect = 2.058e-9
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  145 IWTDCDREGENIGFEIIHVCKAVKPNLRVLRARFSEIT 182          
BLAST of DNA topoisomerase vs. Ensembl Mouse
Match: Top3a (topoisomerase (DNA) III alpha [Source:MGI Symbol;Acc:MGI:1197527])

HSP 1 Score: 373.244 bits (957), Expect = 2.159e-116
Identity = 229/623 (36.76%), Postives = 310/623 (49.76%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF-----HTSKPSSNFQ-----NSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVN------------------CNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNAS 1889
            FA  +L  G   P NG KSDQAHPPIHP K   GL  D+ R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T       +PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K   +VL   +  YK+++     K  KL E +++YL     G+  + A    + P   E VR CP C   ++++  K   ++L C  +P C+ A+W PD+V    L  S++      C     +   L   + S+       F+G I             CD++  E   +RF       S+PS + Q     N + +   N +QP V + T P K       ++Q+    PT++              ++  C+CG+ A    V K+GPN+ + FY CS+  C  F W +S            T  +++  P SS    S V                   C CG+P    TV+K+  NKGRQF++C+     QC FFQW DE    G A+
Sbjct:  392 FAQTILERGGPTPRNGSKSDQAHPPIHPTKYTSGLQGDDRRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLIILARNYLDVYPYDHWSDKLLPVYEQGSHFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTSD--KRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKKDKFQVLRQQVQKYKQVFIEAVAKAKKLDEALSQYL-----GERTEMAQQEEIYPAMPEPVRKCPQCNKDMVLKTKKSGGFYLSCMGFPECRSAVWFPDSV----LEASRDNSVCSVCQPPPVYRLKLKFKRGSLPPAMPLEFVGCIG-----------GCDETLKEIFGLRFPRALPRASQPSGHLQASQALNRMDSSQHNLSQPLVNRHTRPSKT------VAQALLP-PTTA-----------GESNSVTCNCGREAVLLTVRKQGPNQGRHFYKCSNGDCNFFLWADSSHSTG-----GGTPTSASGPPGSSVGCPSSVGSHMDGFGSLGSDSDGGTPCLCGQPAVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENVAPGEAA 948          

HSP 2 Score: 62.003 bits (149), Expect = 2.024e-9
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  145 IWTDCDREGENIGFEIIHVCKAVKPNLRVLRARFSEIT 182          
BLAST of DNA topoisomerase vs. Ensembl Mouse
Match: Top3a (topoisomerase (DNA) III alpha [Source:MGI Symbol;Acc:MGI:1197527])

HSP 1 Score: 303.138 bits (775), Expect = 1.279e-91
Identity = 168/411 (40.88%), Postives = 221/411 (53.77%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFHTSKPSS 1352
            FA  +L  G   P NG KSDQAHPPIHP K   GL  D+ R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T       +PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K   +VL   +  YK+++     K  KL E +++YL     G+  + A    + P   E VR CP C   ++++  K   ++L C  +P C+ A+W PD+V    L  S++      C     +   L   + S+       F+G I             CD++  E   +RF  + P +
Sbjct:  367 FAQTILERGGPTPRNGSKSDQAHPPIHPTKYTSGLQGDDRRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLIILARNYLDVYPYDHWSDKLLPVYEQGSHFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTSD--KRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKKDKFQVLRQQVQKYKQVFIEAVAKAKKLDEALSQYL-----GERTEMAQQEEIYPAMPEPVRKCPQCNKDMVLKTKKSGGFYLSCMGFPECRSAVWFPDSV----LEASRDNSVCSVCQPPPVYRLKLKFKRGSLPPAMPLEFVGCIG-----------GCDETLKEIFGLRFPRALPRA 734          

HSP 2 Score: 62.003 bits (149), Expect = 1.860e-9
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  120 IWTDCDREGENIGFEIIHVCKAVKPNLRVLRARFSEIT 157          
BLAST of DNA topoisomerase vs. Ensembl Mouse
Match: Top3a (topoisomerase (DNA) III alpha [Source:MGI Symbol;Acc:MGI:1197527])

HSP 1 Score: 284.648 bits (727), Expect = 1.111e-85
Identity = 149/323 (46.13%), Postives = 189/323 (58.51%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACK 1088
            FA  +L  G   P NG KSDQAHPPIHP K   GL  D+ R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T       +PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K   +VL   +  YK+++     K  KL E +++YL     G+  + A    + P   E VR CP C   ++++  K   ++L C  +P C+
Sbjct:  367 FAQTILERGGPTPRNGSKSDQAHPPIHPTKYTSGLQGDDRRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLIILARNYLDVYPYDHWSDKLLPVYEQGSHFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTSD--KRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKKDKFQVLRQQVQKYKQVFIEAVAKAKKLDEALSQYL-----GERTEMAQQEEIYPAMPEPVRKCPQCNKDMVLKTKKSGGFYLSCMGFPECR 661          

HSP 2 Score: 60.077 bits (144), Expect = 7.332e-9
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  120 IWTDCDREGENIGFEIIHVCKAVKPNLRVLRARFSEIT 157          
BLAST of DNA topoisomerase vs. Ensembl Mouse
Match: Top3b (topoisomerase (DNA) III beta [Source:MGI Symbol;Acc:MGI:1333803])

HSP 1 Score: 116.316 bits (290), Expect = 7.207e-27
Identity = 86/250 (34.40%), Postives = 124/250 (49.60%), Query Frame = 3
Query:  132 RLLSEGIH-PHNGKKSDQAHPPIHPLKQGIG--LNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIG-EGFSLTGLSVLERNYLDVYPYDKW-VDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIY 866
            +LL+EGI+ P  G  +   HPPI P+K      L  D  R++E ITRHF+A +S     H+ K L   IS                   IG E F+  G +V+   + ++ P+    +++ +P    G+ F    V + + +TS P  LTEA+L+ LM+KHGIGTDA+   HI  +  R+YV  T      L P  LG+ LV GY  +   L  P +RS  E  L LI  G     +VL H L+ +K  +
Sbjct:  164 QLLAEGINRPRKGHDAGD-HPPITPMKSATEAELGGDAWRLYEYITRHFIATVS-----HDCKYLQSTIS-----------------FRIGPEHFTCMGKTVISPGFTEIMPWQSVPLEESLPTCQKGDTFTVGEVKMLEKQTSPPDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYV--TVESGRRLKPTNLGIVLVHGYYKIDAELVLPTIRSAVEKQLNLIAQGKADYHQVLGHTLDIFKRKF 388          
BLAST of DNA topoisomerase vs. UniProt/SwissProt
Match: sp|O70157|TOP3A_MOUSE (DNA topoisomerase 3-alpha OS=Mus musculus OX=10090 GN=Top3a PE=2 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 6.065e-119
Identity = 246/688 (35.76%), Postives = 332/688 (48.26%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF-----HTSKPSSNFQ-----NSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVN------------------CNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIAL--TSNVWPPPAHINKGKP-KSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K   GL  D+ R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T       +PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K   +VL   +  YK+++     K  KL E +++YL     G+  + A    + P   E VR CP C   ++++  K   ++L C  +P C+ A+W PD+V    L  S++      C     +   L   + S+       F+G I             CD++  E   +RF       S+PS + Q     N + +   N +QP V + T P K       ++Q+    PT++              ++  C+CG+ A    V K+GPN+ + FY CS+  C  F W +S            T  +++  P SS    S V                   C CG+P    TV+K+  NKGRQF++C+     QC FFQW DE    G          SF +P   G   +      ++  P     + G   K  R C LC QPGHT   CP  +
Sbjct:  392 FAQTILERGGPTPRNGSKSDQAHPPIHPTKYTSGLQGDDRRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLIILARNYLDVYPYDHWSDKLLPVYEQGSHFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTSD--KRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKKDKFQVLRQQVQKYKQVFIEAVAKAKKLDEALSQYL-----GERTEMAQQEEIYPAMPEPVRKCPQCNKDMVLKTKKSGGFYLSCMGFPECRSAVWFPDSV----LEASRDNSVCSVCQPPPVYRLKLKFKRGSLPPAMPLEFVGCIG-----------GCDETLKEIFGLRFPRALPRASQPSGHLQASQALNRMDSSQHNLSQPLVNRHTRPSKT------VAQALLP-PTTA-----------GESNSVTCNCGREAVLLTVRKQGPNQGRHFYKCSNGDCNFFLWADSSHSTG-----GGTPTSASGPPGSSVGCPSSVGSHMDGFGSLGSDSDGGTPCLCGQPAVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENVAPG----------SFAAPAWPGGRGKAQRPEAASKRPRAGSSDAGSTVKKPRKCSLCHQPGHTRTFCPQNR 1003          

HSP 2 Score: 62.003 bits (149), Expect = 1.440e-8
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  145 IWTDCDREGENIGFEIIHVCKAVKPNLRVLRARFSEIT 182          
BLAST of DNA topoisomerase vs. UniProt/SwissProt
Match: sp|Q13472|TOP3A_HUMAN (DNA topoisomerase 3-alpha OS=Homo sapiens OX=9606 GN=TOP3A PE=1 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.784e-117
Identity = 246/679 (36.23%), Postives = 333/679 (49.04%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACL-YCDKSFCEALNIRF-----HTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSS--TVMNSANTPQS-----------SNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDE---PNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K    L  DE R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC+G K    VL   +  YK+++     K  KL E +A+Y      G+  + A    + P   E +R CP C   ++++  K   ++L C  +P C+ A+WLPD+V    L  S+++     C  H  +   L   + S+       F+             C+  CD +  E L++RF       S+PS   Q       +NQ+  ++  S  P       QP + S     + +  Q L         ++  C+CGQ A    V KEGPN+ + F+ C+   C  F W +S +     P   +   +  S   P              + + S  +C C +P    TV+K+  NKGRQF++C+     QC FFQW DE   P   G  S   +  R+ +S  E    +  A +S++            K  R C LC QPGHT   CP  +
Sbjct:  392 FAQSILERGGPTPRNGNKSDQAHPPIHPTKYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLMILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLT-PDKRFL-PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKKDKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYF-----GNGTELAQQEDIYPAMPEPIRKCPQCNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSV----LEASRDSSVCPVCQPHPVYRLKLKFKRGSLPPTMPLEFV------------CCIGGCDDTLREILDLRFSGGPPRASQPSGRLQ-------ANQSLNRMDNSQHP-------QP-ADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNGGSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLES--EARSKRPRASSSDM--------GSTAKKPRKCSLCHQPGHTRPFCPQNR 1001          

HSP 2 Score: 62.3882 bits (150), Expect = 1.266e-8
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  145 IWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSEIT 182          
BLAST of DNA topoisomerase vs. UniProt/SwissProt
Match: sp|Q9NG98|TOP3A_DROME (DNA topoisomerase 3-alpha OS=Drosophila melanogaster OX=7227 GN=Top3alpha PE=2 SV=2)

