SMED30008508

Overview
NameSMED30008508
Smed IDSMED30008508
Length (bp)1495
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30008508 (SMED30008508) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30008508 (SMED30008508) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30008508 (SMED30008508) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30008508 (SMED30008508) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008508

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30008508SMESG000018237.1 Contig818GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30008508SMESG000044487.1 Contig818GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v4_921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008508SMESG000055230.1 SMESG000044487.1 Contig35514newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008508SMESG000055230.1 SMESG000044487.1 Contig35514uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008508SMESG000055230.1 SMESG000044487.1 Contig44467newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008508SMESG000055230.1 SMESG000044487.1 Contig44467uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v6_921_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v6_921_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v6_921_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30008508SMESG000055230.1 SMESG000044487.1 dd_Smed_v6_921_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30008508 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001855:83145..85609 +7242
Homology
BLAST of SMED30008508 vs. Ensembl Human
Match: XIRP2 (xin actin binding repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:14303])

HSP 1 Score: 93.5893 bits (231), Expect = 1.925e-19
Identity = 71/242 (29.34%), Postives = 119/242 (49.17%), Query Frame = -1
Query:  530 ISRNIADEIAENSECIDISNYEEINATSNELVH--EVMSGIESNLVLEDEHISNDVVNENSITDEKI---MNENITNVQENLEDNKQASEDCEIKSETTNVEVNIVDDEKVVE-DTEAIENQPDNEACEIQQEIINSTKEISQKTNEPSYSPTKGKDVKSLSTAYGREENLINVN--CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 1231
            + +   DEI  +        Y+  N +  E +H  +V +   S  +  +E   + V        +KI     E +++++++ E+  QAS+  +   ET    ++  +DE++ +  T+ ++ Q +  A   Q++I+ S KE++          T  K +K L         L+     C +C K VYPME LVA+ + FHK+CFRC  C S LS GNY+    + YC PH+ +LFK +G YDE
Sbjct:  258 VKKQFEDEITSSRNTFAQYQYQHQNRSEQEAIHSSQVGTSRSSQEMARNEQEGSKV--------QKIDVHGTEMVSHLEKHTEEVNQASQFHQYVQETV---IDTPEDEEIPKVSTKLLKEQFEKSA---QEKILYSDKEMT----------TPAKQIKKL---------LLQDKEICILCQKTVYPMECLVADKQNFHKSCFRCHHCNSKLSLGNYASLHGQIYCKPHFKQLFKSKGNYDE 466          
BLAST of SMED30008508 vs. Ensembl Human
Match: XIRP2 (xin actin binding repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:14303])

HSP 1 Score: 93.5893 bits (231), Expect = 2.050e-19
Identity = 71/242 (29.34%), Postives = 119/242 (49.17%), Query Frame = -1
Query:  530 ISRNIADEIAENSECIDISNYEEINATSNELVH--EVMSGIESNLVLEDEHISNDVVNENSITDEKI---MNENITNVQENLEDNKQASEDCEIKSETTNVEVNIVDDEKVVE-DTEAIENQPDNEACEIQQEIINSTKEISQKTNEPSYSPTKGKDVKSLSTAYGREENLINVN--CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 1231
            + +   DEI  +        Y+  N +  E +H  +V +   S  +  +E   + V        +KI     E +++++++ E+  QAS+  +   ET    ++  +DE++ +  T+ ++ Q +  A   Q++I+ S KE++          T  K +K L         L+     C +C K VYPME LVA+ + FHK+CFRC  C S LS GNY+    + YC PH+ +LFK +G YDE
Sbjct:  291 VKKQFEDEITSSRNTFAQYQYQHQNRSEQEAIHSSQVGTSRSSQEMARNEQEGSKV--------QKIDVHGTEMVSHLEKHTEEVNQASQFHQYVQETV---IDTPEDEEIPKVSTKLLKEQFEKSA---QEKILYSDKEMT----------TPAKQIKKL---------LLQDKEICILCQKTVYPMECLVADKQNFHKSCFRCHHCNSKLSLGNYASLHGQIYCKPHFKQLFKSKGNYDE 499          
BLAST of SMED30008508 vs. Ensembl Human
Match: XIRP2 (xin actin binding repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:14303])

HSP 1 Score: 93.5893 bits (231), Expect = 2.171e-19
Identity = 71/242 (29.34%), Postives = 119/242 (49.17%), Query Frame = -1
Query:  530 ISRNIADEIAENSECIDISNYEEINATSNELVH--EVMSGIESNLVLEDEHISNDVVNENSITDEKI---MNENITNVQENLEDNKQASEDCEIKSETTNVEVNIVDDEKVVE-DTEAIENQPDNEACEIQQEIINSTKEISQKTNEPSYSPTKGKDVKSLSTAYGREENLINVN--CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 1231
            + +   DEI  +        Y+  N +  E +H  +V +   S  +  +E   + V        +KI     E +++++++ E+  QAS+  +   ET    ++  +DE++ +  T+ ++ Q +  A   Q++I+ S KE++          T  K +K L         L+     C +C K VYPME LVA+ + FHK+CFRC  C S LS GNY+    + YC PH+ +LFK +G YDE
Sbjct:  266 VKKQFEDEITSSRNTFAQYQYQHQNRSEQEAIHSSQVGTSRSSQEMARNEQEGSKV--------QKIDVHGTEMVSHLEKHTEEVNQASQFHQYVQETV---IDTPEDEEIPKVSTKLLKEQFEKSA---QEKILYSDKEMT----------TPAKQIKKL---------LLQDKEICILCQKTVYPMECLVADKQNFHKSCFRCHHCNSKLSLGNYASLHGQIYCKPHFKQLFKSKGNYDE 474          
BLAST of SMED30008508 vs. Ensembl Human
Match: XIRP2 (xin actin binding repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:14303])

HSP 1 Score: 92.8189 bits (229), Expect = 2.846e-19
Identity = 71/240 (29.58%), Postives = 120/240 (50.00%), Query Frame = -1
Query:  530 ISRNIADEIAENSECIDISNYEEINATSNELVH--EVMSGIESNLVLEDEHISNDVVNENSITDEKI---MNENITNVQENLEDNKQASEDCEIKSETTNVEVNIVDDEKVVE-DTEAIENQPDNEACEIQQEIINSTKEISQKTNEPSYSPTKGKDVKSLSTAYGREENLINVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 1231
            + +   DEI  +        Y+  N +  E +H  +V +   S  +  +E   + V        +KI     E +++++++ E+  QAS+  +   ET    ++  +DE++ +  T+ ++ Q +  A   Q++I+ S KE++          T  K +K L      ++  I   C +C K VYPME LVA+ + FHK+CFRC  C S LS GNY+    + YC PH+ +LFK +G YDE
Sbjct:   36 VKKQFEDEITSSRNTFAQYQYQHQNRSEQEAIHSSQVGTSRSSQEMARNEQEGSKV--------QKIDVHGTEMVSHLEKHTEEVNQASQFHQYVQETV---IDTPEDEEIPKVSTKLLKEQFEKSA---QEKILYSDKEMT----------TPAKQIKKLLL----QDKEI---CILCQKTVYPMECLVADKQNFHKSCFRCHHCNSKLSLGNYASLHGQIYCKPHFKQLFKSKGNYDE 244          
BLAST of SMED30008508 vs. Ensembl Human
Match: XIRP2 (xin actin binding repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:14303])

HSP 1 Score: 92.0485 bits (227), Expect = 7.738e-19
Identity = 36/65 (55.38%), Postives = 45/65 (69.23%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C +C K VYPME LVA+ + FHK+CFRC  C S LS GNY+    + YC PH+ +LFK +G YDE
Sbjct: 3301 CILCQKTVYPMECLVADKQNFHKSCFRCHHCNSKLSLGNYASLHGQIYCKPHFKQLFKSKGNYDE 3365          
BLAST of SMED30008508 vs. Ensembl Celegans
Match: F42H10.3 (LIM and SH3 domain protein F42H10.3 [Source:UniProtKB/Swiss-Prot;Acc:P34416])

