SOXP-3

Overview
NameSOXP-3 (AFD29621.1)
Smed IDSMED30008505
Length (bp)1052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SOXP-3 (SMED30008505) t-SNE clustered cells

Violin plots show distribution of expression levels for SOXP-3 (SMED30008505) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SOXP-3 (SMED30008505) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SOXP-3 (SMED30008505) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008505

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 26

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30008505SMESG000051170.1 SMED30008505smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30008505SMESG000051170.1 SmedASXL_004704SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30008505SMESG000051170.1 SmedASXL_004704SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30008505SMESG000051170.1 SmedASXL_004704SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30008505SMESG000051170.1 SmedASXL_004704SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30008505SMESG000051170.1 SmedASXL_004704SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30008505SMESG000051170.1 SMED30008505smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Category 3 cellSMED30008505SMESG000051170.1 SMED30008505smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30008505SMESG000051170.1 SMED30008505smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30008505SMESG000051170.1 SMED30008505smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30008505SMESG000051170.1 dd_Smed_v4_5942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008505SMESG000051170.1 dd_Smed_v4_5942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008505SMESG000051170.1 dd_Smed_v4_5942_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008505SMESG000051170.1 Contig42468newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008505SMESG000051170.1 Contig42468uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008505SMESG000051170.1 Contig29804newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30008505SMESG000051170.1 Contig29804uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30008505SMESG000051170.1 JQ425153smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult fluorescence in situ hybridization evidence
zeta neoblastSMED30008505SMESG000051170.1 JQ425153smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30008505SMESG000051170.1 dd_Smed_v6_5942_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30008505SMESG000051170.1 dd_Smed_v4_5942_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30008505SMESG000051170.1 SMED_05061_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30008505SMESG000051170.1 SMED_05061_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30008505SMESG000051170.1 SmWIOct06_030341GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30008505SMESG000051170.1 SMED30008505smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30008505SMESG000051170.1 SMED30008505smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SOXP-3 vs. Ensembl Human
Match: SOX11 (SRY-box transcription factor 11 [Source:HGNC Symbol;Acc:HGNC:11191])

HSP 1 Score: 91.2781 bits (225), Expect = 9.085e-20
Identity = 37/73 (50.68%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S HIK PMNAFMVW+KI R+ +  Q P+  N +ISK LGK+W  +   E+ PFI EA++LR++H+  YP+++Y
Sbjct:   46 SGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKY 118          
BLAST of SOXP-3 vs. Ensembl Human
Match: SOX8 (SRY-box transcription factor 8 [Source:HGNC Symbol;Acc:HGNC:11203])

HSP 1 Score: 90.8929 bits (224), Expect = 1.216e-19
Identity = 35/77 (45.45%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            ++K   H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  +S  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   95 ALKAKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKY 171          
BLAST of SOXP-3 vs. Ensembl Human
Match: SOX9 (SRY-box transcription factor 9 [Source:HGNC Symbol;Acc:HGNC:11204])

HSP 1 Score: 91.2781 bits (225), Expect = 1.463e-19
Identity = 36/77 (46.75%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S KN  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  ++  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   98 SSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKY 174          
BLAST of SOXP-3 vs. Ensembl Human
Match: SOX14 (SRY-box transcription factor 14 [Source:HGNC Symbol;Acc:HGNC:11193])

HSP 1 Score: 87.8113 bits (216), Expect = 1.560e-19
Identity = 36/75 (48.00%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  427 KNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            K S+HIK PMNAFMVW++  R+ MA + P   N +ISK LG +W  +S  E+ P+I+EAK+LR +H+ ++P+++Y
Sbjct:    3 KPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKY 77          
BLAST of SOXP-3 vs. Ensembl Human
Match: SOX18 (SRY-box transcription factor 18 [Source:HGNC Symbol;Acc:HGNC:11194])

HSP 1 Score: 90.1225 bits (222), Expect = 1.635e-19
Identity = 36/79 (45.57%), Postives = 56/79 (70.89%), Query Frame = 1
Query:  415 KKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            ++   + + I+ PMNAFMVWAK  RK +A Q P+  N  +SK+LGK W E++A E+ PF+ EA++LR++HL  +P ++Y
Sbjct:   76 ERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHLRDHPNYKY 154          
BLAST of SOXP-3 vs. Ensembl Celegans
Match: sox-3 (SOX (Mammalian SRY box) family [Source:UniProtKB/TrEMBL;Acc:Q20201])

HSP 1 Score: 87.4261 bits (215), Expect = 4.810e-20
Identity = 42/95 (44.21%), Postives = 67/95 (70.53%), Query Frame = 1
Query:  436 NHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRYXXXXXXXXXXXXXXIKTDLASPT 720
            +H+K PMNAFMVW++  R+ MA   P   N +ISK LG +W ++S +E+ PFI+EAK+LR  H+ ++P+++Y+PRR+ K S   +  + ++A PT
Sbjct:   46 DHVKRPMNAFMVWSRGQRRKMAQDNPKMHNSEISKRLGAEWKQLSEQEKRPFIDEAKRLRALHMKEHPDYKYRPRRKPKSSNLKQQPRLNIAMPT 140          
BLAST of SOXP-3 vs. Ensembl Celegans
Match: sox-2 (Transcription factor sox-2 [Source:UniProtKB/Swiss-Prot;Acc:Q21305])