HSP 1 Score: 302.368 bits (773), Expect = 1.415e-87
Identity = 165/411 (40.15%), Postives = 226/411 (54.99%), Query Frame = 3
Query:  123 FATRLLSEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDE--NDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNV--WFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFHTSK 1343
            FA R++  G +P NG KSDQAHPPIHP K    L  +EAR++EL+ RHFLAC+SKDA+G ET V ID                       GE F+  GL + ERNYLDVY YDKW  K++  Y  G+ FEPT VS+ +  T+AP LLTEADL+ LM+KHGIGTDATHAEHI  +K R Y+G    G  FL+PG +GMGL EGY  +   L++P LR++FE DL+LIC G K P  VL   +  YK+ Y+    KI  +   ++  ++E P  +    + A  ++ +    +++  CP C    L  K KKN   W++GC N+P CK+A+WLP   +   +      E   TC + +            +K + +  +   +F      +  CL CD  F    NI   + K
Sbjct:  386 FAQRVIEWGPNPRNGNKSDQAHPPIHPTKLAENLQGNEARVYELVVRHFLACVSKDAVGSETLVHIDIA---------------------GEKFTANGLVIHERNYLDVYVYDKWSAKQIHHYENGQRFEPTEVSLHEGATTAPPLLTEADLIALMEKHGIGTDATHAEHINTIKERGYIGVLDKG--FLVPGVIGMGLYEGYDAMELALAKPQLRAEFELDLKLICQGQKDPKVVLTEQIAKYKQAYQQITDKITAMDAKISARINETPAANSAVQEGADGSAPSHGIIQSIFQCPKCNEAPLALKPKKNQQGWYIGCNNFPDCKNAVWLPTECKDASVLD----ECCPTCGDGYRM----------LKFRLSTPYYRGVFGTPSGWYKTCLPCDNLFRTTFNINLDSVK 759          

HSP 2 Score: 78.1814 bits (191), Expect = 1.694e-13
Identity = 63/228 (27.63%), Postives = 84/228 (36.84%), Query Frame = 3
Query: 1548 CGQIAATRKVSKEGPNKNKFFYTCSS-SKCQMFAWVES---------------------------------------GDVRNQNPHCSSTVMNSANTPQSSNNTRS-----DVNCNCGKPVNLLTVRKENQNKGRQFYSC----SQCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPP----PAHINKGKPKSVRSCLLCRQPGHTSRKCPSK 2072
            C Q A    V K GPN  + +Y C    +C  F W +                                        G    ++   S+  +    T Q   NT +     +V CNCG+  + LTVRK+  N+GR FY+C      C FF+W DE    G +ST                      ++N  PP    P  I    PK+ R C LCR+ GHT  KCP K
Sbjct: 1038 CQQPARQNTVRKNGPNLGRLYYKCPKPDECNFFQWADEPPSSAKSKNSTGSAPQSTTSWGSNRVVTLPSIQQSNSQRGQSSMRSNSSSTVTITQTKTKQQERNTATPGDGEEVMCNCGQLASQLTVRKDGPNQGRPFYACPTREKSCGFFKWGDEDQNQGASSTSWG-------------------SANRNPPGRSQPTAITSDGPKT-RRCGLCRKEGHTRNKCPRK 1245          

HSP 3 Score: 65.855 bits (159), Expect = 1.144e-9
Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+D C AIKPNI+V RA FSEIT
Sbjct:  137 IWTDCDREGENIGYEIIDVCRAIKPNISVYRATFSEIT 174          
BLAST of DNA topoisomerase vs. UniProt/SwissProt
Match: sp|O61660|TOP3_CAEEL (DNA topoisomerase 3 OS=Caenorhabditis elegans OX=6239 GN=top-3 PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 8.398e-63
Identity = 117/270 (43.33%), Postives = 164/270 (60.74%), Query Frame = 3
Query:  123 FATRLLSEGIHPHNGKKSDQAHPPIHPLK--QGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDE 926
            FA  +L  G++P NG+KSD+AHPPIHPLK  +   L  D+ +++EL+ RHFLAC+S+DA G ET V +   +                     E F  +GL + +  YL VY Y+KW ++ +P Y  GE F    + I   +T AP  LTEADL+ LMDK+GIGTDATHAEHIEK+K R+Y+G    G   LIP  LG+ LV+GY  +G  +S+PDLR+  E  L+ IC+G +Q  EVL+  +  Y+ I+  +  KI  L + + +YLD+
Sbjct:  364 FANEVLQNGVNPRNGRKSDEAHPPIHPLKFTEKHQLQGDDWKVYELVVRHFLACVSQDAQGEETMVNLTVGT---------------------EKFHASGLRIRDMGYLKVYVYEKWGNRLLPTYTEGERFTDFELKIGDGKTQAPDFLTEADLISLMDKYGIGTDATHAEHIEKIKTREYIGVRPDGK--LIPSFLGLALVDGYDDMGFAMSKPDLRANLEIGLKEICDGRRQKQEVLDEQIGKYRAIFVESERKIGVLSQSLQRYLDK 610          
BLAST of DNA topoisomerase vs. UniProt/SwissProt
Match: sp|Q9LVP1|TOP3A_ARATH (DNA topoisomerase 3-alpha OS=Arabidopsis thaliana OX=3702 GN=TOP3A PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 7.277e-57
Identity = 166/525 (31.62%), Postives = 244/525 (46.48%), Query Frame = 3
Query:  123 FATRLLS-EG---IHPHNGKKSDQAHPPIHPLKQGIG---LNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLC-EGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACL-YCDKSFCEALNIRFHTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPT---SSFRQELENLQDTSVKSTPVCH-CGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVES 1658
            +A RLL  EG    +P NG   D+AHPPIHP K   G    + D   ++EL+ RH+LAC+S+ A+  ET V ID                       GE FS +G ++L +NYL+VY ++ W    +PVY  G+ F PT++++  + T  P LL EADLL  MDK GIGTDAT  +HI+K+  R Y   T        P  LG  LV GY  +G  L +P+LR+  E D+  +  G K   EVL   L   K  + +   K +KL E +  + + +   DE++       +    E VR C LC E  + +RK++   + +GC NYP C++A+WLP       L  S  T    +C           V KI  K +      GF     D     C+  CD    + ++I    S+  S  + +  T PSN  Q    + +      I  Q    +S + P+   +S           + +ST  C+ CG     R  + E  N+ + F++C +  C  FAW +S
Sbjct:  372 YAQRLLEPEGGLWRNPANGGHDDKAHPPIHPTKFSSGESNWSRDHLNVYELVVRHYLACVSQPAVAAETTVEIDIA---------------------GERFSASGRAILAKNYLEVYRFESWGGSVIPVYEKGQQFIPTTLTLDAAVTRPPPLLCEADLLSCMDKAGIGTDATMHDHIKKLLDRGYA--TKDANTRFSPTNLGEALVMGYDDMGYELWKPNLRALMEHDMNEVSVGRKTKAEVLETCLQQMKACFLDARVKKSKLLEAMTIFFERSNNTDESE-------SQTAGEVVRRCNLCNESDMALRKNRDGNFMVGCMNYPQCRNAVWLPGPT----LEASVTTNVCQSCGPG-------PVYKILFKFRQIGIPPGF-----DVNHLGCVGGCDDILKQLIDICGTGSR--SQARRTPGTAPSNNIQGSNTRQS---NVCIHCQQRGHASTNCPSRVPASRNSRPTATNPRNDESTVSCNTCGSQCVLRTANTEA-NRGRQFFSCPTQGCSFFAWEDS 844          

HSP 2 Score: 58.9214 bits (141), Expect = 1.364e-7
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKAV 139
            LWL CDREGENI  E+VD C A+K N+ ++RA FS +  +  H+AV
Sbjct:  120 LWLDCDREGENIAFEVVDVCRAVKHNLFIRRAHFSALIDRDIHEAV 165          
BLAST of DNA topoisomerase vs. TrEMBL
Match: A0A5N3WYH4 (Uncharacterized protein OS=Muntiacus muntjak OX=9888 GN=FD754_011056 PE=4 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 1.312e-121
Identity = 245/665 (36.84%), Postives = 325/665 (48.87%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFHTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMN----SANTPQSS----NNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K    L  DE R++ELI RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD+W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K  L VL+  +  YK+++     K  KL E +++Y      G   + AP  +L P   + +R CP C   ++++  K   ++L CT +P C+ A+W PD+V    L  S++      C  H  +       + S+       F+G I             CD++  E L +RF    P           P++Q    +  S    + +   Q   +     P+ +  + L      S  ++  C+CGQ A    V KEGPN+ + FY CS   C  F W +SG      P  +S  +     S   P  S    N      +C CG+P    TV+K+  N+GRQF++C+     QC FFQW DE    G     L        P   G  + +   S      +       K  R C LC QPGHT   CP  +
Sbjct:  410 FARNILERGGPTPRNGNKSDQAHPPIHPTKYTDSLQGDEQRLYELIVRHFLACCSQDAQGQETTVEIDIAH---------------------ERFVAQGLMILARNYLDVYPYDRWSDKTLPVYEQGTCFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLT-PDKRFL-PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKKDKLVVLHQQVQKYKQVFIEAVAKARKLDEALSQYF-----GAAAEVAPQEAL-PAVPQPIRKCPQCGQDMVLKTRKSGGFYLSCTGFPECRSAVWFPDSV----LEASRDDSVCPVCQPHPVYRLKFKFKRGSLPPTMPLEFVGCIG-----------GCDETLREILALRFSRGAPQVG-------QPASQTSGHLQASQSLNRMDSGQQGQPRPPVTKPSKALTRTLPPPAIESEGNSVTCNCGQEALLLTVRKEGPNQGRQFYKCSGGGCSFFLWADSGHPGAGPPSSASRPLGRPPASGTLPGGSSRPGNGGSGGASCLCGQPAVTRTVQKDGPNQGRQFHTCAQPREQQCGFFQWVDENMAPGTFGGTL-------WPGSRGGTQGLEARSKRARAGSSDMGSAAKKPRKCSLCHQPGHTRPFCPQNR 1016          
BLAST of DNA topoisomerase vs. TrEMBL
Match: A0A4X2KWD5 (DNA topoisomerase OS=Vombatus ursinus OX=29139 GN=TOP3A PE=3 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 1.568e-121
Identity = 250/681 (36.71%), Postives = 337/681 (49.49%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDE--APVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFH---------TSKPSSNFQ--NSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVM-----NSANTPQSSN------NTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA R+L  G   P NGKKSDQAHPPIHP K    L  +E R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVY YDKW DK +P+Y  G  F+PT++ +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K    VL   +  YK+++       NKL E +++Y  E  A VG E        + P    T++ CP C   ++++K K   ++L C  YP C+ A+W PD+V    L  SK+      C  H  +   L   + S+       F+G I             CD++  + L++R             +P+++ Q   SL+ + +NQ    +  +      E +  P++ S+     S+   E  N        T +C+CGQ A    V KEGPN+ + FY C++  C  F W +S           +  +     NS N     +      ++ S   C C +P    TV+KE  NKGRQF++CS     QC FFQW+DE N +   S  +      Q       +KR    S+  P          K +R C LC QPGHT   CP  +
Sbjct:  375 FAQRILDRGGPTPRNGKKSDQAHPPIHPTKYTCNLQGNEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLMILARNYLDVYIYDKWSDKVIPIYEKGSCFQPTTIEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKSRMYVGLT-PDKRFL-PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKKDKHVVLRQQIQKYKQVFIEAVAHANKLDEALSQYFGEMAAAVGQEE-------IYPAMPATIKKCPQCNKDMVLKKKKNGGFYLSCMGYPDCRKAIWFPDSV----LEASKDDSVCPVCKPHPVYRLKLKFKRGSVPPTMPLEFVGCIG-----------GCDETLMQILDLRSSNGPSRASQPAGRPTNHLQANQSLNRMGNNQGSYSISST------ERQTGPLNPSAGILVPSAATSESHN--------TVMCNCGQEALLLTVRKEGPNQGRHFYKCNTGSCNFFLWADSQQGTEMASFSRTRTLSHFQGNSTNFGGRQDGFGNHGSSSSSATCMCNQPAIKRTVQKEGPNKGRQFHTCSKPREQQCGFFQWADE-NVVPGTSGPVWFGGRGQGQGSEAKSKRPRTNSDTEP--------TTKKIRKCGLCHQPGHTRTTCPQNR 987          