HSP 1 Score: 64.6994 bits (156), Expect = 3.874e-11
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = -1
Query:  566 CNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHY 715
            C K VYP+E+L   DK +HK CF+C+ C   L+  NY    +RPYC PHY
Sbjct:   10 CGKTVYPVEELKCLDKVWHKQCFKCTVCGMTLNMKNYKGYDKRPYCDPHY 59          
BLAST of SMED30008508 vs. Ensembl Celegans
Match: F42H10.3 (LIM and SH3 domain protein F42H10.3 [Source:UniProtKB/Swiss-Prot;Acc:P34416])

HSP 1 Score: 64.3142 bits (155), Expect = 5.144e-11
Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = -1
Query:  566 CNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHY 715
            C K VYP+E+L   DK +HK CF+C+ C   L+  NY    +RPYC PHY
Sbjct:   10 CGKTVYPVEELKCLDKVWHKQCFKCTVCGMTLNMKNYKGYDKRPYCDPHY 59          
BLAST of SMED30008508 vs. Ensembl Celegans
Match: exc-9 (pep chromosome:WBcel235:IV:7939812:7940818:-1 gene:WBGene00017644.1 transcript:F20D12.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:exc-9)

HSP 1 Score: 52.373 bits (124), Expect = 1.399e-8
Identity = 24/64 (37.50%), Postives = 34/64 (53.12%), Query Frame = -1
Query:  542 NCCVCNKKVYPMEKLVANDKTFHKTCFRCSK--CKSALSTGNYSFNQQRPYCTPHYIELFKKRG 727
            NC  C K VY  E++ +    +H+ C RC    CK  L+ G++S  + +PYC   Y  LF  RG
Sbjct:    3 NCPRCQKAVYFAERVTSIGFDWHRPCLRCENEACKKTLAAGSHSEREGKPYCNRCYGALFGPRG 66          
BLAST of SMED30008508 vs. Ensembl Celegans
Match: exc-9 (pep chromosome:WBcel235:IV:7939812:7941064:-1 gene:WBGene00017644.1 transcript:F20D12.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:exc-9)

HSP 1 Score: 52.373 bits (124), Expect = 1.399e-8
Identity = 24/64 (37.50%), Postives = 34/64 (53.12%), Query Frame = -1
Query:  542 NCCVCNKKVYPMEKLVANDKTFHKTCFRCSK--CKSALSTGNYSFNQQRPYCTPHYIELFKKRG 727
            NC  C K VY  E++ +    +H+ C RC    CK  L+ G++S  + +PYC   Y  LF  RG
Sbjct:    3 NCPRCQKAVYFAERVTSIGFDWHRPCLRCENEACKKTLAAGSHSEREGKPYCNRCYGALFGPRG 66          
BLAST of SMED30008508 vs. Ensembl Celegans
Match: valv-1 (pep chromosome:WBcel235:IV:7444639:7445432:-1 gene:WBGene00015216.1 transcript:B0496.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:valv-1)

HSP 1 Score: 50.447 bits (119), Expect = 5.463e-8
Identity = 23/64 (35.94%), Postives = 36/64 (56.25%), Query Frame = -1
Query:  542 NCCVCNKKVYPMEKLVANDKTFHKTCFRCSK--CKSALSTGNYSFNQQRPYCTPHYIELFKKRG 727
            NC  C K VY  E++ +  K +H+ C +C+   C   LS G++S ++ +PYC   Y  LF  +G
Sbjct:    3 NCPNCQKPVYFAERVSSLGKDWHRPCLKCANKACGKTLSAGSHSEHEGKPYCNRCYGALFGPKG 66          
BLAST of SMED30008508 vs. Ensembl Fly
Match: Lasp (gene:FBgn0063485 transcript:FBtr0306152)

HSP 1 Score: 62.7734 bits (151), Expect = 1.328e-10
Identity = 25/56 (44.64%), Postives = 34/56 (60.71%), Query Frame = -1
Query:  569 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPH 736
            +N  C  C K VYP+E+L   DKT+HKTCF+C++C   L+   Y    + PYC  H
Sbjct:    1 MNKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAH 56          
BLAST of SMED30008508 vs. Ensembl Fly
Match: Lasp (gene:FBgn0063485 transcript:FBtr0075350)

HSP 1 Score: 63.1586 bits (152), Expect = 2.572e-10
Identity = 25/56 (44.64%), Postives = 34/56 (60.71%), Query Frame = -1
Query:  569 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPH 736
            +N  C  C K VYP+E+L   DKT+HKTCF+C++C   L+   Y    + PYC  H
Sbjct:    1 MNKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAH 56          
BLAST of SMED30008508 vs. Ensembl Fly
Match: Lasp (gene:FBgn0063485 transcript:FBtr0100145)

HSP 1 Score: 62.7734 bits (151), Expect = 3.968e-10
Identity = 25/56 (44.64%), Postives = 34/56 (60.71%), Query Frame = -1
Query:  569 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPH 736
            +N  C  C K VYP+E+L   DKT+HKTCF+C++C   L+   Y    + PYC  H
Sbjct:    1 MNKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAH 56          
BLAST of SMED30008508 vs. Ensembl Fly
Match: Lasp (gene:FBgn0063485 transcript:FBtr0306151)

HSP 1 Score: 62.7734 bits (151), Expect = 4.068e-10
Identity = 25/56 (44.64%), Postives = 34/56 (60.71%), Query Frame = -1
Query:  569 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPH 736
            +N  C  C K VYP+E+L   DKT+HKTCF+C++C   L+   Y    + PYC  H
Sbjct:    1 MNKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAH 56          
BLAST of SMED30008508 vs. Ensembl Fly
Match: CG33521 (gene:FBgn0250819 transcript:FBtr0334661)

HSP 1 Score: 56.225 bits (134), Expect = 4.159e-8
Identity = 26/71 (36.62%), Postives = 38/71 (53.52%), Query Frame = -1
Query:  527 NCCVCNKKVYPMEKLVANDKT----FHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDEV 727
            NC  C K VY ME+++ + KT    FHKTC RC  C   L   +Y+ +    YC+ H+  +F  +  Y+E 
Sbjct:   79 NCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFKLIFAPKVVYEEF 149          
BLAST of SMED30008508 vs. Ensembl Zebrafish
Match: xirp2a (xin actin binding repeat containing 2a [Source:ZFIN;Acc:ZDB-GENE-040108-7])

HSP 1 Score: 102.064 bits (253), Expect = 2.006e-22
Identity = 43/84 (51.19%), Postives = 55/84 (65.48%), Query Frame = -1
Query:  476 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE-VDDNVEKEIPATNDINDV 724
            C VC K+VYPME L+A+ + FHKTCFRC+ C S LS G Y+    R YC PHY +LFK +G YDE   +   KE  +T D N++
Sbjct:  266 CQVCRKRVYPMESLIADKQNFHKTCFRCAHCNSQLSLGTYASLHGRMYCKPHYKQLFKSKGNYDEGFGERPHKEHWSTKDQNNI 349          
BLAST of SMED30008508 vs. Ensembl Zebrafish
Match: xirp2b (xin actin binding repeat containing 2b [Source:ZFIN;Acc:ZDB-GENE-030521-26])

HSP 1 Score: 89.3521 bits (220), Expect = 1.503e-19
Identity = 38/82 (46.34%), Postives = 49/82 (59.76%), Query Frame = -1
Query:  479 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDEVDDNVEKEIPATNDIND 724
            C VC K+VYPME L+A+ K FHK+CF C  CK+ LS GN+       YC PHY +LFK +G  +  D   + E+P   D  D
Sbjct:  137 CAVCKKRVYPMEGLIADKKKFHKSCFFCEHCKNKLSLGNFVSLHGHLYCQPHYKQLFKSKGNLE--DGFGQSELPGVRDTGD 216          
BLAST of SMED30008508 vs. Ensembl Zebrafish
Match: lima1a (LIM domain and actin binding 1a [Source:ZFIN;Acc:ZDB-GENE-001120-1])