HSP 1 Score: 87.0409 bits (214), Expect = 2.406e-19
Identity = 37/79 (46.84%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  415 KKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            K   KN + +K PMNAFMVW++  RK MA + P   N +ISK LG +W  +S +E+ PFI+EAK+LR  H+ ++P+++Y
Sbjct:   51 KDGKKNDDRVKRPMNAFMVWSRGQRKKMALENPKMHNSEISKRLGTEWKMLSEQEKRPFIDEAKRLRAIHMKEHPDYKY 129          
BLAST of SOXP-3 vs. Ensembl Celegans
Match: sox-2 (Transcription factor sox-2 [Source:UniProtKB/Swiss-Prot;Acc:Q21305])

HSP 1 Score: 87.0409 bits (214), Expect = 2.406e-19
Identity = 37/79 (46.84%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  415 KKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            K   KN + +K PMNAFMVW++  RK MA + P   N +ISK LG +W  +S +E+ PFI+EAK+LR  H+ ++P+++Y
Sbjct:   51 KDGKKNDDRVKRPMNAFMVWSRGQRKKMALENPKMHNSEISKRLGTEWKMLSEQEKRPFIDEAKRLRAIHMKEHPDYKY 129          
BLAST of SOXP-3 vs. Ensembl Celegans
Match: sox-2 (Transcription factor sox-2 [Source:UniProtKB/Swiss-Prot;Acc:Q21305])

HSP 1 Score: 87.0409 bits (214), Expect = 2.406e-19
Identity = 37/79 (46.84%), Postives = 55/79 (69.62%), Query Frame = 1
Query:  415 KKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            K   KN + +K PMNAFMVW++  RK MA + P   N +ISK LG +W  +S +E+ PFI+EAK+LR  H+ ++P+++Y
Sbjct:   51 KDGKKNDDRVKRPMNAFMVWSRGQRKKMALENPKMHNSEISKRLGTEWKMLSEQEKRPFIDEAKRLRAIHMKEHPDYKY 129          
BLAST of SOXP-3 vs. Ensembl Celegans
Match: sem-2 (Transcription factor sem-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8T3B9])

HSP 1 Score: 87.8113 bits (216), Expect = 4.706e-19
Identity = 34/72 (47.22%), Postives = 53/72 (73.61%), Query Frame = 1
Query:  427 KNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPE 642
            K+SNHIK PMNAFMVW+++ R+ +    P+  N +ISK LG +W  ++ EE+ PF+ EA++LR+ H+ +YP+
Sbjct:   88 KSSNHIKRPMNAFMVWSQMERRKICEHQPDMHNAEISKQLGSRWRSLTDEEKAPFVAEAERLRVCHMQEYPD 159          
BLAST of SOXP-3 vs. Ensembl Fly
Match: Sox15 (gene:FBgn0005613 transcript:FBtr0087576)

HSP 1 Score: 93.9745 bits (232), Expect = 1.219e-20
Identity = 38/78 (48.72%), Postives = 58/78 (74.36%), Query Frame = 1
Query:  418 KSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            KS K S  I+ PMNAFMVWAKI RK +A + P+  N D+SK+LGKKW  ++ ++R P++ EA++LR+ H+ ++P ++Y
Sbjct:  208 KSAKESR-IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKY 284          
BLAST of SOXP-3 vs. Ensembl Fly
Match: Sox21b (gene:FBgn0042630 transcript:FBtr0330116)

HSP 1 Score: 88.1965 bits (217), Expect = 8.628e-19
Identity = 37/84 (44.05%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  400 FKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
             ++ TK+  +N  HIK PMNAFMVW+++ R+ +A   P   N +ISK LG +W  ++ EE+ PFI+EAK+LR  H+ ++P+++Y
Sbjct:  236 IQNTTKR--QNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKY 317          
BLAST of SOXP-3 vs. Ensembl Fly
Match: Sox21b (gene:FBgn0042630 transcript:FBtr0075747)

HSP 1 Score: 87.8113 bits (216), Expect = 9.248e-19
Identity = 37/84 (44.05%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  400 FKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
             ++ TK+  +N  HIK PMNAFMVW+++ R+ +A   P   N +ISK LG +W  ++ EE+ PFI+EAK+LR  H+ ++P+++Y
Sbjct:  236 IQNTTKR--QNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKY 317          
BLAST of SOXP-3 vs. Ensembl Fly
Match: Sox21b (gene:FBgn0042630 transcript:FBtr0330115)

HSP 1 Score: 87.8113 bits (216), Expect = 9.248e-19
Identity = 37/84 (44.05%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  400 FKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
             ++ TK+  +N  HIK PMNAFMVW+++ R+ +A   P   N +ISK LG +W  ++ EE+ PFI+EAK+LR  H+ ++P+++Y
Sbjct:  236 IQNTTKR--QNEEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMKEHPDYKY 317          
BLAST of SOXP-3 vs. Ensembl Fly
Match: SoxN (gene:FBgn0029123 transcript:FBtr0079733)

HSP 1 Score: 87.4261 bits (215), Expect = 1.340e-18
Identity = 35/78 (44.87%), Postives = 57/78 (73.08%), Query Frame = 1
Query:  418 KSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            K+ ++++ +K PMNAFMVW++  R+ MAS  P   N +ISK LG +W ++S  E+ PFI+EAK+LR  H+ ++P+++Y
Sbjct:  171 KNQQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKY 248          
BLAST of SOXP-3 vs. Ensembl Zebrafish
Match: sox8a (SRY-box transcription factor 8a [Source:ZFIN;Acc:ZDB-GENE-130530-719])

HSP 1 Score: 94.3597 bits (233), Expect = 4.061e-21
Identity = 37/78 (47.44%), Postives = 57/78 (73.08%), Query Frame = 1
Query:  418 KSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            +S+K+  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  +S  E+ PF+ EA++LR++H   YP+++Y
Sbjct:   78 RSLKDKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRLQHKKDYPDYKY 155          
BLAST of SOXP-3 vs. Ensembl Zebrafish
Match: sox9a (SRY-box transcription factor 9a [Source:ZFIN;Acc:ZDB-GENE-001103-1])