HSP 2 Score: 62.003 bits (149), Expect = 5.167e-6
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  128 IWTDCDREGENIGFEIIHVCKAVKPNLRVFRARFSEIT 165          
BLAST of DNA topoisomerase vs. TrEMBL
Match: K9J3S6 (DNA topoisomerase (Fragment) OS=Desmodus rotundus OX=9430 PE=2 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 1.793e-121
Identity = 252/678 (37.17%), Postives = 326/678 (48.08%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFH---------TSKPSSNFQ-----NSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTV--MNSANTPQ---SSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTS-NVWPPPAHINKGK-PKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K    L  DE R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD+W DK +PVY  G  F+P+++ +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K    VL   +  YK+++     K  KL E +++Y      G+  + A   ++ P   E VR CP C   ++++  K   ++L CT +P C+  +W PD+V    L  S++      C  H  +       + S+       FIG I             CD++  E L +RF           S+PS   Q     N + +   +  QP   + T P K    N P        PT++        +  SV    VC+CGQ A    V KEGPN+ + FY C    C  F W  S       P  S+      S N P    S  +     +C C +     TV+K+  NKGRQF++C+     QC FFQW DE    G              P   G  K   L S +  P P+  + G   K  R C LC QPGHT   CP  +
Sbjct:  230 FAQSILERGGPTPRNGNKSDQAHPPIHPTKYTSSLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLMILARNYLDVYPYDRWSDKTLPVYERGSRFQPSTMQMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLT-PDKRFL-PGHLGMGLVEGYDAMGYEMSKPDLRAELEADLKLICEGKKDKCVVLRQQVQKYKQVFIEAVAKAKKLDEALSQYF-----GEGAEVAQQEAIYPAMLEPVRKCPQCNKDMVLKTKKSGGFYLSCTGFPECRSVMWFPDSV----LEASRDASVCPVCQPHPVYRLKFKFKRGSLPPTMPLEFIGCIG-----------GCDETLKEILGLRFSQGTPRAVPTASQPSGYLQAGRSSNRMDSSQHSHPQPPGTRQTRPLKALAPNLPP-------PTAAG-------ESNSV----VCNCGQEALLLTVRKEGPNQGRQFYKCQGGSCSFFLWANSSHPEAGGPPSSAIRHPTGSGNRPHGFGSPGDDSGGTSCLCSQATVTWTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENAAPGTLGA---------PPWPGGRGKTHGLESRSKRPRPSSSDPGSMAKKPRKCSLCHQPGHTRPFCPQNR 837          
BLAST of DNA topoisomerase vs. TrEMBL
Match: A0A4W2HP29 (DNA topoisomerase OS=Bos indicus x Bos taurus OX=30522 GN=TOP3A PE=3 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 2.532e-121
Identity = 250/685 (36.50%), Postives = 331/685 (48.32%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF-----HTSKPSSNFQNSLSTIPS-------NQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRN--------------QNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKL--NMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L  G   P NG KSDQAHPPIHP K    L  DE R++ELI RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVYPYD+W DK +PVY  G  F+P++V +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K  L VL+  +  YK+++     K  KL E +++Y      G   + AP ++L P   E +R CP C   ++++  K   ++LGCT +P C+ A+W PD+V    L  S++      C  H  +       + S+       F+G I             CD++  E L +RF       S+P+S     L    S        Q QP+     PP  +              P+ +  + L      S  ++  C+CGQ A    V KEGPN+ + FY C S  C  F W +SG                  ++P  S T++  ++     +      +C CG+P    TV+KE  N+GRQF++C+     QC FFQW DE    G     L    +R  Q         R   +               K  R C LC QPGHT   CP  +
Sbjct:  297 FARNILERGGPTPRNGNKSDQAHPPIHPTKYTDSLQGDEQRLYELIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLMILARNYLDVYPYDRWSDKTLPVYEQGTCFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLT-PDKRFL-PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKKDKLVVLHQQVQKYKQVFIEAVAKARKLDEALSQYF-----GAATEVAPQDAL-PAVPEPIRKCPQCSRDMVLKTRKSGGFYLGCTGFPECRSAVWFPDSV----LEASRDVSVCPVCQPHPVYRLKFKFKRGSLPPTMPLEFVGCIG-----------GCDETLREILALRFSQGAARVSQPASQTSGYLQASQSLNRMDSGQQGQPR-----PPVTR--------------PSKALTRTLPPPAVESESNSVTCNCGQEALLLTVRKEGPNQGRQFYKCGSGGCSFFLWADSGHPGAGPPSSASRPPGGPLEHPPGSGTLLGGSSR--PGSGGSGGASCLCGQPAVTRTVQKEGPNQGRQFHTCAQPREHQCGFFQWVDENVAPGTFGGPLWPGSRRGTQGLEARSKRPRAGSSD---------TGSAAKKPRKCSLCHQPGHTRPFCPQNR 907          
BLAST of DNA topoisomerase vs. TrEMBL
Match: A0A4X2KWG1 (DNA topoisomerase OS=Vombatus ursinus OX=29139 GN=TOP3A PE=3 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 2.672e-121
Identity = 250/681 (36.71%), Postives = 337/681 (49.49%), Query Frame = 3
Query:  123 FATRLLSEG-IHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDE--APVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFH---------TSKPSSNFQ--NSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVM-----NSANTPQSSN------NTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA R+L  G   P NGKKSDQAHPPIHP K    L  +E R++E I RHFLAC S+DA G ET V ID                        E F   GL +L RNYLDVY YDKW DK +P+Y  G  F+PT++ +   ETS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T P   FL PG LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K    VL   +  YK+++       NKL E +++Y  E  A VG E        + P    T++ CP C   ++++K K   ++L C  YP C+ A+W PD+V    L  SK+      C  H  +   L   + S+       F+G I             CD++  + L++R             +P+++ Q   SL+ + +NQ    +  +      E +  P++ S+     S+   E  N        T +C+CGQ A    V KEGPN+ + FY C++  C  F W +S           +  +     NS N     +      ++ S   C C +P    TV+KE  NKGRQF++CS     QC FFQW+DE N +   S  +      Q       +KR    S+  P          K +R C LC QPGHT   CP  +
Sbjct:  370 FAQRILDRGGPTPRNGKKSDQAHPPIHPTKYTCNLQGNEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQ---------------------ERFVAHGLMILARNYLDVYIYDKWSDKVIPIYEKGSCFQPTTIEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKSRMYVGLT-PDKRFL-PGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKKDKHVVLRQQIQKYKQVFIEAVAHANKLDEALSQYFGEMAAAVGQEE-------IYPAMPATIKKCPQCNKDMVLKKKKNGGFYLSCMGYPDCRKAIWFPDSV----LEASKDDSVCPVCKPHPVYRLKLKFKRGSVPPTMPLEFVGCIG-----------GCDETLMQILDLRSSNGPSRASQPAGRPTNHLQANQSLNRMGNNQGSYSISST------ERQTGPLNPSAGILVPSAATSESHN--------TVMCNCGQEALLLTVRKEGPNQGRHFYKCNTGSCNFFLWADSQQGTEMASFSRTRTLSHFQGNSTNFGGRQDGFGNHGSSSSSATCMCNQPAIKRTVQKEGPNKGRQFHTCSKPREQQCGFFQWADE-NVVPGTSGPVWFGGRGQGQGSEAKSKRPRTNSDTEP--------TTKKIRKCGLCHQPGHTRTTCPQNR 982          

HSP 2 Score: 62.003 bits (149), Expect = 5.158e-6
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG EI+  C A+KPN+ V RA+FSEIT
Sbjct:  148 IWTDCDREGENIGFEIIHVCKAVKPNLRVFRARFSEIT 185          
BLAST of DNA topoisomerase vs. Ensembl Cavefish
Match: top3a (DNA topoisomerase III alpha [Source:ZFIN;Acc:ZDB-GENE-071212-2])

HSP 1 Score: 380.178 bits (975), Expect = 1.115e-118
Identity = 244/689 (35.41%), Postives = 341/689 (49.49%), Query Frame = 3
Query:  123 FATRLL-SEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVW-FLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF---HTSKPSS--NFQNSLSTIPSNQAQP---KVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVES-----GDVRNQNP-----HCSSTVMNSANTPQ-------SSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDN------KRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L S G  P NG KSDQAHPPIHP K    L  +E R++E I RHFLAC SKDA G E  V ID                        E FS +GL+++ RNYLDVYPY+KW +K +P+Y     F+P+++ + + +TS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T       +PG+LGMGLVEGY+ +G  +S+PDLR++ EADL+L+  G K    VL H++  YK ++  +  K  KL E ++ YL     G   +              VR CP C   +++RK K +   FL C  YPACK A+W PDTV  V    S++     TC  H  H       + S+    +  F+G I             CD++  E LN+++    + +P++  N   +L +   N+  P     + S PP     +++P+   S D             Q  +V    VC+CG  A    V KEGPN+ + FY C++  C+ F W +      G   ++ P       S   +   N PQ       ++ +T  +  CNC +P    TV K+  NKGR F++C      QC FFQW+DE  P            + +S    GDN      K+  ++S+  P          K  R+C +C QPGHT   CP  +
Sbjct:  391 FAQGILESGGPTPRNGNKSDQAHPPIHPTKYTNSLQGNEKRLYEFIVRHFLACCSKDAQGQEVIVDIDIAE---------------------EKFSASGLTIIARNYLDVYPYEKWFNKVIPLYTANTTFQPSAIEMVEGQTSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKSRMYVGLTAD--QRFLPGELGMGLVEGYNSMGYEMSKPDLRAELEADLKLVSEGRKDKASVLRHHVAKYKAVFIESAKKAKKLDEALSNYL-----GQAQEYTEQEEQELEMPLPVRKCPQCNRDMVLRKRKDSTGKFLSCLGYPACKAAVWFPDTVLEV----SRDDSVCPTCRPHPVHMLKFKFKRGSLPPGMDLEFVGCIG-----------GCDETLREVLNLKYLRGASRQPNAPRNNNTALQSRSENRPPPPRLSAVSSRPPLTNPAQSRPMQLPSSD-------------QSNAV----VCNCGVDALLLTVRKEGPNQGRQFYKCNTGNCKFFLWADESAEQHGSAGSRGPAGQSFQPSRPSVGFGNGPQERHGSRGAAGDTGGEAMCNCNEPAVQRTVMKDGPNKGRAFHTCGKPRDQQCGFFQWADENVPPA----------AVRSTTGGGDNSTWNGSKKTGVSSSKAP--------AAKRPRTCGICHQPGHTRTTCPQGR 1001          