HSP 1 Score: 87.4261 bits (215), Expect = 7.427e-18
Identity = 35/69 (50.72%), Postives = 44/69 (63.77%), Query Frame = -1
Query:  530 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 736
            +   C  C K VYP+EKLVAN + +H TCFRC+ C + LS  NY+      YC PHY +LFK +G YDE
Sbjct:  242 VRETCVTCLKTVYPLEKLVANQQIYHNTCFRCAYCNTKLSLVNYASLHNNVYCKPHYCQLFKAKGNYDE 310          
BLAST of SMED30008508 vs. Ensembl Zebrafish
Match: limd2 (LIM domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-120906-1])

HSP 1 Score: 77.7962 bits (190), Expect = 4.875e-17
Identity = 38/84 (45.24%), Postives = 49/84 (58.33%), Query Frame = -1
Query:  476 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE-VDDNVEKEIPATNDINDV 724
            C  C K VYPME+LVAN+  FH  CF C  C + LS G+Y+  Q   YC PH+ +LFK +G YDE       KE+ A+ D   +
Sbjct:   27 CASCEKTVYPMERLVANNLIFHAACFCCKHCNTKLSLGSYAALQGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWASKDAESI 110          
BLAST of SMED30008508 vs. Ensembl Zebrafish
Match: mical3a (microtubule associated monooxygenase, calponin and LIM domain containing 3a [Source:NCBI gene;Acc:402881])

HSP 1 Score: 66.2402 bits (160), Expect = 6.426e-11
Identity = 24/55 (43.64%), Postives = 35/55 (63.64%), Query Frame = -1
Query:  566 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQ--RPYCTPHY 724
            C  C K+VY ME+L A  K FH++CF+C  C + L   +Y+F+ +  + YC PHY
Sbjct:  774 CFFCRKRVYVMERLSAEGKFFHRSCFKCDYCGTTLRLSSYAFDVEDGKFYCKPHY 828          
BLAST of SMED30008508 vs. Ensembl Xenopus
Match: ENSXETT00000049904.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:64558417:64561350:-1 gene:ENSXETG00000020789.1 transcript:ENSXETT00000049904.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.141e-19
Identity = 35/65 (53.85%), Postives = 45/65 (69.23%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C +C KKVYPME LVA+ + FH +CFRCS C + LS GNY+    + YC  H+ +LFK +G YDE
Sbjct:   10 CIICQKKVYPMECLVADKQIFHNSCFRCSHCSNKLSLGNYASLHGQIYCKAHFKQLFKSKGNYDE 74          
BLAST of SMED30008508 vs. Ensembl Xenopus
Match: lima1 (LIM domain and actin binding 1 [Source:NCBI gene;Acc:779798])

HSP 1 Score: 85.1149 bits (209), Expect = 7.077e-17
Identity = 43/111 (38.74%), Postives = 57/111 (51.35%), Query Frame = -1
Query:  530 EISQKTNEPSYSP----------TKGKDVKSLSTAYGREENLINVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 832
            EI + ++ P YSP          +  K VK       RE       C  C K VYPME+L AN++ +H  CFRCS C + LS G ++      YC PH+ +LFK +G YDE
Sbjct:  317 EIQRSSSSPDYSPQSRVLNTMEPSPPKSVKKFQLP-ARE------VCFSCQKTVYPMERLFANNQVYHNGCFRCSHCSTKLSLGTFASLHGTVYCKPHFNQLFKSKGNYDE 420          
BLAST of SMED30008508 vs. Ensembl Xenopus
Match: limd2 (uncharacterized loc100145002 [Source:Xenbase;Acc:XB-GENE-5749128])

HSP 1 Score: 76.6406 bits (187), Expect = 8.507e-16
Identity = 32/65 (49.23%), Postives = 40/65 (61.54%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C  C K VYPME+LVA+   FH +CF C  C + LS G Y+      YC PH+ +LFK +G YDE
Sbjct:   88 CSSCQKTVYPMERLVADKHIFHNSCFCCKHCSAKLSLGTYAALHGEFYCKPHFQQLFKSKGNYDE 152          
BLAST of SMED30008508 vs. Ensembl Xenopus
Match: lasp1 (LIM and SH3 protein 1 [Source:NCBI gene;Acc:493322])

HSP 1 Score: 62.003 bits (149), Expect = 3.315e-10
Identity = 26/57 (45.61%), Postives = 33/57 (57.89%), Query Frame = -1
Query:  566 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHY 736
            +N +C  C K VYP EK+   DK +HK CF C  CK  L+  NY    ++PYC  HY
Sbjct:    1 MNPSCARCGKIVYPTEKVNCLDKFWHKACFHCEICKMTLNMKNYKGYDKKPYCNAHY 57          
BLAST of SMED30008508 vs. Ensembl Xenopus
Match: ENSXETT00000052352.1 (nebulette [Source:NCBI gene;Acc:100496676])

HSP 1 Score: 60.4622 bits (145), Expect = 1.299e-9
Identity = 25/57 (43.86%), Postives = 33/57 (57.89%), Query Frame = -1
Query:  566 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHY 736
            +N  C  C + VYP EK+   DK +HK CF+C  CK  L+  NY    ++PYC  HY
Sbjct:    1 MNPQCARCGRVVYPTEKVNCLDKFWHKGCFQCEVCKMTLNMNNYKGYDKKPYCNAHY 57          
BLAST of SMED30008508 vs. Ensembl Mouse
Match: Xirp2 (xin actin-binding repeat containing 2 [Source:MGI Symbol;Acc:MGI:2685198])

HSP 1 Score: 94.7449 bits (234), Expect = 7.858e-20
Identity = 39/82 (47.56%), Postives = 52/82 (63.41%), Query Frame = -1
Query:  530 LSTAYGREENLINVN--CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 769
            +S A+  E   ++    C +C K VYPME L+A+ + FHK+CFRC  C S LS GNY+    R YC PH+ +LFK +G YDE
Sbjct: 3240 MSRAFQEESAFLSDKEICIICQKTVYPMECLIADKQNFHKSCFRCHHCSSKLSLGNYASLHGRIYCKPHFKQLFKSKGNYDE 3321          
BLAST of SMED30008508 vs. Ensembl Mouse
Match: Xirp2 (xin actin-binding repeat containing 2 [Source:MGI Symbol;Acc:MGI:2685198])

HSP 1 Score: 92.4337 bits (228), Expect = 2.887e-19
Identity = 36/65 (55.38%), Postives = 45/65 (69.23%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C +C K VYPME L+A+ + FHK+CFRC  C S LS GNY+    R YC PH+ +LFK +G YDE
Sbjct:  174 CIICQKTVYPMECLIADKQNFHKSCFRCHHCSSKLSLGNYASLHGRIYCKPHFKQLFKSKGNYDE 238          
BLAST of SMED30008508 vs. Ensembl Mouse
Match: Xirp2 (xin actin-binding repeat containing 2 [Source:MGI Symbol;Acc:MGI:2685198])

HSP 1 Score: 92.4337 bits (228), Expect = 3.139e-19
Identity = 36/65 (55.38%), Postives = 45/65 (69.23%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C +C K VYPME L+A+ + FHK+CFRC  C S LS GNY+    R YC PH+ +LFK +G YDE
Sbjct:  403 CIICQKTVYPMECLIADKQNFHKSCFRCHHCSSKLSLGNYASLHGRIYCKPHFKQLFKSKGNYDE 467          
BLAST of SMED30008508 vs. Ensembl Mouse
Match: Lima1 (LIM domain and actin binding 1 [Source:MGI Symbol;Acc:MGI:1920992])

HSP 1 Score: 88.9669 bits (219), Expect = 2.586e-18
Identity = 35/66 (53.03%), Postives = 45/66 (68.18%), Query Frame = -1
Query:  530 NCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 727
            +C  C K VYPME+L+AN + FH +CFRCS C + LS G Y+    R YC PH+ +LFK +G YDE
Sbjct:  227 SCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDE 292          
BLAST of SMED30008508 vs. Ensembl Mouse
Match: Lima1 (LIM domain and actin binding 1 [Source:MGI Symbol;Acc:MGI:1920992])