HSP 1 Score: 89.3521 bits (220), Expect = 2.847e-20
Identity = 36/77 (46.75%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S KN  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  ++  E+ PF+ EA++LR++H   +P+++Y
Sbjct:  100 SSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNEVEKRPFVEEAERLRVQHKKDHPDYKY 176          
BLAST of SOXP-3 vs. Ensembl Zebrafish
Match: sox8b (SRY-box transcription factor 8b [Source:ZFIN;Acc:ZDB-GENE-031114-1])

HSP 1 Score: 90.1225 bits (222), Expect = 9.348e-20
Identity = 35/77 (45.45%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S K+  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  ++  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   79 SGKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLTESEKRPFVEEAERLRVQHKKDHPDYKY 155          
BLAST of SOXP-3 vs. Ensembl Zebrafish
Match: sox12 (SRY-box transcription factor 12 [Source:ZFIN;Acc:ZDB-GENE-040724-33])

HSP 1 Score: 89.3521 bits (220), Expect = 1.735e-19
Identity = 35/73 (47.95%), Postives = 54/73 (73.97%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            + HIK PMNAFMVW++I R+ +  Q+P+  N +ISK LGK+W  +   E+ PFI EA++LR++H+  YP+++Y
Sbjct:   50 TGHIKRPMNAFMVWSQIERRKIMEQWPDMHNAEISKRLGKRWKLLPDYEKIPFIKEAERLRLKHMADYPDYKY 122          
BLAST of SOXP-3 vs. Ensembl Zebrafish
Match: sox4b (SRY-box transcription factor 4b [Source:ZFIN;Acc:ZDB-GENE-040426-1274])

HSP 1 Score: 88.9669 bits (219), Expect = 1.767e-19
Identity = 41/98 (41.84%), Postives = 67/98 (68.37%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRYXXXXXXXXXXXXXXIKTDLASPTNQ 726
            S HIK PMNAFMVW++I R+ +  Q P+  N +ISK LGK+W  +   ++ PFI EA++LR++H+  YP+++Y+PR++ K S      K  ++ P+++
Sbjct:   52 SGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDGDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSSGSKPSEKLSISKPSSK 149          
BLAST of SOXP-3 vs. Ensembl Xenopus
Match: cyp4f2 (cytochrome P450 family 4 subfamily F member 2 [Source:Xenbase;Acc:XB-GENE-6258041])

HSP 1 Score: 90.1225 bits (222), Expect = 1.329e-19
Identity = 35/73 (47.95%), Postives = 54/73 (73.97%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S HIK PMNAFMVW++I R+ +  Q P+  N +ISK LGK+W ++   ++ PFI EA++LR++H+  YP+++Y
Sbjct:   57 SGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKQLKDGDKIPFIREAERLRLKHMADYPDYKY 129          
BLAST of SOXP-3 vs. Ensembl Xenopus
Match: smad9 (SMAD family member 9 [Source:Xenbase;Acc:XB-GENE-484686])

HSP 1 Score: 90.1225 bits (222), Expect = 1.572e-19
Identity = 36/73 (49.32%), Postives = 54/73 (73.97%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            + HIK PMNAFMVW+KI R+ +  Q P+  N +ISK LGK+W  ++  E+ PFI EA++LR++H+  YP+++Y
Sbjct:   45 TGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLNDSEKIPFIREAERLRLKHMADYPDYKY 117          
BLAST of SOXP-3 vs. Ensembl Xenopus
Match: sox7 (SRY-box 7 [Source:NCBI gene;Acc:549080])

HSP 1 Score: 88.9669 bits (219), Expect = 3.032e-19
Identity = 40/111 (36.04%), Postives = 65/111 (58.56%), Query Frame = 1
Query:  319 TENYLCRQFEDYPTIKDKIQVNREMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            TE   C   ++   + D +  +R  +E    T+        I+ PMNAFMVWAK  RK +A Q P+  N ++SK+LGK W  +S  ++ P++ EA++LR++H+  YP ++Y
Sbjct:   11 TEGLDCSPIDE--DLSDGLSPHRSPREKGSETR--------IRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLRVQHMQDYPNYKY 111          
BLAST of SOXP-3 vs. Ensembl Xenopus
Match: SOX8 (SRY-box 8 [Source:NCBI gene;Acc:100497725])

HSP 1 Score: 89.7373 bits (221), Expect = 3.411e-19
Identity = 35/77 (45.45%), Postives = 54/77 (70.13%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
             +K   H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  +S  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   98 GLKAKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSENEKRPFVEEAERLRVQHKKDHPDYKY 174          
BLAST of SOXP-3 vs. Ensembl Xenopus
Match: sox17b.3 (SRY-box 17 alpha [Source:NCBI gene;Acc:395066])

HSP 1 Score: 88.9669 bits (219), Expect = 3.659e-19
Identity = 39/92 (42.39%), Postives = 60/92 (65.22%), Query Frame = 1
Query:  400 FKDI-TKKSVKNSN-------HIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            F+D  TKK   ++N        I+ PMNAFMVWAK  RK +A Q P+  N ++SK+LGK W  ++   + PF+ EA++LR++H+  YP+++Y
Sbjct:   36 FQDAKTKKEAGSANSRGKAEARIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVKEAERLRVQHIQDYPDYKY 127          
BLAST of SOXP-3 vs. Ensembl Mouse
Match: Sox8 (SRY (sex determining region Y)-box 8 [Source:MGI Symbol;Acc:MGI:98370])