HSP 2 Score: 60.077 bits (144), Expect = 7.987e-9
Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG E+++ C A+K NI V RA+FSEIT
Sbjct:  143 IWTDCDREGENIGFEVINVCKAVKANIQVFRARFSEIT 180          
BLAST of DNA topoisomerase vs. Ensembl Cavefish
Match: top3a (DNA topoisomerase III alpha [Source:ZFIN;Acc:ZDB-GENE-071212-2])

HSP 1 Score: 374.015 bits (959), Expect = 4.258e-117
Identity = 244/704 (34.66%), Postives = 341/704 (48.44%), Query Frame = 3
Query:  123 FATRLL-SEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVW-FLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF------------------HTSKPSS--NFQNSLSTIPSNQAQP---KVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVES-----GDVRNQNP-----HCSSTVMNSANTPQ-------SSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDN------KRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA  +L S G  P NG KSDQAHPPIHP K    L  +E R++E I RHFLAC SKDA G E  V ID                        E FS +GL+++ RNYLDVYPY+KW +K +P+Y     F+P+++ + + +TS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T       +PG+LGMGLVEGY+ +G  +S+PDLR++ EADL+L+  G K    VL H++  YK ++  +  K  KL E ++ YL     G   +              VR CP C   +++RK K +   FL C  YPACK A+W PDTV  V    S++     TC  H  H       + S+    +  F+G I             CD++  E LN+++                   + +P++  N   +L +   N+  P     + S PP     +++P+   S D             Q  +V    VC+CG  A    V KEGPN+ + FY C++  C+ F W +      G   ++ P       S   +   N PQ       ++ +T  +  CNC +P    TV K+  NKGR F++C      QC FFQW+DE  P            + +S    GDN      K+  ++S+  P          K  R+C +C QPGHT   CP  +
Sbjct:  308 FAQGILESGGPTPRNGNKSDQAHPPIHPTKYTNSLQGNEKRLYEFIVRHFLACCSKDAQGQEVIVDIDIAE---------------------EKFSASGLTIIARNYLDVYPYEKWFNKVIPLYTANTTFQPSAIEMVEGQTSPPQLLTEADLIALMEKHGIGTDATHAEHIETIKSRMYVGLTAD--QRFLPGELGMGLVEGYNSMGYEMSKPDLRAELEADLKLVSEGRKDKASVLRHHVAKYKAVFIESAKKAKKLDEALSNYL-----GQAQEYTEQEEQELEMPLPVRKCPQCNRDMVLRKRKDSTGKFLSCLGYPACKAAVWFPDTVLEV----SRDDSVCPTCRPHPVHMLKFKFKRGSLPPGMDLEFVGCIG-----------GCDETLREVLNLKYLRGGGSGGDSGIQVIQRTASRQPNAPRNNNTALQSRSENRPPPPRLSAVSSRPPLTNPAQSRPMQLPSSD-------------QSNAV----VCNCGVDALLLTVRKEGPNQGRQFYKCNTGNCKFFLWADESAEQHGSAGSRGPAGQSFQPSRPSVGFGNGPQERHGSRGAAGDTGGEAMCNCNEPAVQRTVMKDGPNKGRAFHTCGKPRDQQCGFFQWADENVPPA----------AVRSTTGGGDNSTWNGSKKTGVSSSKAP--------AAKRPRTCGICHQPGHTRTTCPQGR 933          

HSP 2 Score: 60.077 bits (144), Expect = 7.677e-9
Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEIT 115
            +W  CDREGENIG E+++ C A+K NI V RA+FSEIT
Sbjct:   60 IWTDCDREGENIGFEVINVCKAVKANIQVFRARFSEIT 97          
BLAST of DNA topoisomerase vs. Ensembl Cavefish
Match: top3b (DNA topoisomerase III beta [Source:NCBI gene;Acc:103043516])

HSP 1 Score: 118.242 bits (295), Expect = 4.583e-27
Identity = 83/248 (33.47%), Postives = 125/248 (50.40%), Query Frame = 3
Query:  135 LLSEGIH-PHNGKKSDQAHPPIHPLKQGIG--LNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKW-VDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIY 866
            LL+EGI+ P  G  +   HPPI P++      L  +  R++E ITRHF+A +S D    +T +                  + R+ +E   GFS TG +++   + +V P+    +++ +P    G+ F    V + + +TS P  LTEA+L+ LM+KHGIGTDA+   HI  +  R+YV  T      L P  LG+ LV GY  +   L  P +RS  E  L LI  G     +VL H L+ +K  +
Sbjct:  370 LLAEGINRPRKGADAGD-HPPITPMRSATESELGSESWRLYEYITRHFIATVSPDCKYLQTTI------------------SFRIGTE---GFSCTGKTLISAGFTEVMPWQGIPLEEALPTCEKGDAFTVDEVKLLEKQTSPPDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYV--TVENGRKLKPTNLGIVLVHGYYKIDVELVLPTIRSAVEKQLNLIALGKANFHQVLQHTLDIFKRKF 593          
BLAST of DNA topoisomerase vs. Ensembl Sea Lamprey
Match: top3a (DNA topoisomerase III alpha [Source:ZFIN;Acc:ZDB-GENE-071212-2])

HSP 1 Score: 375.555 bits (963), Expect = 7.646e-118
Identity = 239/664 (35.99%), Postives = 339/664 (51.05%), Query Frame = 3
Query:  123 FATRLLSEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFH--TSKPSSNFQNSLSTIPSNQA--QPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQW-SDEPNPIGNASTKLNMKRSFQS---PHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FA RLL  G +P NG KSDQAHPPIHP K    LN ++ R++E I RHFLAC S+DA G ET V I+                       GE F   GL +  RNYLDVYPYDKW  K +PVY  G  F+P+++ ++  ETS P LL+EADL+ LM+KHGIGTDATHA+HIE +K R YVG T P   FL PG+LGMGLVEGY  +G  +S+PDLR++ EADL+LIC G K    VL   +  YK+++    +K  KL E ++ YL E      N++     L P     VR CP C+  ++++++K   + L C  +P C+ A++ PD V    L  +++      C  +  H       K S+   T   ++G +             CD    +  ++++    + P+ + QN  S++   +   QP    S    ++  +  P   +    P    R E         +S  VC+CG  A    V KEG NK + FY CSSS C  F W +  D   ++   + +  +S+   +  ++   +V C+C  P  + T+ K+  NKGRQFY+CS     QC FF W +DEP+    +S+  +   +  S   P    DN R   TSN      H      ++ R+C +C QPGH    CP  K
Sbjct:  392 FAQRLLEAGPNPRNGTKSDQAHPPIHPTKYTADLNGNDQRLYEFIVRHFLACCSQDAQGQETTVEIEIA---------------------GERFFANGLMITARNYLDVYPYDKWNAKVIPVYTTGVKFQPSNIEMTDGETSPPQLLSEADLISLMEKHGIGTDATHADHIETIKSRMYVGLT-PAQRFL-PGELGMGLVEGYDAMGYEMSKPDLRAELEADLKLICEGKKNNTTVLQQQIQKYKQVFLEAVSKAEKLDEALSCYLGEPQQSIANEETIPRRLEP-----VRKCPQCKSNMVLKQTKDGKFMLTCLGFPNCRAAVFFPDFV----LEATRDESICQFCQPNAIHRLKFKFKKNSVIPCTPLDYVGCVG-----------GCDDVINDIADLKYLRPATTPNQSRQNQPSSVARQRGTCQP----SNAYVQRPPQQAPPPMAMLQIPPG--RNE---------ESAVVCNCGIEATLLTVKKEGINKGRMFYKCSSSVCNFFLWADQQDGGFRSAQSNQSSFHSSAVSRGGHD---EVMCSCNNPAVMRTIVKDGPNKGRQFYTCSKPRDEQCGFFLWMADEPSNSDLSSSNCDFAYAAHSVTRPSPRPDNARP--TSNNRTAGEHTTV---RAKRTCGICHQPGHIRTTCPMNK 989          

HSP 2 Score: 67.781 bits (164), Expect = 6.709e-12
Identity = 29/45 (64.44%), Postives = 34/45 (75.56%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKA 136
            +W  CDREGENIG EI+D C A+KPN+ V RA+FSEIT Q  H A
Sbjct:  145 IWTDCDREGENIGFEIIDVCKAVKPNLQVFRARFSEITQQSIHNA 189          
BLAST of DNA topoisomerase vs. Ensembl Yeast
Match: TOP3 (DNA Topoisomerase III; conserved protein that functions in a complex with Sgs1p and Rmi1p to relax single-stranded negatively-supercoiled DNA preferentially; DNA catenation/decatenation activity is stimulated by RPA and Sgs1p-Top3p-Rmi1p; involved in telomere stability and regulation of mitotic recombination [Source:SGD;Acc:S000004224])

HSP 1 Score: 160.614 bits (405), Expect = 4.393e-42
Identity = 91/254 (35.83%), Postives = 138/254 (54.33%), Query Frame = 3
Query:  156 PHNGKKSDQAHPPIHP---LKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKW-VDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGM-NFLIPGKLGMGLVEGYSLVG--QLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKL 896
            P +G   D+AHPPIHP   L     ++  E R++E + RHFLAC S+DA G    +++D          W V           E FS +GL VLERN+LDVYP+ +W   K++P   +  + +     +    T+ P  +TE++L++LMD +GIGTDAT AEHI+K++ R+YV +   G   +L P  LG+ LV G+  +G     ++P  R + E DL+ IC G     +V+   +  Y++ +  TN   N L
Sbjct:  413 PRSGSHDDKAHPPIHPIVSLGPEANVSPVERRVYEYVARHFLACCSEDAKGQSMTLVLD----------WAV-----------ERFSASGLVVLERNFLDVYPWARWETTKQLPRLEMNALVDIAKAEMKAGTTAPPKPMTESELILLMDTNGIGTDATIAEHIDKIQVRNYVRSEKVGKETYLQPTTLGVSLVHGFEAIGLEDSFAKPFQRREMEQDLKKICEGHASKTDVVKDIVEKYRKYWHKTNACKNTL 645          
BLAST of DNA topoisomerase vs. Ensembl Nematostella
Match: EDO40018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S883])