HSP 1 Score: 88.9669 bits (219), Expect = 3.108e-18
Identity = 35/66 (53.03%), Postives = 45/66 (68.18%), Query Frame = -1
Query:  530 NCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 727
            +C  C K VYPME+L+AN + FH +CFRCS C + LS G Y+    R YC PH+ +LFK +G YDE
Sbjct:  387 SCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDE 452          
BLAST of SMED30008508 vs. UniProt/SwissProt
Match: sp|Q4U4S6|XIRP2_MOUSE (Xin actin-binding repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Xirp2 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.497e-19
Identity = 39/82 (47.56%), Postives = 52/82 (63.41%), Query Frame = -1
Query:  530 LSTAYGREENLINVN--CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 769
            +S A+  E   ++    C +C K VYPME L+A+ + FHK+CFRC  C S LS GNY+    R YC PH+ +LFK +G YDE
Sbjct: 3240 MSRAFQEESAFLSDKEICIICQKTVYPMECLIADKQNFHKSCFRCHHCSSKLSLGNYASLHGRIYCKPHFKQLFKSKGNYDE 3321          
BLAST of SMED30008508 vs. UniProt/SwissProt
Match: sp|Q9UHB6|LIMA1_HUMAN (LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.155e-17
Identity = 35/65 (53.85%), Postives = 44/65 (67.69%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C  C K VYPME+L+AN + FH +CFRCS C + LS G Y+    R YC PH+ +LFK +G YDE
Sbjct:  390 CVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDE 454          
BLAST of SMED30008508 vs. UniProt/SwissProt
Match: sp|F1LR10|LIMA1_RAT (LIM domain and actin-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Lima1 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 1.350e-17
Identity = 65/181 (35.91%), Postives = 90/181 (49.72%), Query Frame = -1
Query:  530 SITDEKIMNENITNVQENLEDNKQASEDCEIKSETTNVEV--NIVDDEKVVEDTEAIENQPDNEACEIQQEIINSTKEIS---QKTNEPSYSPTKGKDVKSLSTAYGREENLINVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 1057
            S   E   +E+ T+  E  E+     E C I  E + V    N +    V  + +   +Q  +EA   QQ I   TK +S   + ++ P  SP+K    K    A  RE      +C  C K VYPME+L+AN + FH +CFRCS C + LS G Y+    R YC PH+ +LFK +G YDE
Sbjct:  286 SYASELKPSESKTHKWEQKENVPPGPEACSIHQEGSKVSATENSLVAHPVPAEDDTCNSQGRSEA---QQPIY--TKPLSPDARTSSLPESSPSK--TAKKFQ-APARE------SCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDE 452          
BLAST of SMED30008508 vs. UniProt/SwissProt
Match: sp|B0KYV5|LIMA1_PIG (LIM domain and actin-binding protein 1 OS=Sus scrofa OX=9823 GN=LIMA1 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.104e-17
Identity = 35/65 (53.85%), Postives = 44/65 (67.69%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C  C K VYPME+L+AN + FH +CFRCS C + LS G Y+    R YC PH+ +LFK +G YDE
Sbjct:  386 CVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDE 450          
BLAST of SMED30008508 vs. UniProt/SwissProt
Match: sp|Q9ERG0|LIMA1_MOUSE (LIM domain and actin-binding protein 1 OS=Mus musculus OX=10090 GN=Lima1 PE=1 SV=3)

HSP 1 Score: 88.9669 bits (219), Expect = 2.174e-17
Identity = 35/66 (53.03%), Postives = 45/66 (68.18%), Query Frame = -1
Query:  530 NCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 727
            +C  C K VYPME+L+AN + FH +CFRCS C + LS G Y+    R YC PH+ +LFK +G YDE
Sbjct:  387 SCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDE 452          
BLAST of SMED30008508 vs. TrEMBL
Match: A0A4W4F0Q6 (LIM zinc-binding domain-containing protein OS=Electrophorus electricus OX=8005 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 5.247e-20
Identity = 38/65 (58.46%), Postives = 47/65 (72.31%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C VC K+VYPME L+A+ + FHK+CFRC+ C S LS GNY+    R YC PHY +LFK +G YDE
Sbjct:   30 CRVCRKRVYPMESLIADKQNFHKSCFRCAHCNSQLSLGNYASLHGRMYCKPHYKQLFKSKGNYDE 94          
BLAST of SMED30008508 vs. TrEMBL
Match: Q4S320 (Chromosome 3 SCAF14756, whole genome shotgun sequence (Fragment) OS=Tetraodon nigroviridis OX=99883 GN=GSTENG00024832001 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.433e-19
Identity = 37/65 (56.92%), Postives = 46/65 (70.77%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C  C K+VYPME L+A+ ++FHK+CFRC  CK  LS GNY+    R YC PHY +LFK +G YDE
Sbjct:    9 CRACRKRVYPMELLIADKQSFHKSCFRCEHCKGKLSLGNYASLHGRMYCKPHYKQLFKSKGNYDE 73          
BLAST of SMED30008508 vs. TrEMBL
Match: F8W3Z4 (Xin actin-binding repeat-containing 2a OS=Danio rerio OX=7955 GN=xirp2a PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.489e-19
Identity = 43/84 (51.19%), Postives = 55/84 (65.48%), Query Frame = -1
Query:  476 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE-VDDNVEKEIPATNDINDV 724
            C VC K+VYPME L+A+ + FHKTCFRC+ C S LS G Y+    R YC PHY +LFK +G YDE   +   KE  +T D N++
Sbjct:  266 CQVCRKRVYPMESLIADKQNFHKTCFRCAHCNSQLSLGTYASLHGRMYCKPHYKQLFKSKGNYDEGFGERPHKEHWSTKDQNNI 349          
BLAST of SMED30008508 vs. TrEMBL
Match: A0A267EUL3 (LIM zinc-binding domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011398g1 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 5.092e-19
Identity = 67/219 (30.59%), Postives = 105/219 (47.95%), Query Frame = -1
Query:  116 NCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRY--------------DEVDDNVEKEIPATNDINDVLTDELPAPDTTKKIVAKFQNFETGNTSSINQNANVDSVDELPAPNTTKILMEKFSAIQQDNSEGKCKPQIDIPRHSNGHSNGTSENVPVVLPTDVVRAND-PSQDNRPEQGITKNLVNRFH 727
            +C +C+ +VYPME+L ++ + +HK+C+RC KCK  LS GN++    R YC PHYIELF+ +G Y                 D++VE     +ND   V             I ++F++FE    +S ++         L    + +   E  ++ ++     K K +   PR     S G  E+ P  LP DVVR  D    D+RP  G ++N++ RF 
Sbjct:   18 SCKMCHGRVYPMERLTSDGQVYHKSCYRCYKCKRQLSVGNFAIMDDRLYCQPHYIELFRLKGSYRFHDSAGVPVNSIAGSGDESVENGG-GSNDSGHV--------PKLSNIKSRFESFEEQPPASPSKRKEKVYYAGL---QSARHRYETATSEKERPHSEKPK-RFTPPREG---SAGVVESQPQELPPDVVRCYDNGDSDDRPAPGSSRNVLARFR 220          
BLAST of SMED30008508 vs. TrEMBL
Match: A0A267G033 (LIM zinc-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024286g1 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 9.515e-19
Identity = 67/219 (30.59%), Postives = 105/219 (47.95%), Query Frame = -1
Query:  116 NCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRY--------------DEVDDNVEKEIPATNDINDVLTDELPAPDTTKKIVAKFQNFETGNTSSINQNANVDSVDELPAPNTTKILMEKFSAIQQDNSEGKCKPQIDIPRHSNGHSNGTSENVPVVLPTDVVRAND-PSQDNRPEQGITKNLVNRFH 727
            +C +C+ +VYPME+L ++ + +HK+C+RC KCK  LS GN++    R YC PHYIELF+ +G Y                 D++VE     +ND   V             I ++F++FE    +S ++         L    + +   E  ++ ++     K K +   PR     S G  E+ P  LP DVVR  D    D+RP  G ++N++ RF 
Sbjct:  107 SCKMCHGRVYPMERLTSDGQVYHKSCYRCYKCKRQLSVGNFAIMDDRLYCQPHYIELFRLKGSYRFHDSAGVPVNSIAGSGDESVENGG-GSNDSGHV--------PKLSNIKSRFESFEEQPPASPSKRKEKVYYAGL---QSARHRYETATSEKERPHSEKPK-RFTPPREG---SAGVVESQPQELPPDVVRCYDNGDSDDRPAPGSSRNVLARFR 309          
BLAST of SMED30008508 vs. Ensembl Cavefish
Match: limd2 (LIM domain containing 2 [Source:NCBI gene;Acc:103034267])