HSP 1 Score: 90.5077 bits (223), Expect = 7.030e-21
Identity = 35/77 (45.45%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            ++K   H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  +S  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   92 TLKAKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKY 168          
BLAST of SOXP-3 vs. Ensembl Mouse
Match: Sox17 (SRY (sex determining region Y)-box 17 [Source:MGI Symbol;Acc:MGI:107543])

HSP 1 Score: 87.8113 bits (216), Expect = 2.666e-20
Identity = 35/80 (43.75%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  412 TKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            T    K  + I+ PMNAFMVWAK  RK +A Q P+  N ++SK+LGK W  ++  E+ PF+ EA++LR++H+  +P ++Y
Sbjct:   58 TSGRAKAESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKY 137          
BLAST of SOXP-3 vs. Ensembl Mouse
Match: Sox17 (SRY (sex determining region Y)-box 17 [Source:MGI Symbol;Acc:MGI:107543])

HSP 1 Score: 87.8113 bits (216), Expect = 2.710e-20
Identity = 35/80 (43.75%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  412 TKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            T    K  + I+ PMNAFMVWAK  RK +A Q P+  N ++SK+LGK W  ++  E+ PF+ EA++LR++H+  +P ++Y
Sbjct:   58 TSGRAKAESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKY 137          
BLAST of SOXP-3 vs. Ensembl Mouse
Match: Sox11 (SRY (sex determining region Y)-box 11 [Source:MGI Symbol;Acc:MGI:98359])

HSP 1 Score: 91.2781 bits (225), Expect = 5.384e-20
Identity = 37/73 (50.68%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S HIK PMNAFMVW+KI R+ +  Q P+  N +ISK LGK+W  +   E+ PFI EA++LR++H+  YP+++Y
Sbjct:   46 SGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKY 118          
BLAST of SOXP-3 vs. Ensembl Mouse
Match: Sox8 (SRY (sex determining region Y)-box 8 [Source:MGI Symbol;Acc:MGI:98370])

HSP 1 Score: 91.2781 bits (225), Expect = 8.213e-20
Identity = 35/84 (41.67%), Postives = 56/84 (66.67%), Query Frame = 1
Query:  400 FKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
             +     ++K   H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  +S  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   85 VRGGGGGTLKAKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKY 168          
BLAST of SOXP-3 vs. UniProt/SwissProt
Match: sp|Q6IZ48|SOX8_TETNG (Transcription factor Sox-8 OS=Tetraodon nigroviridis OX=99883 GN=sox8 PE=2 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 1.786e-20
Identity = 38/77 (49.35%), Postives = 57/77 (74.03%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S+KN  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  +S  E+ PF++EA++LRI+H   +P+++Y
Sbjct:   93 SLKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVDEAERLRIQHKKDHPDYKY 169          
BLAST of SOXP-3 vs. UniProt/SwissProt
Match: sp|P40657|SOX15_DROME (Putative transcription factor SOX-15 OS=Drosophila melanogaster OX=7227 GN=Sox15 PE=2 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 1.222e-19
Identity = 38/78 (48.72%), Postives = 58/78 (74.36%), Query Frame = 1
Query:  418 KSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            KS K S  I+ PMNAFMVWAKI RK +A + P+  N D+SK+LGKKW  ++ ++R P++ EA++LR+ H+ ++P ++Y
Sbjct:  208 KSAKESR-IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEHPNYKY 284          
BLAST of SOXP-3 vs. UniProt/SwissProt
Match: sp|P0C1G9|SOX11_RAT (Transcription factor SOX-11 OS=Rattus norvegicus OX=10116 GN=Sox11 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.766e-19
Identity = 37/73 (50.68%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S HIK PMNAFMVW+KI R+ +  Q P+  N +ISK LGK+W  +   E+ PFI EA++LR++H+  YP+++Y
Sbjct:   46 SGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKY 118          
BLAST of SOXP-3 vs. UniProt/SwissProt
Match: sp|Q7M6Y2|SOX11_MOUSE (Transcription factor SOX-11 OS=Mus musculus OX=10090 GN=Sox11 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.766e-19
Identity = 37/73 (50.68%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S HIK PMNAFMVW+KI R+ +  Q P+  N +ISK LGK+W  +   E+ PFI EA++LR++H+  YP+++Y
Sbjct:   46 SGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKY 118          
BLAST of SOXP-3 vs. UniProt/SwissProt
Match: sp|P35716|SOX11_HUMAN (Transcription factor SOX-11 OS=Homo sapiens OX=9606 GN=SOX11 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 4.363e-19
Identity = 37/73 (50.68%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S HIK PMNAFMVW+KI R+ +  Q P+  N +ISK LGK+W  +   E+ PFI EA++LR++H+  YP+++Y
Sbjct:   46 SGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKY 118          
BLAST of SOXP-3 vs. TrEMBL
Match: H9CXV0 (SOXP-3 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 480.33 bits (1235), Expect = 4.629e-169
Identity = 251/254 (98.82%), Postives = 251/254 (98.82%), Query Frame = 1
Query:  265 NLLSMFLNTPVTMNYCENTENYLCRQFEDYPTIKDKIQVNREMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRYXXXXXXXXXXXXXXIKTDLASPTNQCSADFHSFENLNLPKISNFNFTDMNNFEVKNIYDYQPASINYNSEINLFNDYFDHTIDSGFQPIDSNLPSVSSLIYNSHPYTFNYNCEKSLAQFNYLEHE 1026
            NLLSMFLNTPVTMNYCENTENYLCRQFEDYPTIKDKIQVNREMKEFKDITKKSVKNSNHIKIP NAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRYQ RRRQKKSKKSKPIKTDLASPTNQCSADFHSFENLNLPKISNFNFTDMNNFEVKNIYDYQPASINYNSEINLFNDYFDHTIDSGFQPIDSNLPSVSSLIYNSHPYTFNYNCEKSLA FNYLEHE
Sbjct:    1 NLLSMFLNTPVTMNYCENTENYLCRQFEDYPTIKDKIQVNREMKEFKDITKKSVKNSNHIKIPKNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRYQSRRRQKKSKKSKPIKTDLASPTNQCSADFHSFENLNLPKISNFNFTDMNNFEVKNIYDYQPASINYNSEINLFNDYFDHTIDSGFQPIDSNLPSVSSLIYNSHPYTFNYNCEKSLAPFNYLEHE 254          
BLAST of SOXP-3 vs. TrEMBL
Match: E9GZE6 (HMG box domain-containing protein (Fragment) OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_199562 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.254e-20
Identity = 47/107 (43.93%), Postives = 73/107 (68.22%), Query Frame = 1
Query:  400 FKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRYXXXXXXXXXXXXXXIKTDLASPT 720
            + D T+   KN+  IK PMNAFMVW++I R+ +    P   N +ISK LGK+W  +S+EERTPFI EA++LR+ H+ +YP+++Y+PR++ + +K S   +    +PT
Sbjct:   39 YSDATQTKKKNTVRIKRPMNAFMVWSQIERRKICEIQPEMHNAEISKQLGKQWKTLSSEERTPFIQEAQRLRLLHIQEYPDYKYRPRKKTEVAKGSSAARKSCTTPT 145          
BLAST of SOXP-3 vs. TrEMBL
Match: A0A1B6CI02 (HMG box domain-containing protein (Fragment) OS=Clastoptera arizonana OX=38151 GN=g.19427 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.608e-20
Identity = 42/84 (50.00%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  400 FKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            + D T+    N NHIK PMNAFMVW++I R+ +  Q P+  N +ISK LGK+W  ++ EER PFI EA++LR+ HL +YP+++Y
Sbjct:   34 YSDATQTKKNNPNHIKRPMNAFMVWSQIERRKICEQQPDMHNAEISKRLGKQWKLLTEEERQPFIEEAERLRLMHLQEYPDYKY 117          
BLAST of SOXP-3 vs. TrEMBL
Match: A0A482XS96 (HMG box domain-containing protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR007547 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.141e-20
Identity = 41/84 (48.81%), Postives = 60/84 (71.43%), Query Frame = 1
Query:  400 FKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            + D T+    N NHIK PMNAFMVW++I R+ +  Q P+  N +ISK LG++W  ++ EER PFI EA++LR+ HL +YP+++Y
Sbjct:   31 YSDATQTKKNNPNHIKRPMNAFMVWSQIERRKICEQQPDMHNAEISKRLGRRWKTLTEEERQPFIEEAERLRLMHLQEYPDYKY 114          
BLAST of SOXP-3 vs. TrEMBL
Match: A0A1B6HFM9 (HMG box domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.29342 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 5.668e-20
Identity = 41/84 (48.81%), Postives = 59/84 (70.24%), Query Frame = 1
Query:  400 FKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            + D T+    N NHIK PMNAFMVW++I R+ +    P+  N +ISK LG++W  +S EER PFI EA++LR+ HL +YP+++Y
Sbjct:   37 YSDATQTKKNNPNHIKRPMNAFMVWSQIERRKICELQPDMHNAEISKRLGRRWKTLSEEERQPFIEEAERLRLMHLQEYPDYKY 120          
BLAST of SOXP-3 vs. Ensembl Cavefish
Match: sox8b (SRY-box transcription factor 8 [Source:NCBI gene;Acc:103030792])