HSP 1 Score: 338.191 bits (866), Expect = 6.820e-104
Identity = 215/615 (34.96%), Postives = 309/615 (50.24%), Query Frame = 3
Query:   90 SALNFLKLLFRFATRLLSEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEE-TVRGCPLCEG-MILIRKSKK------NVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFHTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSK--CQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVN--------CNCGKPVNLLTVRKENQNKGRQFYSCSQ-----CSFFQWSDE 1865
            S +++++ +  FA+ +L+ G +P  G K+D AHPPIHP +    L  ++ R++E I RHFLAC S+DA G ET V ID                       GE F+ TGL +  RNYLDVYPYD+W  K +PVY   E F+PTS+ +   ET+ P LLTEADL+ LM+KHGIGTDATHA+HIE +K R YVG  G G    +PG+LGMGLVEGY L+    S+P LRS  EADL+ IC+GTK    VL   +  YKE +     +  KL + ++ Y      GD  D      L+PL  +  VR CP CE   + +RK+K+      + + +GC  +P C+ +++LP +V    LA + +      C     H       + S+   T   ++G I             CD+   E L+I+  +       +N+  + PS + Q +    +  F     +           T+   Q        S ++  VC CG  A    V K+GPN+ + FY CS  +  C  F W ++       P    T+ +S N   S N++   ++        CNC +P    TV K+  NKGR FYSCS+     C FF+W+D+
Sbjct:  342 SMISYIEFVTGFASDVLANGPNPRQGSKTDNAHPPIHPTQYTNNLQGNDKRLYEFIVRHFLACCSQDAQGRETSVEIDIA---------------------GEKFTATGLMITARNYLDVYPYDRWSTKVIPVYETNEEFQPTSIEMVDGETTPPPLLTEADLIALMEKHGIGTDATHADHIETIKSRSYVGVQGDGT--FLPGQLGMGLVEGYDLMHFEFSKPKLRSGLEADLKRICDGTKSGAVVLREQIAKYKENFIQAAQEAIKLDQALSNYF-----GDPADFIE-QELDPLAADPIVRPCPRCEQHQMTLRKTKEGRQVKLSFYMIGCQGFPQCRASIFLPKSV----LALTVDESVCPVCRPRDVHMLRFTFKRGSVPPMTPLQYVGCIG-----------GCDEMLTETLDIKDIS-------RNTRGSQPS-RGQSRGRSQSSQFGASQTSASGRGRGRGTRTTGSNQSSRYYVCYSDENAIVCTCGNAAIQLTVRKDGPNQGRQFYKCSQREGGCDFFLWADANGPLPSTPR--PTLWSSTNGSSSWNDSGKRLDHVIGDELVCNCRQPAVSRTVNKDGPNKGRPFYSCSKPIGQSCGFFKWADQ 902          

HSP 2 Score: 60.4622 bits (145), Expect = 2.250e-9
Identity = 26/45 (57.78%), Postives = 31/45 (68.89%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKA 136
            +W  CDREGENIG EI+D C  + P I V RA+FSEIT Q   +A
Sbjct:  112 IWTDCDREGENIGHEIIDVCTKVCPRIKVYRARFSEITPQSVQRA 156          

HSP 3 Score: 52.373 bits (124), Expect = 5.754e-7
Identity = 23/47 (48.94%), Postives = 28/47 (59.57%), Query Frame = 3
Query: 1749 VNCNCGKPVNLLTVRKENQNKGRQFYSCSQ----CSFFQWSDEPNPI 1877
            + C CG     LTVRK+  N+GRQFY CSQ    C FF W+D   P+
Sbjct:  780 IVCTCGNAAIQLTVRKDGPNQGRQFYKCSQREGGCDFFLWADANGPL 826          
BLAST of DNA topoisomerase vs. Ensembl Nematostella
Match: EDO44262 (DNA topoisomerase [Source:UniProtKB/TrEMBL;Acc:A7RW77])

HSP 1 Score: 110.538 bits (275), Expect = 4.963e-25
Identity = 78/243 (32.10%), Postives = 117/243 (48.15%), Query Frame = 3
Query:  186 HPPIHPLKQGIG--LNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIG-EGFSLTGLSVLERNYLDVYPYDKWVDKE-VPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKE 902
            HPPI P++      L  D  R+++ ITRHFLA LS D    +T V                      + +IG E FS TG +V +  +  V  +    D E +P +  G+I +   V + + +T  P  LTE++L+ LM+KHGIGTDA+ + HI  +  R+YV     G   L P  LG+ LV GY  +   L  P +RS  E  L LI +G      VL+H +  + + +      ++ + E
Sbjct:  385 HPPITPMRCASESELGGDPWRLYDFITRHFLATLSPDCKYLQTTV----------------------KFKIGKEAFSFTGKAVTDPGFTSVMTWQAISDDERMPPFNKGDICQVAEVKLDERQTLPPDFLTESELITLMEKHGIGTDASISVHINNICERNYV-QIQSGRK-LAPTSLGIVLVHGYQKIDPELVLPTMRSAVEEQLNLIAHGKADFNAVLHHAIGIFTQKFTYFVKTVSSMDE 603          
BLAST of DNA topoisomerase vs. Ensembl Medaka
Match: top3a (DNA topoisomerase III alpha [Source:NCBI gene;Acc:101168371])

HSP 1 Score: 360.147 bits (923), Expect = 6.375e-112
Identity = 248/688 (36.05%), Postives = 330/688 (47.97%), Query Frame = 3
Query:  123 FATRLLSE--GIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLN-PLTEETVRGCPLC-EGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF--------HTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVE---------------SGDVRNQNPHCSSTVMNSANTPQSSNNTRS----DVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDE--PNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSK 2072
            FA R+L +  G +P  GKKSDQAHPPIHP K    L  +EAR++E I RHFLAC+S+DALG ET V ID                        E FS +GL ++ RNYLDVYPYDKW  K +PVY     F+P+++ +   +TS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T     FL PG+LGMGLVEGY+ +G  +S+P+LRS+ EADL+L+  G K    VL H++  YK ++  +  K  KL E ++ YL  A    E  +A    L  PL    VR CP C   M+L RK + +  FL C  YPACK A+W PD V  V    S++     TC     H       + S+       F+G I             CD++  E L++++               +  +S    P   A P+  ++ PP    + + P        P       + N  D       VC+CGQ A    V K+GPN+ + FY C+S  C  F W +               S     Q P  S+   N++   +      S       CNC +     TV+K+  NKGR F++C      QC FFQW+DE  P P G               +   D +R  +  +  PP A       K  R C  C  PGHT   CP +
Sbjct:  307 FAQRVLDQPGGPNPRQGKKSDQAHPPIHPTKYTSSLQGNEARVYEFIVRHFLACVSQDALGQETVVDIDIAQ---------------------EKFSTSGLMIIARNYLDVYPYDKWNAKVIPVYEEDSQFQPSAIEMVDGQTSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLTA-DQRFL-PGELGMGLVEGYNSMGYEMSKPNLRSELEADLKLVSEGRKDKRGVLQHHIQKYKTVFIESVRKAKKLDEALSAYLGAA---LEIPEAQQQDLEMPL---PVRKCPNCGRDMVLKRKREGSSKFLTCVGYPACKTAVWFPDMVLDV----SRDESICPTCQPSPVHMLKFKFRRGSLPPMMPLEFVGCIG-----------GCDETLREVLDLKYLRGAGAGGAGGGGRGDDPHSPPPRPPRAAPPRTQRAIPP----VPSVPAWNPEPRPPPGGSSVAINNSNDVI-----VCNCGQEAVLLTVRKDGPNQGRQFYKCNSGSCNFFLWADQPSQQEAPQSRGPTPSAQRIQQLPRPSAGFRNASGGRRGHEAGGSGHSGQTLCNCNQTAVTRTVQKDGPNKGRMFHTCGKPREQQCGFFQWADENVPPPDGGF-------------NRLEDGRRKVMGDSNKPPTA-------KKPRHCGNCHMPGHTRVTCPQR 921          

HSP 2 Score: 66.2402 bits (160), Expect = 8.709e-11
Identity = 30/53 (56.60%), Postives = 36/53 (67.92%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKAVVRRNTST 160
            +W  CDREGENIG E++D C A+KPN+ V RAKFSEIT      A +RR   T
Sbjct:   60 IWTDCDREGENIGFEVIDVCKAVKPNLQVFRAKFSEIT-----PASIRRACET 107          
BLAST of DNA topoisomerase vs. Ensembl Medaka
Match: top3a (DNA topoisomerase III alpha [Source:NCBI gene;Acc:101168371])

HSP 1 Score: 362.459 bits (929), Expect = 7.826e-112
Identity = 250/687 (36.39%), Postives = 334/687 (48.62%), Query Frame = 3
Query:  123 FATRLLSE--GIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLN-PLTEETVRGCPLC-EGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF--------HTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVE---------------SGDVRNQNPHCSSTVMNSANTPQSSNNTRS----DVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDE-PNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSK 2072
            FA R+L +  G +P  GKKSDQAHPPIHP K    L  +EAR++E I RHFLAC+S+DALG ET V ID                        E FS +GL ++ RNYLDVYPYDKW  K +PVY     F+P+++ +   +TS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T     FL PG+LGMGLVEGY+ +G  +S+P+LRS+ EADL+L+  G K    VL H++  YK ++  +  K  KL E ++ YL  A    E  +A    L  PL    VR CP C   M+L RK + +  FL C  YPACK A+W PD V  V    S++     TC     H       + S+       F+G I             CD++  E L++++               +  +S    P   A P+  ++ PP    + + P        P       + N  D       VC+CGQ A    V K+GPN+ + FY C+S  C  F W +               S     Q P  S+   N++   +      S       CNC +     TV+K+  NKGR F++C      QC FFQW+DE   P G +S+     R   S H   + +R  +  +  PP A       K  R C  C  PGHT   CP +
Sbjct:  408 FAQRVLDQPGGPNPRQGKKSDQAHPPIHPTKYTSSLQGNEARVYEFIVRHFLACVSQDALGQETVVDIDIAQ---------------------EKFSTSGLMIIARNYLDVYPYDKWNAKVIPVYEEDSQFQPSAIEMVDGQTSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLTA-DQRFL-PGELGMGLVEGYNSMGYEMSKPNLRSELEADLKLVSEGRKDKRGVLQHHIQKYKTVFIESVRKAKKLDEALSAYLGAA---LEIPEAQQQDLEMPL---PVRKCPNCGRDMVLKRKREGSSKFLTCVGYPACKTAVWFPDMVLDV----SRDESICPTCQPSPVHMLKFKFRRGSLPPMMPLEFVGCIG-----------GCDETLREVLDLKYLRGAGAGGAGGGGRGDDPHSPPPRPPRAAPPRTQRAIPP----VPSVPAWNPEPRPPPGGSSVAINNSNDVI-----VCNCGQEAVLLTVRKDGPNQGRQFYKCNSGSCNFFLWADQPSQQEAPQSRGPTPSAQRIQQLPRPSAGFRNASGGRRGHEAGGSGHSGQTLCNCNQTAVTRTVQKDGPNKGRMFHTCGKPREQQCGFFQWADENVPPPGKSSSSKRSTRVGSSSHPNSNGRRKVMGDSNKPPTA-------KKPRHCGNCHMPGHTRVTCPQR 1034          