HSP 1 Score: 80.1073 bits (196), Expect = 7.795e-18
Identity = 39/84 (46.43%), Postives = 48/84 (57.14%), Query Frame = -1
Query:  476 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE-VDDNVEKEIPATNDINDV 724
            C  C K VYPME+LVAN+  FH  CF C  C + LS G Y+  Q   YC PHY +LFK +G YDE       KE+ A+ D   +
Sbjct:   27 CAACQKTVYPMERLVANNLIFHTVCFCCKHCNAKLSLGTYAALQGEFYCKPHYQQLFKSKGNYDEGFGRKQHKELWASKDAESI 110          
BLAST of SMED30008508 vs. Ensembl Cavefish
Match: lima1a (LIM domain and actin binding 1a [Source:ZFIN;Acc:ZDB-GENE-001120-1])

HSP 1 Score: 87.0409 bits (214), Expect = 9.796e-18
Identity = 33/69 (47.83%), Postives = 46/69 (66.67%), Query Frame = -1
Query:  530 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 736
            +  +C +C K VYP+E+LVAN + +H TCFRC+ C + LS  NY+      YC PH+ +LFK +G YDE
Sbjct:  309 VRESCVMCLKTVYPLERLVANQQIYHNTCFRCAHCNTKLSLVNYASLHSTVYCKPHFCQLFKAKGNYDE 377          
BLAST of SMED30008508 vs. Ensembl Cavefish
Match: ENSAMXT00000032509.1 (uncharacterized LOC103022480 [Source:NCBI gene;Acc:103022480])

HSP 1 Score: 80.4925 bits (197), Expect = 1.885e-15
Identity = 40/99 (40.40%), Postives = 52/99 (52.53%), Query Frame = -1
Query:  530 YSPTKGKDVKSLSTAY----GREENLIN----VNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 802
            YS      VK+ S  Y    G EE   +    V C  C   VYPME++VA++   H +CF C  C++ LS  NYS      YC  HY +LFK++G YDE
Sbjct:   57 YSSASISSVKTRSALYMSKVGAEEAFRSSTQTVMCYACETPVYPMERIVADEHVLHTSCFCCKHCRTKLSLHNYSSLYGEFYCVSHYQQLFKRKGNYDE 155          
BLAST of SMED30008508 vs. Ensembl Cavefish
Match: ENSAMXT00000001570.2 (uncharacterized LOC103022480 [Source:NCBI gene;Acc:103022480])

HSP 1 Score: 79.7221 bits (195), Expect = 3.237e-15
Identity = 40/99 (40.40%), Postives = 52/99 (52.53%), Query Frame = -1
Query:  530 YSPTKGKDVKSLSTAY----GREENLIN----VNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 802
            YS      VK+ S  Y    G EE   +    V C  C   VYPME++VA++   H +CF C  C++ LS  NYS      YC  HY +LFK++G YDE
Sbjct:  288 YSSASISSVKTRSALYMSKVGAEEAFRSSTQTVMCYACETPVYPMERIVADEHVLHTSCFCCKHCRTKLSLHNYSSLYGEFYCVSHYQQLFKRKGNYDE 386          
BLAST of SMED30008508 vs. Ensembl Cavefish
Match: ENSAMXT00000002215.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:23527930:23529000:-1 gene:ENSAMXG00000002170.2 transcript:ENSAMXT00000002215.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 4.669e-12
Identity = 27/55 (49.09%), Postives = 34/55 (61.82%), Query Frame = -1
Query:  530 MEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 694
            MEK+ A+   FHK+CF C  CK  LS  NY+      YC  HY +LF+K+G YDE
Sbjct:    1 MEKMTADKFIFHKSCFCCKHCKQKLSLRNYAPLYGEFYCVFHYQQLFRKKGNYDE 55          
BLAST of SMED30008508 vs. Ensembl Sea Lamprey
Match: mical3b (Danio rerio microtubule associated monooxygenase, calponin and LIM domain containing 3b (mical3b), mRNA. [Source:RefSeq mRNA;Acc:NM_001353875])

HSP 1 Score: 64.3142 bits (155), Expect = 3.821e-11
Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = -1
Query:  566 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQ--RPYCTPHY 724
            C  C ++VY ME+L A  K FH+ CF+C+ C   L  G ++F+ +  + YC PHY
Sbjct:  761 CYFCGRRVYVMERLSAEGKFFHRGCFKCNYCDVTLRLGAFAFDVEDGKFYCKPHY 815          
BLAST of SMED30008508 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005882.1 (pep scaffold:Pmarinus_7.0:GL476535:329859:333216:1 gene:ENSPMAG00000005319.1 transcript:ENSPMAT00000005882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.331e-9
Identity = 23/56 (41.07%), Postives = 34/56 (60.71%), Query Frame = -1
Query:  569 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPH 736
            +N  C  C   VYP+EKL    +T+HK CF C +C++ L+  N+   ++RPYC  H
Sbjct:    1 MNKPCARCQHPVYPLEKLDCLGQTWHKMCFYCEECETVLTVNNFKSFEKRPYCHAH 56          
BLAST of SMED30008508 vs. Ensembl Sea Lamprey
Match: csrp2 (cysteine and glycine-rich protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1863])

HSP 1 Score: 48.521 bits (114), Expect = 7.858e-7
Identity = 22/58 (37.93%), Postives = 30/58 (51.72%), Query Frame = -1
Query:  542 CNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRG 715
            C K VY  EK+V   K +HK+CFRC+KC   L +   +      YC   Y + F  +G
Sbjct:  122 CTKPVYAAEKIVGAGKPWHKSCFRCAKCGKGLESTTVTDRDGELYCKGCYAKYFGPKG 179          
BLAST of SMED30008508 vs. Ensembl Sea Lamprey
Match: nebl (nebulette [Source:ZFIN;Acc:ZDB-GENE-050320-151])

HSP 1 Score: 46.9802 bits (110), Expect = 4.380e-6
Identity = 18/35 (51.43%), Postives = 22/35 (62.86%), Query Frame = -1
Query:  566 KTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHY 670
            +T+HK CF C  CK AL+  NY    +RPYC  HY
Sbjct:    4 QTWHKACFHCEVCKMALNMKNYKGYDKRPYCNMHY 38          
BLAST of SMED30008508 vs. Ensembl Nematostella
Match: EDO50008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF11])

HSP 1 Score: 85.1149 bits (209), Expect = 4.294e-20
Identity = 35/65 (53.85%), Postives = 47/65 (72.31%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C VCNK VYPME+L A+ K +HK CF+C++C + L  GNY+  Q + YC PH+ +LFK +G YDE
Sbjct:   22 CEVCNKTVYPMERLAADKKVYHKFCFKCNECNNTLRLGNYAALQGKVYCKPHFKQLFKVKGNYDE 86          
BLAST of SMED30008508 vs. Ensembl Nematostella
Match: EDO47999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ7])