HSP 1 Score: 93.5893 bits (231), Expect = 9.820e-21
Identity = 37/77 (48.05%), Postives = 56/77 (72.73%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S+KN  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  +S  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   83 SLKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSENEKRPFVEEAERLRVQHKKDHPDYKY 159          
BLAST of SOXP-3 vs. Ensembl Cavefish
Match: sox8b (SRY-box transcription factor 8 [Source:NCBI gene;Acc:103030792])

HSP 1 Score: 93.5893 bits (231), Expect = 1.012e-20
Identity = 37/77 (48.05%), Postives = 56/77 (72.73%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S+KN  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  +S  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   83 SLKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSENEKRPFVEEAERLRVQHKKDHPDYKY 159          
BLAST of SOXP-3 vs. Ensembl Cavefish
Match: sox9b (transcription factor Sox-9 [Source:NCBI gene;Acc:103039568])

HSP 1 Score: 91.2781 bits (225), Expect = 7.089e-20
Identity = 36/77 (46.75%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S KN  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  ++  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   94 SSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNEGEKRPFVEEAERLRVQHKKDHPDYKY 170          
BLAST of SOXP-3 vs. Ensembl Cavefish
Match: sox9a (transcription factor Sox-9-A-like [Source:NCBI gene;Acc:103045523])

HSP 1 Score: 90.8929 bits (224), Expect = 7.833e-20
Identity = 36/77 (46.75%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S KN  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  ++  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   93 SSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNDAEKRPFVEEAERLRVQHKKDHPDYKY 169          
BLAST of SOXP-3 vs. Ensembl Cavefish
Match: sox9a (transcription factor Sox-9-A-like [Source:NCBI gene;Acc:103045523])

HSP 1 Score: 90.8929 bits (224), Expect = 8.561e-20
Identity = 36/77 (46.75%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S KN  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  ++  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   93 SSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNDAEKRPFVEEAERLRVQHKKDHPDYKY 169          
BLAST of SOXP-3 vs. Ensembl Sea Lamprey
Match: sox4b (SRY-box transcription factor 4b [Source:ZFIN;Acc:ZDB-GENE-040426-1274])