HSP 2 Score: 66.2402 bits (160), Expect = 8.860e-11
Identity = 30/53 (56.60%), Postives = 36/53 (67.92%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKAVVRRNTST 160
            +W  CDREGENIG E++D C A+KPN+ V RAKFSEIT      A +RR   T
Sbjct:  161 IWTDCDREGENIGFEVIDVCKAVKPNLQVFRAKFSEIT-----PASIRRACET 208          
BLAST of DNA topoisomerase vs. Ensembl Medaka
Match: top3a (DNA topoisomerase III alpha [Source:NCBI gene;Acc:101168371])

HSP 1 Score: 360.533 bits (924), Expect = 1.830e-111
Identity = 248/688 (36.05%), Postives = 330/688 (47.97%), Query Frame = 3
Query:  123 FATRLLSE--GIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLN-PLTEETVRGCPLC-EGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF--------HTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVE---------------SGDVRNQNPHCSSTVMNSANTPQSSNNTRS----DVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDE--PNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSK 2072
            FA R+L +  G +P  GKKSDQAHPPIHP K    L  +EAR++E I RHFLAC+S+DALG ET V ID                        E FS +GL ++ RNYLDVYPYDKW  K +PVY     F+P+++ +   +TS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T     FL PG+LGMGLVEGY+ +G  +S+P+LRS+ EADL+L+  G K    VL H++  YK ++  +  K  KL E ++ YL  A    E  +A    L  PL    VR CP C   M+L RK + +  FL C  YPACK A+W PD V  V    S++     TC     H       + S+       F+G I             CD++  E L++++               +  +S    P   A P+  ++ PP    + + P        P       + N  D       VC+CGQ A    V K+GPN+ + FY C+S  C  F W +               S     Q P  S+   N++   +      S       CNC +     TV+K+  NKGR F++C      QC FFQW+DE  P P G               +   D +R  +  +  PP A       K  R C  C  PGHT   CP +
Sbjct:  367 FAQRVLDQPGGPNPRQGKKSDQAHPPIHPTKYTSSLQGNEARVYEFIVRHFLACVSQDALGQETVVDIDIAQ---------------------EKFSTSGLMIIARNYLDVYPYDKWNAKVIPVYEEDSQFQPSAIEMVDGQTSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLTA-DQRFL-PGELGMGLVEGYNSMGYEMSKPNLRSELEADLKLVSEGRKDKRGVLQHHIQKYKTVFIESVRKAKKLDEALSAYLGAA---LEIPEAQQQDLEMPL---PVRKCPNCGRDMVLKRKREGSSKFLTCVGYPACKTAVWFPDMVLDV----SRDESICPTCQPSPVHMLKFKFRRGSLPPMMPLEFVGCIG-----------GCDETLREVLDLKYLRGAGAGGAGGGGRGDDPHSPPPRPPRAAPPRTQRAIPP----VPSVPAWNPEPRPPPGGSSVAINNSNDVI-----VCNCGQEAVLLTVRKDGPNQGRQFYKCNSGSCNFFLWADQPSQQEAPQSRGPTPSAQRIQQLPRPSAGFRNASGGRRGHEAGGSGHSGQTLCNCNQTAVTRTVQKDGPNKGRMFHTCGKPREQQCGFFQWADENVPPPDGGF-------------NRLEDGRRKVMGDSNKPPTA-------KKPRHCGNCHMPGHTRVTCPQR 981          

HSP 2 Score: 66.2402 bits (160), Expect = 9.473e-11
Identity = 30/53 (56.60%), Postives = 36/53 (67.92%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKAVVRRNTST 160
            +W  CDREGENIG E++D C A+KPN+ V RAKFSEIT      A +RR   T
Sbjct:  120 IWTDCDREGENIGFEVIDVCKAVKPNLQVFRAKFSEIT-----PASIRRACET 167          
BLAST of DNA topoisomerase vs. Ensembl Medaka
Match: top3a (DNA topoisomerase III alpha [Source:NCBI gene;Acc:101168371])

HSP 1 Score: 360.533 bits (924), Expect = 3.758e-111
Identity = 248/688 (36.05%), Postives = 330/688 (47.97%), Query Frame = 3
Query:  123 FATRLLSE--GIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLN-PLTEETVRGCPLC-EGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRF--------HTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVE---------------SGDVRNQNPHCSSTVMNSANTPQSSNNTRS----DVNCNCGKPVNLLTVRKENQNKGRQFYSCS-----QCSFFQWSDE--PNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSK 2072
            FA R+L +  G +P  GKKSDQAHPPIHP K    L  +EAR++E I RHFLAC+S+DALG ET V ID                        E FS +GL ++ RNYLDVYPYDKW  K +PVY     F+P+++ +   +TS P LLTEADL+ LM+KHGIGTDATHAEHIE +K R YVG T     FL PG+LGMGLVEGY+ +G  +S+P+LRS+ EADL+L+  G K    VL H++  YK ++  +  K  KL E ++ YL  A    E  +A    L  PL    VR CP C   M+L RK + +  FL C  YPACK A+W PD V  V    S++     TC     H       + S+       F+G I             CD++  E L++++               +  +S    P   A P+  ++ PP    + + P        P       + N  D       VC+CGQ A    V K+GPN+ + FY C+S  C  F W +               S     Q P  S+   N++   +      S       CNC +     TV+K+  NKGR F++C      QC FFQW+DE  P P G               +   D +R  +  +  PP A       K  R C  C  PGHT   CP +
Sbjct:  410 FAQRVLDQPGGPNPRQGKKSDQAHPPIHPTKYTSSLQGNEARVYEFIVRHFLACVSQDALGQETVVDIDIAQ---------------------EKFSTSGLMIIARNYLDVYPYDKWNAKVIPVYEEDSQFQPSAIEMVDGQTSPPQLLTEADLISLMEKHGIGTDATHAEHIETIKSRMYVGLTA-DQRFL-PGELGMGLVEGYNSMGYEMSKPNLRSELEADLKLVSEGRKDKRGVLQHHIQKYKTVFIESVRKAKKLDEALSAYLGAA---LEIPEAQQQDLEMPL---PVRKCPNCGRDMVLKRKREGSSKFLTCVGYPACKTAVWFPDMVLDV----SRDESICPTCQPSPVHMLKFKFRRGSLPPMMPLEFVGCIG-----------GCDETLREVLDLKYLRGAGAGGAGGGGRGDDPHSPPPRPPRAAPPRTQRAIPP----VPSVPAWNPEPRPPPGGSSVAINNSNDVI-----VCNCGQEAVLLTVRKDGPNQGRQFYKCNSGSCNFFLWADQPSQQEAPQSRGPTPSAQRIQQLPRPSAGFRNASGGRRGHEAGGSGHSGQTLCNCNQTAVTRTVQKDGPNKGRMFHTCGKPREQQCGFFQWADENVPPPDGGF-------------NRLEDGRRKVMGDSNKPPTA-------KKPRHCGNCHMPGHTRVTCPQR 1024          

HSP 2 Score: 66.2402 bits (160), Expect = 9.216e-11
Identity = 30/53 (56.60%), Postives = 36/53 (67.92%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKAVVRRNTST 160
            +W  CDREGENIG E++D C A+KPN+ V RAKFSEIT      A +RR   T
Sbjct:  163 IWTDCDREGENIGFEVIDVCKAVKPNLQVFRAKFSEIT-----PASIRRACET 210          
BLAST of DNA topoisomerase vs. Ensembl Medaka
Match: top3b (DNA topoisomerase III beta [Source:NCBI gene;Acc:101167966])

HSP 1 Score: 111.694 bits (278), Expect = 6.340e-25
Identity = 124/472 (26.27%), Postives = 194/472 (41.10%), Query Frame = 3
Query:  135 LLSEGIH-PHNGKKSDQAHPPIHPLKQGIG--LNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIG-EGFSLTGLSVLERNYLDVYPYDKW-VDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVG-NTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGV-----------------------AKYLDEAPV------GDENDDAPWNSLNPLTEET---------------VRG-----CPLCEGMILIRKSKKNVWFLGCTNYPACKH---ALWLPDTVEH----VMLAKSKETEAIITCSNHH------EHDHNLAVNKISIKI-QTNQTFIGF-----IFFDEDRRFTACLYCDKSFCEALNIR 1328
            LLS G++ P  G      HPPI P++      L  D  R++E ITRHF+A +S+D    ++ +                         IG E FS  G + +   Y  + P+    +++ +P    G+ F    + + + +T  P  LTEA+L+ LM+KHGIGTDA+   HI  V  R+YV   TG     L P  LG+ LV GY  +   L  P +RS  E  L LI  G     +VL H L+ +K  +      I+ + E +                        KY+   P        DE  + P N    L +E                 RG     CP C      R  KK +    CT +P+C+H   AL +   VE     ++L  +   +  + C+  +      EH H + V++ S ++   +   + F        + D + T C++CD  F +A+ ++
Sbjct:  370 LLSAGLNRPRKGNDVGD-HPPITPMRAASEGELGSDGWRLYEYITRHFIATVSQDCRYLQSTIEFS----------------------IGTERFSCGGKTPISPGYTALMPWQGVPLEEALPTCQPGDAFTVDELRLVERQTGPPDYLTEAELITLMEKHGIGTDASIPVHINNVCQRNYVTVETG---RRLKPTNLGVVLVHGYYKIDAELVLPTIRSAVEKQLSLIALGKANFQQVLQHTLDIFKRKFHYFVDSISSMDELMEVSFSPIAATGKPLSRCGKCHRFMKYIQAKPSRLHCSHCDETYNVPQNGAIKLYKELRCPLDDFELVLWTSGARGKSYPLCPYCFSNPPFRDMKKGMGCNECT-HPSCQHSLSALGIGQCVECESGVLVLDPTSGPKWRMACNRCNVLVHLFEHAHKVQVSQDSCEVCDASLVMVDFNKARTPLPEGDTQHTGCVFCDPLFQDAVELK 814          
BLAST of DNA topoisomerase vs. Planmine SMEST
Match: SMESG000081337.1 (SMESG000081337.1)

HSP 1 Score: 1367.06 bits (3537), Expect = 0.000e+0
Identity = 651/651 (100.00%), Postives = 651/651 (100.00%), Query Frame = 3
Query:  123 FATRLLSEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFHTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCSQCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 2075
            FATRLLSEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFHTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCSQCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK
Sbjct:  360 FATRLLSEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRKSKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHDHNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFHTSKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSSFRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCSQCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK 1010          

HSP 2 Score: 84.3445 bits (207), Expect = 1.880e-16
Identity = 38/46 (82.61%), Postives = 41/46 (89.13%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKAV 139
            +W  CDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQ   +A+
Sbjct:  112 IWTDCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQSVTRAL 157          
BLAST of DNA topoisomerase vs. Planmine SMEST
Match: SMESG000081321.1 (SMESG000081321.1)