HSP 1 Score: 67.3958 bits (163), Expect = 6.970e-12
Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = -1
Query:  599 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSF 736
            +   C +C ++VY ME+LVA  + FH+ CFRCS+C S+L  G Y+F
Sbjct:  394 LGTACLICGERVYLMERLVAERRLFHRACFRCSRCNSSLRAGTYTF 439          
BLAST of SMED30008508 vs. Ensembl Nematostella
Match: LASP1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI30])

HSP 1 Score: 62.7734 bits (151), Expect = 2.615e-11
Identity = 26/57 (45.61%), Postives = 32/57 (56.14%), Query Frame = -1
Query:  566 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHY 736
            +N  C  C K VYP+EKL   DK +HK CF+C  C   L+   Y   Q+ PYC  HY
Sbjct:    1 MNPPCARCRKTVYPVEKLSCLDKVWHKGCFKCESCGMTLNMKTYKGYQKLPYCDAHY 57          
BLAST of SMED30008508 vs. Ensembl Nematostella
Match: EDO32617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUJ8])

HSP 1 Score: 58.5362 bits (140), Expect = 3.671e-11
Identity = 25/62 (40.32%), Postives = 38/62 (61.29%), Query Frame = -1
Query:  542 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCT-PHYIELFKKRG 724
            C  C K+VY  EK+ +  K +H+ C RC KCK  L+ G+++ ++ +PYC  P Y  LF  +G
Sbjct:    4 CPSCAKEVYFAEKVTSLGKDWHRACLRCEKCKKTLTCGSHAQHEGKPYCNIPCYSALFGPKG 65          
BLAST of SMED30008508 vs. Ensembl Nematostella
Match: LASP3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI32])

HSP 1 Score: 61.6178 bits (148), Expect = 6.629e-11
Identity = 28/57 (49.12%), Postives = 32/57 (56.14%), Query Frame = -1
Query:  566 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHY 736
            +N  C  C K VY  EKL   DK +HKTCFRC  C  AL+  NY    + PYC  HY
Sbjct:    1 MNPQCTKCAKTVYSQEKLNCLDKIWHKTCFRCVVCNMALNMKNYKGYNKNPYCNAHY 57          
BLAST of SMED30008508 vs. Ensembl Medaka
Match: limd2 (LIM domain containing 2 [Source:NCBI gene;Acc:101173786])

HSP 1 Score: 83.5741 bits (205), Expect = 2.124e-18
Identity = 37/84 (44.05%), Postives = 52/84 (61.90%), Query Frame = -1
Query:  476 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE-VDDNVEKEIPATNDINDV 724
            C  C K VYPME+LVAND+ FH +CF C  C + LS G ++  Q   YC PH+ +LFK +G YDE       KE+ A+ + +++
Sbjct:   94 CTSCEKTVYPMERLVANDQVFHLSCFCCKHCNAKLSLGTFAALQGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWASKETDNI 177          
BLAST of SMED30008508 vs. Ensembl Medaka
Match: limd2 (LIM domain containing 2 [Source:NCBI gene;Acc:101173786])

HSP 1 Score: 83.1889 bits (204), Expect = 2.259e-18
Identity = 37/84 (44.05%), Postives = 52/84 (61.90%), Query Frame = -1
Query:  476 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE-VDDNVEKEIPATNDINDV 724
            C  C K VYPME+LVAND+ FH +CF C  C + LS G ++  Q   YC PH+ +LFK +G YDE       KE+ A+ + +++
Sbjct:   79 CTSCEKTVYPMERLVANDQVFHLSCFCCKHCNAKLSLGTFAALQGEFYCKPHFQQLFKSKGNYDEGFGRKQHKELWASKETDNI 162          
BLAST of SMED30008508 vs. Ensembl Medaka
Match: lima1a (LIM domain and actin-binding protein 1 [Source:NCBI gene;Acc:101156656])

HSP 1 Score: 86.2705 bits (212), Expect = 1.632e-17
Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C  C K VYP+E+LVAN   +H +CFRCS C + LS  NY+      YC PH+ +LFK +G YDE
Sbjct:  271 CVTCQKTVYPLERLVANQHVYHSSCFRCSHCNTKLSLVNYASLHNVVYCKPHFCQLFKAKGNYDE 335          
BLAST of SMED30008508 vs. Ensembl Medaka
Match: lima1a (LIM domain and actin-binding protein 1 [Source:NCBI gene;Acc:101156656])

HSP 1 Score: 86.2705 bits (212), Expect = 1.746e-17
Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C  C K VYP+E+LVAN   +H +CFRCS C + LS  NY+      YC PH+ +LFK +G YDE
Sbjct:  294 CVTCQKTVYPLERLVANQHVYHSSCFRCSHCNTKLSLVNYASLHNVVYCKPHFCQLFKAKGNYDE 358          
BLAST of SMED30008508 vs. Ensembl Medaka
Match: lima1a (LIM domain and actin-binding protein 1 [Source:NCBI gene;Acc:101156656])

HSP 1 Score: 86.2705 bits (212), Expect = 2.122e-17
Identity = 33/65 (50.77%), Postives = 42/65 (64.62%), Query Frame = -1
Query:  530 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDE 724
            C  C K VYP+E+LVAN   +H +CFRCS C + LS  NY+      YC PH+ +LFK +G YDE
Sbjct:  356 CVTCQKTVYPLERLVANQHVYHSSCFRCSHCNTKLSLVNYASLHNVVYCKPHFCQLFKAKGNYDE 420          
BLAST of SMED30008508 vs. Planmine SMEST
Match: SMESG000044487.1 (SMESG000044487.1)

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 331/413 (80.15%), Postives = 338/413 (81.84%), Query Frame = -1
Query:   92 MSGIESNLVLEDEHISNDVVNENS-----ITDEKIMN-------------------------------ENI---------------------TNVQENLEDN-----------KQASEDCEIKSETTNVEVNIVDDEKVVEDTEAIENQPDNEACEIQQEIINSTKEISQKTNEPSYSPTKGKDVKSLSTAYGREENLINVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDEVDDNVEKEIPATNDINDVLTDELPAPDTTKKIVAKFQNFETGNTSSINQNANVDSVDELPAPNTTKILMEKFSAIQQDNSEGKCKPQIDIPRHSNGHSNGTSENVPVVLPTDVVRANDPSQDNRPEQGITKNLVNRFHGMGGSLNN 1126
            MS IESNLVLEDEHISNDVVNENS     I +E I N                               EN+                     TNV+ N+ D+           KQASED EIKSETTNV++NIVDDEKVVEDTEAIENQPDNEACEIQQEIINSTKEISQKTNEPSYSPTKGKDVKSLSTAYGREENLINVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDEVDDNVEKEIPATNDINDVLTDELPAPDTTKKIVAKFQNFETGNTSSINQNANVDSVDELPAPNTTKILMEKFSAIQQDNSEGKCKPQIDIPRHSNGHSNGTSENVPVVLPTDVVRANDPSQDNRPEQGITKNLVNRFHGMGGSLNN
Sbjct:    1 MSEIESNLVLEDEHISNDVVNENSITDEKIMNENITNVQENLEDNKQASEDCEIKSETTNVEVNIVDDENVVEDTEAIEKQASEDYEIKSETTNVEVNIVDDENVVEDTEAIEKQASEDYEIKSETTNVDLNIVDDEKVVEDTEAIENQPDNEACEIQQEIINSTKEISQKTNEPSYSPTKGKDVKSLSTAYGREENLINVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDEVDDNVEKEIPATNDINDVLTDELPAPDTTKKIVAKFQNFETGNTSSINQNANVDSVDELPAPNTTKILMEKFSAIQQDNSEGKCKPQIDIPRHSNGHSNGTSENVPVVLPTDVVRANDPSQDNRPEQGITKNLVNRFHGMGGSLNN 413          
BLAST of SMED30008508 vs. Planmine SMEST
Match: SMESG000001219.1 (SMESG000001219.1)