HSP 1 Score: 91.6633 bits (226), Expect = 4.932e-21
Identity = 35/73 (47.95%), Postives = 54/73 (73.97%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S HIK PMNAFMVW++I R+ +  Q P+  N +ISK LG++W ++   E+ PFI EA++LR++H+  YP+++Y
Sbjct:   59 SGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGRRWKQLKESEKVPFIREAERLRLKHMADYPDYKY 131          
BLAST of SOXP-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010223.1 (pep scaffold:Pmarinus_7.0:GL478813:2555:9375:-1 gene:ENSPMAG00000009255.1 transcript:ENSPMAT00000010223.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 7.665e-20
Identity = 32/67 (47.76%), Postives = 50/67 (74.63%), Query Frame = 1
Query:  451 PMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            PMNAFMVWAK  R+ +A Q P+  N ++SK+LGK W  ++ E R P + EA++LR+ HL+++P+++Y
Sbjct:    9 PMNAFMVWAKDERRRLAKQNPDLHNAELSKMLGKSWRALTPESRRPCVEEAERLRLLHLSEHPDYKY 75          
BLAST of SOXP-3 vs. Ensembl Sea Lamprey
Match: sox10 (SRY-box transcription factor 10 [Source:ZFIN;Acc:ZDB-GENE-011207-1])

HSP 1 Score: 84.7297 bits (208), Expect = 8.203e-19
Identity = 32/71 (45.07%), Postives = 51/71 (71.83%), Query Frame = 1
Query:  439 HIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            H+K PMNAFMVWA+  R+ ++ QYP   N ++SK LGK W  ++  E+ PF+ EA++LR++H   +P+++Y
Sbjct:  111 HVKRPMNAFMVWAQAARRKLSDQYPQLHNAELSKTLGKLWRLLNEGEKRPFVEEAERLRMQHKKDHPDYKY 181          
BLAST of SOXP-3 vs. Ensembl Sea Lamprey
Match: sox12 (SRY-box transcription factor 12 [Source:ZFIN;Acc:ZDB-GENE-040724-33])

HSP 1 Score: 85.1149 bits (209), Expect = 1.016e-18
Identity = 32/72 (44.44%), Postives = 53/72 (73.61%), Query Frame = 1
Query:  436 NHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
             HIK PMNAFMVW++I R+ +  + P+  N +ISK LG++W ++   E+ PF+ EA++LR++H+  YP+++Y
Sbjct:   58 GHIKRPMNAFMVWSQIERRKIMMESPDVHNAEISKRLGRRWKQLKDCEKVPFMREAERLRLKHMADYPDYKY 129          
BLAST of SOXP-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008165.1 (pep scaffold:Pmarinus_7.0:GL479973:18969:29522:-1 gene:ENSPMAG00000007384.1 transcript:ENSPMAT00000008165.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 1.025e-17
Identity = 38/95 (40.00%), Postives = 55/95 (57.89%), Query Frame = 1
Query:  367 DKIQVNREMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            D   V  + K F+D   +      HIK PMNAFMVWAK  R+ +   +P+  N  ISK+LG +W  MS++E+ P+  E  +L   HL +YP ++Y
Sbjct:   37 DGGGVFGDAKVFRDGRGRHA-GEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKAMSSQEKQPYYEEQARLSKLHLERYPGYKY 130          
BLAST of SOXP-3 vs. Ensembl Yeast
Match: NHP6B (High-mobility group (HMG) protein; binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to the chromosomes; functionally redundant with Nhp6Ap; required for transcriptional initiation fidelity of some tRNA genes; homologous to mammalian HMGB1 and HMGB2; NHP6B has a paralog, NHP6A, that arose from the whole genome duplication [Source:SGD;Acc:S000002157])

HSP 1 Score: 46.9802 bits (110), Expect = 2.057e-7
Identity = 22/74 (29.73%), Postives = 47/74 (63.51%), Query Frame = 1
Query:  385 REMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAK 606
            ++ KE K  T +  K+ N  K  ++A+M +A  NR ++ S+ P+ +   + ++LG++W  ++AEE+ P+ ++A+
Sbjct:    8 KQPKEPKKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEKQPYESKAQ 81          
BLAST of SOXP-3 vs. Ensembl Nematostella
Match: EDO39449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9V3])

HSP 1 Score: 90.1225 bits (222), Expect = 1.139e-22
Identity = 39/77 (50.65%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S  +  HIK PMNAFMVW++  R+ +A +YPN  N +ISKLLG +W+ +S EE+ PF+ EAK+LR  H  +YP++ Y
Sbjct:    2 SETDDQHIKRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEEEKRPFVTEAKRLRTIHNQKYPDYSY 78          
BLAST of SOXP-3 vs. Ensembl Nematostella
Match: EDO43746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXZ2])

HSP 1 Score: 85.5001 bits (210), Expect = 4.219e-21
Identity = 33/70 (47.14%), Postives = 53/70 (75.71%), Query Frame = 1
Query:  442 IKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            +K PMN+FM+WAK+ R+  A + P   N +ISKLLGK WNE++ +++ PF+ +A++LRI H+ ++P +RY
Sbjct:    1 VKRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTKDKRPFVEKAERLRIRHMKEHPNYRY 70          
BLAST of SOXP-3 vs. Ensembl Nematostella
Match: EDO32843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STW6])

HSP 1 Score: 85.1149 bits (209), Expect = 9.274e-21
Identity = 38/80 (47.50%), Postives = 58/80 (72.50%), Query Frame = 1
Query:  412 TKKSVKNSN--HIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEF 645
            T +S K S+  H+K PMNAFMVW++I R+ MA ++P+  N +ISK LGK+W  +S  E+ PF+ E+++LRI H+  YP++
Sbjct:   11 THESKKKSDMQHVKRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSESEKRPFVEESERLRIRHMQAYPDY 90          
BLAST of SOXP-3 vs. Ensembl Nematostella
Match: EDO37974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA1])