HSP 1 Score: 298.516 bits (763), Expect = 3.453e-96
Identity = 141/147 (95.92%), Postives = 144/147 (97.96%), Query Frame = 3
Query: 1599 NKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCSQCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQ 2039
            +KFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCSQCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRI LTSNVW PPAHINKGKPKSVRSCLL ++
Sbjct:  128 DKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCSQCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFGDNKRIDLTSNVWSPPAHINKGKPKSVRSCLLSKK 274          
BLAST of DNA topoisomerase vs. Planmine SMEST
Match: SMESG000081353.1 (SMESG000081353.1)

HSP 1 Score: 295.819 bits (756), Expect = 7.873e-90
Identity = 149/266 (56.02%), Postives = 189/266 (71.05%), Query Frame = 3
Query:  123 FATRLLSEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYL 920
            FA  +L +GI P  G K+D AHPPI PLK GIGL  DE  +FELITRHFLACLSKDA    T++LIDCISK +  D+W  + +    S +GE FSLTG  V E+NYLDVYPY+K +D  +P Y IG+IFEP+ V I   +T  PS LT+ DL+ LMDK+GIGTDATHAEHI K+K R+Y     P  NF +P KLG+GL++ Y+ +G  +++P LRS+FEADL+ ICNGTK P EVL HYL+ YK I+  +   I+KL++ V KYL
Sbjct:  310 FAKNILLDGITPMCGNKNDNAHPPIIPLKLGIGLAFDENHLFELITRHFLACLSKDAQCSRTEILIDCISKDHGRDTWKHKDSKIACSGLGEEFSLTGTIVREKNYLDVYPYEKLLDTFIPNYEIGDIFEPSCVGIKMGKTCPPSFLTDVDLISLMDKYGIGTDATHAEHIYKIKVREYTCLKYP--NFTVPTKLGIGLIDAYNYLGINIAQPMLRSKFEADLKEICNGTKDPNEVLRHYLDEYKSIFLESIKNIDKLQDIVLKYL 573          

HSP 2 Score: 64.3142 bits (155), Expect = 2.114e-10
Identity = 29/46 (63.04%), Postives = 35/46 (76.09%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKAV 139
            +W  CDREGENIGMEIVD CLA+   I VKRA+FSEIT +   +A+
Sbjct:   62 IWTDCDREGENIGMEIVDVCLAVNSKIDVKRARFSEITAESVTRAI 107          

HSP 3 Score: 53.5286 bits (127), Expect = 4.556e-7
Identity = 34/112 (30.36%), Postives = 46/112 (41.07%), Query Frame = 3
Query: 1530 STPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCSQ---CSFFQW 1856
            + P C CG      K +   P  ++  Y C + KC  +  +             +      +     N T+    C CGKP  L T  K N NKGRQ+YSC+Q   C FF W
Sbjct:  612 NVPNCFCG------KPTSSTPKLDQLLYNCKNKKCDFYLLI------------ENEKEKKKSEIDDDNVTK----CYCGKPAKLKTSLKNNANKGRQYYSCNQITNCKFFCW 701          
BLAST of DNA topoisomerase vs. Planmine SMEST
Match: SMESG000081353.1 (SMESG000081353.1)

HSP 1 Score: 295.819 bits (756), Expect = 7.932e-90
Identity = 149/266 (56.02%), Postives = 189/266 (71.05%), Query Frame = 3
Query:  123 FATRLLSEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYL 920
            FA  +L +GI P  G K+D AHPPI PLK GIGL  DE  +FELITRHFLACLSKDA    T++LIDCISK +  D+W  + +    S +GE FSLTG  V E+NYLDVYPY+K +D  +P Y IG+IFEP+ V I   +T  PS LT+ DL+ LMDK+GIGTDATHAEHI K+K R+Y     P  NF +P KLG+GL++ Y+ +G  +++P LRS+FEADL+ ICNGTK P EVL HYL+ YK I+  +   I+KL++ V KYL
Sbjct:  308 FAKNILLDGITPMCGNKNDNAHPPIIPLKLGIGLAFDENHLFELITRHFLACLSKDAQCSRTEILIDCISKDHGRDTWKHKDSKIACSGLGEEFSLTGTIVREKNYLDVYPYEKLLDTFIPNYEIGDIFEPSCVGIKMGKTCPPSFLTDVDLISLMDKYGIGTDATHAEHIYKIKVREYTCLKYP--NFTVPTKLGIGLIDAYNYLGINIAQPMLRSKFEADLKEICNGTKDPNEVLRHYLDEYKSIFLESIKNIDKLQDIVLKYL 571          

HSP 2 Score: 64.3142 bits (155), Expect = 2.166e-10
Identity = 29/46 (63.04%), Postives = 35/46 (76.09%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKAV 139
            +W  CDREGENIGMEIVD CLA+   I VKRA+FSEIT +   +A+
Sbjct:   60 IWTDCDREGENIGMEIVDVCLAVNSKIDVKRARFSEITAESVTRAI 105          

HSP 3 Score: 53.5286 bits (127), Expect = 5.131e-7
Identity = 34/112 (30.36%), Postives = 46/112 (41.07%), Query Frame = 3
Query: 1530 STPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQMFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLTVRKENQNKGRQFYSCSQ---CSFFQW 1856
            + P C CG      K +   P  ++  Y C + KC  +  +             +      +     N T+    C CGKP  L T  K N NKGRQ+YSC+Q   C FF W
Sbjct:  610 NVPNCFCG------KPTSSTPKLDQLLYNCKNKKCDFYLLI------------ENEKEKKKSEIDDDNVTK----CYCGKPAKLKTSLKNNANKGRQYYSCNQITNCKFFCW 699          
BLAST of DNA topoisomerase vs. Planmine SMEST
Match: SMESG000081353.1 (SMESG000081353.1)

HSP 1 Score: 294.664 bits (753), Expect = 7.950e-90
Identity = 149/266 (56.02%), Postives = 189/266 (71.05%), Query Frame = 3
Query:  123 FATRLLSEGIHPHNGKKSDQAHPPIHPLKQGIGLNEDEARIFELITRHFLACLSKDALGHETKVLIDCISKAYSADSWPVRGNIRLRSEIGEGFSLTGLSVLERNYLDVYPYDKWVDKEVPVYGIGEIFEPTSVSISQSETSAPSLLTEADLLILMDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSLVGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKINKLKEGVAKYL 920
            FA  +L +GI P  G K+D AHPPI PLK GIGL  DE  +FELITRHFLACLSKDA    T++LIDCISK +  D+W  + +    S +GE FSLTG  V E+NYLDVYPY+K +D  +P Y IG+IFEP+ V I   +T  PS LT+ DL+ LMDK+GIGTDATHAEHI K+K R+Y     P  NF +P KLG+GL++ Y+ +G  +++P LRS+FEADL+ ICNGTK P EVL HYL+ YK I+  +   I+KL++ V KYL
Sbjct:  310 FAKNILLDGITPMCGNKNDNAHPPIIPLKLGIGLAFDENHLFELITRHFLACLSKDAQCSRTEILIDCISKDHGRDTWKHKDSKIACSGLGEEFSLTGTIVREKNYLDVYPYEKLLDTFIPNYEIGDIFEPSCVGIKMGKTCPPSFLTDVDLISLMDKYGIGTDATHAEHIYKIKVREYTCLKYP--NFTVPTKLGIGLIDAYNYLGINIAQPMLRSKFEADLKEICNGTKDPNEVLRHYLDEYKSIFLESIKNIDKLQDIVLKYL 573          