HSP 1 Score: 119.398 bits (298), Expect = 6.488e-30
Identity = 78/240 (32.50%), Postives = 122/240 (50.83%), Query Frame = -1
Query:  107 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDEVDDNVEKEIPATNDI---NDVLTDELPAPDTTKKIVAKFQNFETGNT---SSINQNAN------------VDSVD----ELPAPNTTKILMEKFSA------------IQQDNSEGKCKPQIDIPRHSNGHSNGTSENVPVVLPTDVVRANDPSQDNRPEQGITKNLVNRFHGMG 724
            C +C  K+YPMEKL  + + +HK CFRCSKCK+ LS  N++ +    YC  H++ELFK RG+YD+V       I   N+I   N+  T+ +P+ D TK ++ KF+  E+G+    SS+++N+N            V S D    ELP P T K ++ +F A            +QQ  S+ K     +   +   H++ T  N         +R +    +  PE+G T+NL+N+F  + 
Sbjct:   92 CLICESKIYPMEKLTVDGRLYHKGCFRCSKCKTVLSVTNFNLSNNSIYCKIHFMELFKIRGKYDDV-------ISIGNEIVSQNEEPTETIPSTD-TKSLLEKFRQLESGSVSYQSSLSKNSNNTVRYVKPTDDVVRSQDIQQEELPPPETAKAMVARFQAMESKKNIPSPERVQQMQSQAKVNSTTNA--NIRFHNSSTQPN--------PIRDSFNETEELPEEGTTRNLLNKFQNLS 313          
BLAST of SMED30008508 vs. Planmine SMEST
Match: SMESG000026096.1 (SMESG000026096.1)

HSP 1 Score: 104.76 bits (260), Expect = 9.443e-24
Identity = 77/253 (30.43%), Postives = 111/253 (43.87%), Query Frame = -1
Query:   95 NCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDEV--DDNVEKEIPATN--DINDVLT--------DELPAPDTTKKIVAKFQNFET------------------------------GNTSSINQNANVDSVDELPAPNTTKILMEKFSAIQQDNSEGKCKPQIDIPRHSNGHSNGTSENVPVVLPTDVVRANDPSQDNRPEQGITKNLVNRFHGMGGSLN 727
            NC  C +KVY  EKLV ++  +H+ CF+C KC+  LS  N++ N  R YC PH++ELF++ G+Y+E     N +    +TN   IN+  T        DELP P  T+ IV KF+  E+                               N  + N  A+ D  DE P P  TK L+  +S  +   S+         P+  N   N + +        D+VR ND  +D  P     K+L  +F G    LN
Sbjct:  204 NCTSCGEKVYITEKLVIDNLLYHRQCFKCMKCRRILSMNNFASNSGRLYCKPHFLELFRQSGKYNEFHQQSNQDSNSISTNYDKINENGTAGTGNTQEDELPPPQITRNIVEKFRLLESNLSADSLLPRQLSSGQHNVKCYQSTNAVLDNNHHTYNDKAD-DVTDEFPTPGITKNLLSLWSNFE---SKSLYSSASGTPKKVN--KNNSPKASVSFQSFDIVRHNDSVEDRYPAPNTAKSLAAKFKGEAPMLN 450          
BLAST of SMED30008508 vs. Planmine SMEST
Match: SMESG000040062.1 (SMESG000040062.1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.615e-15
Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = -1
Query:  527 CCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDEV 724
            C VC K VYPMEK+  + K +HK CFRC  C+  LS    +  +   +C PHYIE F+ RG+YD++
Sbjct:  160 CDVCQKTVYPMEKVSMDSKLYHKNCFRCCVCQKMLSPTVVTKFKDNLFCKPHYIEKFRIRGKYDDI 225          
BLAST of SMED30008508 vs. Planmine SMEST
Match: SMESG000002154.1 (SMESG000002154.1)