HSP 1 Score: 88.1965 bits (217), Expect = 1.535e-19
Identity = 35/71 (49.30%), Postives = 53/71 (74.65%), Query Frame = 1
Query:  439 HIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  ++  E+ PFI EA++LRI+H  ++P+++Y
Sbjct:   63 HVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLNDSEKKPFIEEAERLRIKHKREHPDYKY 133          
BLAST of SOXP-3 vs. Ensembl Nematostella
Match: EDO32666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUF3])

HSP 1 Score: 83.9593 bits (206), Expect = 8.268e-19
Identity = 32/76 (42.11%), Postives = 55/76 (72.37%), Query Frame = 1
Query:  424 VKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            VK   H+K PMNAFMVW++  R+ +A + P   N +ISK LG +W +++ +++ PF+ EAK+LR +H+ ++P+++Y
Sbjct:    4 VKPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLADDDKKPFVEEAKKLRAQHMKEHPDYKY 79          
BLAST of SOXP-3 vs. Ensembl Medaka
Match: sox8 (SRY-box transcription factor 8 [Source:NCBI gene;Acc:100304451])

HSP 1 Score: 93.5893 bits (231), Expect = 8.467e-21
Identity = 36/77 (46.75%), Postives = 57/77 (74.03%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S+K+  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  +S  E+ PF++EA++LR++H   +P+++Y
Sbjct:   93 SLKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVDEAERLRVQHKKDHPDYKY 169          
BLAST of SOXP-3 vs. Ensembl Medaka
Match: sox4b (SRY-box transcription factor 4b [Source:ZFIN;Acc:ZDB-GENE-040426-1274])

HSP 1 Score: 88.5817 bits (218), Expect = 1.354e-19
Identity = 35/73 (47.95%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  433 SNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S HIK PMNAFMVW++I R+ +  Q P+  N +ISK LGK+W  +   ++ PFI EA++LR++H+  YP+++Y
Sbjct:   61 SGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLRDSDKIPFIREAERLRLKHMADYPDYKY 133          
BLAST of SOXP-3 vs. Ensembl Medaka
Match: sox14 (SRY-box transcription factor 14 [Source:NCBI gene;Acc:100304454])

HSP 1 Score: 87.0409 bits (214), Expect = 1.466e-19
Identity = 35/75 (46.67%), Postives = 55/75 (73.33%), Query Frame = 1
Query:  427 KNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            K ++HIK PMNAFMVW++  R+ MA + P   N +ISK LG +W  +S  E+ P+I+EAK+LR +H+ ++P+++Y
Sbjct:    3 KPADHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSESEKRPYIDEAKRLRAQHMKEHPDYKY 77          
BLAST of SOXP-3 vs. Ensembl Medaka
Match: ENSORLT00000029054.1 (transcription factor Sox-14-like [Source:NCBI gene;Acc:111949029])

HSP 1 Score: 86.2705 bits (212), Expect = 2.595e-19
Identity = 36/76 (47.37%), Postives = 53/76 (69.74%), Query Frame = 1
Query:  424 VKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
             K   HIK PMNAFMVW++  R+ MA + P   N +ISK LG +W  +S  ++ PFI+EAK+LR +HL ++P+++Y
Sbjct:    2 AKPVEHIKRPMNAFMVWSRGQRRKMARENPKMHNSEISKRLGAEWKTLSDSDKRPFIDEAKRLRAQHLREHPDYKY 77          
BLAST of SOXP-3 vs. Ensembl Medaka
Match: sox9 (SRY-box transcription factor 9 [Source:NCBI gene;Acc:100125805])

HSP 1 Score: 88.5817 bits (218), Expect = 5.344e-19
Identity = 35/77 (45.45%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  421 SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            S K+  H+K PMNAFMVWA+  R+ +A QYP+  N ++SK LGK W  ++  E+ PF+ EA++LR++H   +P+++Y
Sbjct:   97 SSKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNEVEKRPFVEEAERLRVQHKKDHPDYKY 173          
BLAST of SOXP-3 vs. Planmine SMEST
Match: SMESG000051170.1 (SMESG000051170.1)