HSP 2 Score: 64.3142 bits (155), Expect = 1.883e-10
Identity = 29/46 (63.04%), Postives = 35/46 (76.09%), Query Frame = 2
Query:    2 LWLGCDREGENIGMEIVDTCLAIKPNITVKRAKFSEITFQVRHKAV 139
            +W  CDREGENIGMEIVD CLA+   I VKRA+FSEIT +   +A+
Sbjct:   62 IWTDCDREGENIGMEIVDVCLAVNSKIDVKRARFSEITAESVTRAI 107          
The following BLAST results are available for this feature:
BLAST of DNA topoisomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TOP3A1.705e-11836.23DNA topoisomerase III alpha [Source:HGNC Symbol;Ac... [more]
TOP3A1.705e-11836.23DNA topoisomerase III alpha [Source:HGNC Symbol;Ac... [more]
TOP3A3.714e-11836.23DNA topoisomerase III alpha [Source:HGNC Symbol;Ac... [more]
TOP3A3.714e-11836.23DNA topoisomerase III alpha [Source:HGNC Symbol;Ac... [more]
TOP3A3.714e-11836.23DNA topoisomerase III alpha [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of DNA topoisomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
top-36.602e-6443.33DNA topoisomerase 3 [Source:UniProtKB/Swiss-Prot;... [more]
Y48C3A.143.854e-2834.10DNA topoisomerase [Source:UniProtKB/TrEMBL;Acc:H1... [more]
Y48C3A.143.943e-2834.22DNA topoisomerase [Source:UniProtKB/TrEMBL;Acc:H1... [more]
Y48C3A.143.233e-1138.00DNA topoisomerase [Source:UniProtKB/TrEMBL;Acc:H1... [more]
back to top
BLAST of DNA topoisomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Top3alpha1.412e-8840.15gene:FBgn0040268 transcript:FBtr0081246[more]
Top3beta2.203e-2129.84gene:FBgn0026015 transcript:FBtr0340028[more]
Top3beta2.203e-2129.84gene:FBgn0026015 transcript:FBtr0070930[more]
back to top
BLAST of DNA topoisomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
top3a6.461e-11837.35DNA topoisomerase III alpha [Source:ZFIN;Acc:ZDB-G... [more]
top3b5.156e-2834.68DNA topoisomerase III beta [Source:ZFIN;Acc:ZDB-GE... [more]
top3b5.156e-2834.68DNA topoisomerase III beta [Source:ZFIN;Acc:ZDB-GE... [more]
BX005237.15.213e-2834.68DNA topoisomerase III beta [Source:NCBI gene;Acc:7... [more]
neil35.534e-727.22nei-like DNA glycosylase 3 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of DNA topoisomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cryba12.473e-12135.71crystallin beta A1 [Source:Xenbase;Acc:XB-GENE-956... [more]
cryba12.688e-12135.71crystallin beta A1 [Source:Xenbase;Acc:XB-GENE-956... [more]
cryba12.825e-12135.71crystallin beta A1 [Source:Xenbase;Acc:XB-GENE-956... [more]
cryba11.008e-12035.65crystallin beta A1 [Source:Xenbase;Acc:XB-GENE-956... [more]
cryba17.313e-12035.57crystallin beta A1 [Source:Xenbase;Acc:XB-GENE-956... [more]
back to top
BLAST of DNA topoisomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Top3a8.670e-12035.76topoisomerase (DNA) III alpha [Source:MGI Symbol;A... [more]
Top3a2.159e-11636.76topoisomerase (DNA) III alpha [Source:MGI Symbol;A... [more]
Top3a1.279e-9140.88topoisomerase (DNA) III alpha [Source:MGI Symbol;A... [more]
Top3a1.111e-8546.13topoisomerase (DNA) III alpha [Source:MGI Symbol;A... [more]
Top3b7.207e-2734.40topoisomerase (DNA) III beta [Source:MGI Symbol;Ac... [more]
back to top
BLAST of DNA topoisomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70157|TOP3A_MOUSE6.065e-11935.76DNA topoisomerase 3-alpha OS=Mus musculus OX=10090... [more]
sp|Q13472|TOP3A_HUMAN1.784e-11736.23DNA topoisomerase 3-alpha OS=Homo sapiens OX=9606 ... [more]
sp|Q9NG98|TOP3A_DROME1.415e-8740.15DNA topoisomerase 3-alpha OS=Drosophila melanogast... [more]
sp|O61660|TOP3_CAEEL8.398e-6343.33DNA topoisomerase 3 OS=Caenorhabditis elegans OX=6... [more]
sp|Q9LVP1|TOP3A_ARATH7.277e-5731.62DNA topoisomerase 3-alpha OS=Arabidopsis thaliana ... [more]
back to top
BLAST of DNA topoisomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5N3WYH41.312e-12136.84Uncharacterized protein OS=Muntiacus muntjak OX=98... [more]
A0A4X2KWD51.568e-12136.71DNA topoisomerase OS=Vombatus ursinus OX=29139 GN=... [more]
K9J3S61.793e-12137.17DNA topoisomerase (Fragment) OS=Desmodus rotundus ... [more]
A0A4W2HP292.532e-12136.50DNA topoisomerase OS=Bos indicus x Bos taurus OX=3... [more]
A0A4X2KWG12.672e-12136.71DNA topoisomerase OS=Vombatus ursinus OX=29139 GN=... [more]
back to top
BLAST of DNA topoisomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
top3a1.115e-11835.41DNA topoisomerase III alpha [Source:ZFIN;Acc:ZDB-G... [more]
top3a4.258e-11734.66DNA topoisomerase III alpha [Source:ZFIN;Acc:ZDB-G... [more]
top3b4.583e-2733.47DNA topoisomerase III beta [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA topoisomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
top3a7.646e-11835.99DNA topoisomerase III alpha [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of DNA topoisomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOP34.393e-4235.83DNA Topoisomerase III; conserved protein that func... [more]
back to top
BLAST of DNA topoisomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO400186.820e-10434.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442624.963e-2532.10DNA topoisomerase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA topoisomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
top3a6.375e-11236.05DNA topoisomerase III alpha [Source:NCBI gene;Acc:... [more]
top3a7.826e-11236.39DNA topoisomerase III alpha [Source:NCBI gene;Acc:... [more]
top3a1.830e-11136.05DNA topoisomerase III alpha [Source:NCBI gene;Acc:... [more]
top3a3.758e-11136.05DNA topoisomerase III alpha [Source:NCBI gene;Acc:... [more]
top3b6.340e-2526.27DNA topoisomerase III beta [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA topoisomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081337.11.880e-16100.00SMESG000081337.1[more]
SMESG000081321.13.453e-9695.92SMESG000081321.1[more]
SMESG000081353.17.873e-9056.02SMESG000081353.1[more]
SMESG000081353.17.932e-9056.02SMESG000081353.1[more]
SMESG000081353.17.950e-9056.02SMESG000081353.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008509 ID=SMED30008509|Name=DNA topoisomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=2104bp
TTTATGGCTAGGTTGTGATAGAGAAGGTGAAAATATTGGTATGGAGATTG
TTGACACTTGTTTAGCAATTAAACCTAATATTACGGTAAAGCGCGCTAAA
TTTTCTGAAATTACTTTTCAGGTTCGCCACAAGGCTGTTGTCAGAAGGAA
TACATCCACATAACGGTAAAAAATCTGACCAAGCTCATCCTCCAATTCAT
CCACTGAAACAAGGTATTGGATTAAATGAAGATGAAGCTCGAATATTTGA
ATTGATAACGAGACATTTCTTAGCTTGTTTATCTAAAGATGCACTGGGTC
ATGAAACTAAAGTTCTAATTGACTGTATAAGCAAAGCATACAGTGCTGAT
AGTTGGCCAGTTCGAGGCAATATACGATTGAGAAGCGAAATCGGAGAAGG
ATTTTCCTTAACTGGATTATCTGTATTGGAACGGAATTATTTAGATGTTT
ATCCATATGATAAATGGGTTGACAAGGAAGTGCCGGTTTACGGGATAGGA
GAAATATTTGAGCCAACTTCTGTGAGCATTTCGCAAAGCGAAACATCGGC
ACCTTCACTACTTACAGAAGCTGATTTGCTGATTCTAATGGATAAGCATG
GCATAGGAACCGATGCCACCCATGCCGAGCATATAGAAAAAGTTAAACAT
CGAGATTACGTAGGCAATACTGGCCCTGGAATGAATTTTTTGATTCCAGG
AAAATTAGGCATGGGCTTGGTTGAAGGATACAGTTTAGTTGGACAACTTC
TTTCTCGCCCTGATCTCCGATCTCAATTTGAAGCAGATCTTGAACTAATT
TGCAATGGCACTAAGCAGCCTCTGGAAGTTTTGAACCATTATCTAAATGC
ATACAAGGAAATATATAAAAATACCAATACAAAAATTAACAAACTGAAAG
AAGGTGTGGCTAAATATTTGGACGAAGCTCCAGTAGGTGATGAAAATGAT
GATGCTCCATGGAATAGTTTAAATCCCTTAACCGAAGAAACTGTTCGTGG
TTGTCCTTTGTGCGAAGGAATGATTTTAATTCGTAAATCAAAAAAAAATG
TTTGGTTTCTTGGGTGTACTAACTACCCAGCTTGCAAGCATGCATTATGG
CTTCCTGACACAGTGGAACATGTTATGCTAGCAAAGTCAAAAGAAACAGA
AGCCATAATAACCTGTTCTAACCATCATGAACACGATCACAACCTGGCGG
TAAATAAAATTTCCATAAAAATTCAAACAAATCAAACATTTATCGGATTT
ATATTTTTCGATGAAGACAGAAGATTTACAGCTTGTTTATATTGCGATAA
AAGTTTTTGTGAAGCCCTTAACATACGATTCCATACTTCTAAACCTTCAT
CAAATTTTCAAAATTCATTATCAACAATTCCTTCAAATCAGGCGCAGCCT
AAAGTTATGAAATCAACTCCTCCTTTTAAAAAGGAAATAAAAAATCAACC
TATATCACAGTCTTCGTTCGACTTTCCTACATCCTCTTTTCGACAGGAAT
TGGAAAATCTACAAGATACATCAGTTAAAAGTACACCAGTTTGTCATTGT
GGTCAAATCGCAGCCACTCGTAAAGTTTCAAAGGAAGGGCCAAATAAAAA
TAAATTTTTTTATACATGCTCCAGCTCAAAGTGTCAGATGTTTGCATGGG
TGGAAAGTGGTGATGTTCGAAATCAAAATCCTCATTGTAGTAGTACAGTT
ATGAATTCAGCTAATACTCCTCAAAGCAGTAACAATACTCGTTCTGATGT
TAATTGCAACTGTGGAAAACCTGTAAATCTATTGACAGTTAGAAAAGAAA
ATCAAAATAAAGGGCGACAATTTTATTCTTGTTCTCAGTGTAGCTTTTTC
CAATGGTCAGATGAACCTAACCCAATTGGAAATGCGTCTACAAAATTGAA
TATGAAGCGTTCTTTTCAATCTCCCCACGAATTTGGTGATAATAAAAGAA
TTGCTTTAACCTCTAACGTTTGGCCACCTCCAGCCCACATTAATAAAGGT
AAACCAAAATCTGTCAGAAGCTGCCTTTTATGTAGACAGCCGGGTCACAC
TTCAAGAAAATGTCCATCGAAGAAATAAAGTTGAAATTAAATGCTGAGAT
CGGA
back to top

protein sequence of SMED30008509-orf-1

>SMED30008509-orf-1 ID=SMED30008509-orf-1|Name=SMED30008509-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=497bp
MDKHGIGTDATHAEHIEKVKHRDYVGNTGPGMNFLIPGKLGMGLVEGYSL
VGQLLSRPDLRSQFEADLELICNGTKQPLEVLNHYLNAYKEIYKNTNTKI
NKLKEGVAKYLDEAPVGDENDDAPWNSLNPLTEETVRGCPLCEGMILIRK
SKKNVWFLGCTNYPACKHALWLPDTVEHVMLAKSKETEAIITCSNHHEHD
HNLAVNKISIKIQTNQTFIGFIFFDEDRRFTACLYCDKSFCEALNIRFHT
SKPSSNFQNSLSTIPSNQAQPKVMKSTPPFKKEIKNQPISQSSFDFPTSS
FRQELENLQDTSVKSTPVCHCGQIAATRKVSKEGPNKNKFFYTCSSSKCQ
MFAWVESGDVRNQNPHCSSTVMNSANTPQSSNNTRSDVNCNCGKPVNLLT
VRKENQNKGRQFYSCSQCSFFQWSDEPNPIGNASTKLNMKRSFQSPHEFG
DNKRIALTSNVWPPPAHINKGKPKSVRSCLLCRQPGHTSRKCPSKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003697single-stranded DNA binding
GO:0003917DNA topoisomerase type I activity
GO:0003677DNA binding
GO:0003916DNA topoisomerase activity
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0016853isomerase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005694chromosome
GO:0016605PML body
Vocabulary: biological process
TermDefinition
GO:0032042mitochondrial DNA metabolic process
GO:0051304chromosome separation
GO:0006265DNA topological change
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036875Znf_CCHC_sf
IPR000380Topo_IA
IPR003602Topo_IA_DNA-bd_dom
IPR013497Topo_IA_cen
IPR013826Topo_IA_cen_sub3
IPR013498Topo_IA_Znf
IPR013824Topo_IA_cen_sub1
IPR010666Znf_GRF
IPR001878Znf_CCHC
IPR023405Topo_IA_core_domain
IPR006171TOPRIM_domain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 93..113
NoneNo IPR availablePANTHERPTHR11390:SF21DNA TOPOISOMERASE 3-ALPHAcoord: 1..415
IPR013824DNA topoisomerase, type IA, central region, subdomain 1GENE3DG3DSA:1.10.460.10coord: 1..115
e-value: 2.3E-33
score: 117.2
IPR013498DNA topoisomerase, type IA, zn fingerPFAMPF01396zf-C4_Topoisomcoord: 137..174
e-value: 9.1E-12
score: 44.6
IPR013497DNA topoisomerase, type IA, centralPFAMPF01131Topoisom_baccoord: 1..82
e-value: 2.7E-14
score: 53.0
IPR010666Zinc finger, GRF-typePFAMPF06839zf-GRFcoord: 389..426
e-value: 9.4E-13
score: 48.0
coord: 317..357
e-value: 2.7E-9
score: 37.0
IPR000380DNA topoisomerase, type IAPANTHERPTHR11390PROKARYOTIC DNA TOPOISOMERASEcoord: 1..415
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 479..494
score: 8.829
IPR023405DNA topoisomerase, type IA, core domainSUPERFAMILYSSF56712Prokaryotic type I DNA topoisomerasecoord: 1..149
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 468..495