HSP 1 Score: 65.855 bits (159), Expect = 4.541e-12
Identity = 27/57 (47.37%), Postives = 36/57 (63.16%), Query Frame = -1
Query:  566 INVNCCVCNKKVYPMEKLVANDKTFHKTCFRCSKCKSALSTGNYSFNQQRPYCTPHY 736
            +N  C  CNK VYP+EKL   DK +HK CF+C++C   L+  NY    + PYC+ HY
Sbjct:    1 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHY 57          
The following BLAST results are available for this feature:
BLAST of SMED30008508 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
XIRP21.925e-1929.34xin actin binding repeat containing 2 [Source:HGNC... [more]
XIRP22.050e-1929.34xin actin binding repeat containing 2 [Source:HGNC... [more]
XIRP22.171e-1929.34xin actin binding repeat containing 2 [Source:HGNC... [more]
XIRP22.846e-1929.58xin actin binding repeat containing 2 [Source:HGNC... [more]
XIRP27.738e-1955.38xin actin binding repeat containing 2 [Source:HGNC... [more]
back to top
BLAST of SMED30008508 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F42H10.33.874e-1150.00LIM and SH3 domain protein F42H10.3 [Source:UniPr... [more]
F42H10.35.144e-1150.00LIM and SH3 domain protein F42H10.3 [Source:UniPr... [more]
exc-91.399e-837.50pep chromosome:WBcel235:IV:7939812:7940818:-1 gene... [more]
exc-91.399e-837.50pep chromosome:WBcel235:IV:7939812:7941064:-1 gene... [more]
valv-15.463e-835.94pep chromosome:WBcel235:IV:7444639:7445432:-1 gene... [more]
back to top
BLAST of SMED30008508 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lasp1.328e-1044.64gene:FBgn0063485 transcript:FBtr0306152[more]
Lasp2.572e-1044.64gene:FBgn0063485 transcript:FBtr0075350[more]
Lasp3.968e-1044.64gene:FBgn0063485 transcript:FBtr0100145[more]
Lasp4.068e-1044.64gene:FBgn0063485 transcript:FBtr0306151[more]
CG335214.159e-836.62gene:FBgn0250819 transcript:FBtr0334661[more]
back to top
BLAST of SMED30008508 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
xirp2a2.006e-2251.19xin actin binding repeat containing 2a [Source:ZFI... [more]
xirp2b1.503e-1946.34xin actin binding repeat containing 2b [Source:ZFI... [more]
lima1a7.427e-1850.72LIM domain and actin binding 1a [Source:ZFIN;Acc:Z... [more]
limd24.875e-1745.24LIM domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
mical3a6.426e-1143.64microtubule associated monooxygenase, calponin and... [more]
back to top
BLAST of SMED30008508 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000049904.11.141e-1953.85pep primary_assembly:Xenopus_tropicalis_v9.1:9:645... [more]
lima17.077e-1738.74LIM domain and actin binding 1 [Source:NCBI gene;A... [more]
limd28.507e-1649.23uncharacterized loc100145002 [Source:Xenbase;Acc:X... [more]
lasp13.315e-1045.61LIM and SH3 protein 1 [Source:NCBI gene;Acc:493322... [more]
ENSXETT00000052352.11.299e-943.86nebulette [Source:NCBI gene;Acc:100496676][more]
back to top
BLAST of SMED30008508 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Xirp27.858e-2047.56xin actin-binding repeat containing 2 [Source:MGI ... [more]
Xirp22.887e-1955.38xin actin-binding repeat containing 2 [Source:MGI ... [more]
Xirp23.139e-1955.38xin actin-binding repeat containing 2 [Source:MGI ... [more]
Lima12.586e-1853.03LIM domain and actin binding 1 [Source:MGI Symbol;... [more]
Lima13.108e-1853.03LIM domain and actin binding 1 [Source:MGI Symbol;... [more]
back to top
BLAST of SMED30008508 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4U4S6|XIRP2_MOUSE5.497e-1947.56Xin actin-binding repeat-containing protein 2 OS=M... [more]
sp|Q9UHB6|LIMA1_HUMAN1.155e-1753.85LIM domain and actin-binding protein 1 OS=Homo sap... [more]
sp|F1LR10|LIMA1_RAT1.350e-1735.91LIM domain and actin-binding protein 1 OS=Rattus n... [more]
sp|B0KYV5|LIMA1_PIG2.104e-1753.85LIM domain and actin-binding protein 1 OS=Sus scro... [more]
sp|Q9ERG0|LIMA1_MOUSE2.174e-1753.03LIM domain and actin-binding protein 1 OS=Mus musc... [more]
back to top
BLAST of SMED30008508 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4W4F0Q65.247e-2058.46LIM zinc-binding domain-containing protein OS=Elec... [more]
Q4S3202.433e-1956.92Chromosome 3 SCAF14756, whole genome shotgun seque... [more]
F8W3Z44.489e-1951.19Xin actin-binding repeat-containing 2a OS=Danio re... [more]
A0A267EUL35.092e-1930.59LIM zinc-binding domain-containing protein OS=Macr... [more]
A0A267G0339.515e-1930.59LIM zinc-binding domain-containing protein (Fragme... [more]
back to top
BLAST of SMED30008508 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limd27.795e-1846.43LIM domain containing 2 [Source:NCBI gene;Acc:1030... [more]
lima1a9.796e-1847.83LIM domain and actin binding 1a [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000032509.11.885e-1540.40uncharacterized LOC103022480 [Source:NCBI gene;Acc... [more]
ENSAMXT00000001570.23.237e-1540.40uncharacterized LOC103022480 [Source:NCBI gene;Acc... [more]
ENSAMXT00000002215.24.669e-1249.09pep primary_assembly:Astyanax_mexicanus-2.0:3:2352... [more]
back to top
BLAST of SMED30008508 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mical3b3.821e-1141.82Danio rerio microtubule associated monooxygenase, ... [more]
ENSPMAT00000005882.11.331e-941.07pep scaffold:Pmarinus_7.0:GL476535:329859:333216:1... [more]
csrp27.858e-737.93cysteine and glycine-rich protein 2 [Source:ZFIN;A... [more]
nebl4.380e-651.43nebulette [Source:ZFIN;Acc:ZDB-GENE-050320-151][more]
back to top
BLAST of SMED30008508 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30008508 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO500084.294e-2053.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479996.970e-1247.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LASP12.615e-1145.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326173.671e-1140.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LASP36.629e-1149.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30008508 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limd22.124e-1844.05LIM domain containing 2 [Source:NCBI gene;Acc:1011... [more]
limd22.259e-1844.05LIM domain containing 2 [Source:NCBI gene;Acc:1011... [more]
lima1a1.632e-1750.77LIM domain and actin-binding protein 1 [Source:NCB... [more]
lima1a1.746e-1750.77LIM domain and actin-binding protein 1 [Source:NCB... [more]
lima1a2.122e-1750.77LIM domain and actin-binding protein 1 [Source:NCB... [more]
back to top
BLAST of SMED30008508 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044487.10.000e+080.15SMESG000044487.1[more]
SMESG000001219.16.488e-3032.50SMESG000001219.1[more]
SMESG000026096.19.443e-2430.43SMESG000026096.1[more]
SMESG000040062.17.615e-1546.97SMESG000040062.1[more]
SMESG000002154.14.541e-1247.37SMESG000002154.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008508 ID=SMED30008508|Name=SMED30008508|organism=Schmidtea mediterranea sexual|type=transcript|length=1495bp
TTTTTTTGAAAAAAATCAAAAATTTAATTCGAAAATGTAGCTGAAATAAT
TAGAACTATTAAGTCATGACATGAAATGACGTGGAGCATCAATTATTTAA
GGAACCGCCCATTCCATGGAATCTGTTCACCAGGTTTTTCGTAATTCCCT
GTTCAGGCCTGTTATCTTGACTTGGATCATTTGCTCGAACAACATCAGTA
GGAAGTACAACTGGTACATTTTCCGAAGTTCCATTTGAATGCCCATTAGA
ATGTCGAGGAATATCAATTTGTGGCTTGCATTTTCCTTCAGAATTATCTT
GCTGAATAGCTGAAAATTTTTCCATCAGAATTTTGGTGGTATTTGGAGCA
GGCAATTCATCAACGGAATCAACATTGGCATTTTGATTAATACTACTTGT
GTTACCAGTCTCAAAATTTTGAAATTTAGCTACTATTTTCTTCGTCGTAT
CTGGTGCCGGTAATTCGTCTGTCAAGACATCGTTGATATCATTCGTTGCT
GGAATTTCTTTTTCAACATTGTCATCGACTTCATCATATCTTCCTCGTTT
TTTAAACAGCTCAATATAATGCGGAGTACAATATGGGCGCTGTTGATTGA
AGCTATAGTTACCGGTCGATAAAGCACTTTTGCACTTTGAACAACGGAAA
CACGTCTTGTGGAATGTTTTGTCATTGGCAACCAATTTTTCCATCGGATA
AACTTTTTTATTACAGACACAACAGTTTACATTAATCAAGTTTTCCTCTC
GACCATATGCAGTTGATAATGATTTGACGTCCTTGCCTTTTGTTGGTGAA
TAAGACGGTTCATTTGTTTTCTGTGAAATTTCTTTTGTGGAATTAATGAT
TTCTTGTTGAATTTCGCAGGCTTCATTATCTGGCTGATTTTCAATAGCTT
CGGTATCTTCAACAACTTTTTCATCATCTACTATATTTACTTCAACATTT
GTAGTTTCAGATTTAATTTCACAATCTTCAGAAGCTTGTTTATTATCTTC
TAAATTTTCCTGGACATTTGTAATATTTTCATTCATTATTTTCTCATCAG
TAATACTATTTTCATTAACTACATCATTTGAAATGTGTTCATCTTCTAAT
ACCAAATTTGATTCAATTCCACTCATAACTTCATGTACTAATTCATTTGA
TGTAGCATTTATTTCTTCATAATTTGAAATATCAATGCATTCGGAATTCT
CTGCTATTTCATCAGCAATGTTTCTGGATATGTCATTTTCATTCATTGTA
TTTTCATCGTTTTGATTTGAATTTAAATCACTATCACCAGGTTGAATTTC
ACTGAGTACTTCTTCCTGAGCTTTAGGTGCAAAGCTCTCAACATATTCCT
CTTCACATGCATCATCGATGTGCCGAATAGCTTCTGATTCCAAATTCATA
GTACTTGACATAATTTTTAATTATAAAATGAAAATTAATAACAAAAAGCT
TCTTTATTATATAAACTGAATAACTCTGGAGTTGATTTATAATTG
back to top

protein sequence of SMED30008508-orf-1

>SMED30008508-orf-1 ID=SMED30008508-orf-1|Name=SMED30008508-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=441bp
MSSTMNLESEAIRHIDDACEEEYVESFAPKAQEEVLSEIQPGDSDLNSNQ
NDENTMNENDISRNIADEIAENSECIDISNYEEINATSNELVHEVMSGIE
SNLVLEDEHISNDVVNENSITDEKIMNENITNVQENLEDNKQASEDCEIK
SETTNVEVNIVDDEKVVEDTEAIENQPDNEACEIQQEIINSTKEISQKTN
EPSYSPTKGKDVKSLSTAYGREENLINVNCCVCNKKVYPMEKLVANDKTF
HKTCFRCSKCKSALSTGNYSFNQQRPYCTPHYIELFKKRGRYDEVDDNVE
KEIPATNDINDVLTDELPAPDTTKKIVAKFQNFETGNTSSINQNANVDSV
DELPAPNTTKILMEKFSAIQQDNSEGKCKPQIDIPRHSNGHSNGTSENVP
VVLPTDVVRANDPSQDNRPEQGITKNLVNRFHGMGGSLNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 134..186
e-value: 3.0E-13
score: 60.0
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 135..190
e-value: 4.2E-12
score: 46.1
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 135..169
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 133..193
score: 13.484
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 131..199
e-value: 4.0E-20
score: 73.7
NoneNo IPR availablePANTHERPTHR24206FAMILY NOT NAMEDcoord: 93..233
NoneNo IPR availableCDDcd09358LIM_Mical_likecoord: 135..187
e-value: 8.67935E-27
score: 98.4949
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 161..200
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 134..160