HSP 1 Score: 493.041 bits (1268), Expect = 3.997e-177
Identity = 257/258 (99.61%), Postives = 257/258 (99.61%), Query Frame = 1
Query:  253 VINHNLLSMFLNTPVTMNYCENTENYLCRQFEDYPTIKDKIQVNREMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRYXXXXXXXXXXXXXXIKTDLASPTNQCSADFHSFENLNLPKISNFNFTDMNNFEVKNIYDYQPASINYNSEINLFNDYFDHTIDSGFQPIDSNLPSVSSLIYNSHPYTFNYNCEKSLAQFNYLEHE 1026
            VINHNLLSMFLNTPVTMNYCENTENYLCRQFEDYPTIKDKIQVNREMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRYQPRRRQKKSKKSKPIKTDLASPTNQCSADFHSFENLNLPKISNFNFTDMNNFEVKNIYDYQPASINYNSEINLFNDYFDHTIDSGFQPIDSNLPSVSSLIYNSHPYTFNYNCEKSLA FNYLEHE
Sbjct:   29 VINHNLLSMFLNTPVTMNYCENTENYLCRQFEDYPTIKDKIQVNREMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRYQPRRRQKKSKKSKPIKTDLASPTNQCSADFHSFENLNLPKISNFNFTDMNNFEVKNIYDYQPASINYNSEINLFNDYFDHTIDSGFQPIDSNLPSVSSLIYNSHPYTFNYNCEKSLAPFNYLEHE 286          
BLAST of SOXP-3 vs. Planmine SMEST
Match: SMESG000011244.1 (SMESG000011244.1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.157e-21
Identity = 50/127 (39.37%), Postives = 73/127 (57.48%), Query Frame = 1
Query:  283 LNTPVTMNYCENTENYLCRQFEDYPTIKDKIQ----VNREMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            L TP + +   N  +Y    F+D    KD+ Q     N +  +  +IT  S K  + +K PMNAFMVW++  R+ MA   P   N +ISK LG  W  +S E++ PFI+EAK+LR  H+ QYP+++Y
Sbjct:  205 LRTPKSEDIDRNQNDY----FDDCEFSKDQTQNVTTANSQTSQ-SNITSSSQKKDDRVKRPMNAFMVWSRGQRRRMAQDNPKMHNSEISKRLGGMWKNLSEEDKKPFIDEAKRLRANHMTQYPDYKY 326          
BLAST of SOXP-3 vs. Planmine SMEST
Match: SMESG000011244.1 (SMESG000011244.1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.212e-21
Identity = 50/127 (39.37%), Postives = 73/127 (57.48%), Query Frame = 1
Query:  283 LNTPVTMNYCENTENYLCRQFEDYPTIKDKIQ----VNREMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            L TP + +   N  +Y    F+D    KD+ Q     N +  +  +IT  S K  + +K PMNAFMVW++  R+ MA   P   N +ISK LG  W  +S E++ PFI+EAK+LR  H+ QYP+++Y
Sbjct:  204 LRTPKSEDIDRNQNDY----FDDCEFSKDQTQNVTTANSQTSQ-SNITSSSQKKDDRVKRPMNAFMVWSRGQRRRMAQDNPKMHNSEISKRLGGMWKNLSEEDKKPFIDEAKRLRANHMTQYPDYKY 325          
BLAST of SOXP-3 vs. Planmine SMEST
Match: SMESG000050484.1 (SMESG000050484.1)

HSP 1 Score: 83.1889 bits (204), Expect = 3.813e-17
Identity = 43/112 (38.39%), Postives = 66/112 (58.93%), Query Frame = 1
Query:  325 NYLCRQFEDYPTIKDKIQVNREMKEFKDITKK---SVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            N  C + +D      KI   R ++  ++  K    S  +S+HIK PMNAFMVWA+  R+ +    P+  N +ISKLLG+KW  M+A ++ P+  E  +L  +H+ Q+PE+RY
Sbjct:  500 NVKCAETDDSQNSNGKILGARIVRSQRNPDKSDNMSRSSSSHIKRPMNAFMVWAREERRKILKACPDMHNSNISKLLGQKWKSMTAADKQPYYEEQSRLSRQHMEQHPEYRY 611          
BLAST of SOXP-3 vs. Planmine SMEST
Match: SMESG000067682.1 (SMESG000067682.1)

HSP 1 Score: 82.4185 bits (202), Expect = 5.246e-17
Identity = 41/116 (35.34%), Postives = 67/116 (57.76%), Query Frame = 1
Query:  322 ENYLCRQFEDY-PTIKD-----KIQVNREMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMASQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY 651
            E+Y C    +  P IKD     K +    ++  ++  K++ K    I+ PMNAFMVW++  R+ M+ + P   N +ISK LG  W  +S  ++ PFI+EAK+LR  H  ++P+++Y
Sbjct:  177 ESYHCDDMNNSSPEIKDNQSRLKTETQNSIQINQNANKQTDKKEARIRRPMNAFMVWSRGQRRKMSVENPKMHNSEISKRLGSMWKSLSEIDKKPFIDEAKRLRANHQKEHPDYKY 292          
The following BLAST results are available for this feature:
BLAST of SOXP-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SOX119.085e-2050.68SRY-box transcription factor 11 [Source:HGNC Symbo... [more]
SOX81.216e-1945.45SRY-box transcription factor 8 [Source:HGNC Symbol... [more]
SOX91.463e-1946.75SRY-box transcription factor 9 [Source:HGNC Symbol... [more]
SOX141.560e-1948.00SRY-box transcription factor 14 [Source:HGNC Symbo... [more]
SOX181.635e-1945.57SRY-box transcription factor 18 [Source:HGNC Symbo... [more]
back to top
BLAST of SOXP-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox-34.810e-2044.21SOX (Mammalian SRY box) family [Source:UniProtKB/... [more]
sox-22.406e-1946.84Transcription factor sox-2 [Source:UniProtKB/Swis... [more]
sox-22.406e-1946.84Transcription factor sox-2 [Source:UniProtKB/Swis... [more]
sox-22.406e-1946.84Transcription factor sox-2 [Source:UniProtKB/Swis... [more]
sem-24.706e-1947.22Transcription factor sem-2 [Source:UniProtKB/Swis... [more]
back to top
BLAST of SOXP-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sox151.219e-2048.72gene:FBgn0005613 transcript:FBtr0087576[more]
Sox21b8.628e-1944.05gene:FBgn0042630 transcript:FBtr0330116[more]
Sox21b9.248e-1944.05gene:FBgn0042630 transcript:FBtr0075747[more]
Sox21b9.248e-1944.05gene:FBgn0042630 transcript:FBtr0330115[more]
SoxN1.340e-1844.87gene:FBgn0029123 transcript:FBtr0079733[more]
back to top
BLAST of SOXP-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox8a4.061e-2147.44SRY-box transcription factor 8a [Source:ZFIN;Acc:Z... [more]
sox9a2.847e-2046.75SRY-box transcription factor 9a [Source:ZFIN;Acc:Z... [more]
sox8b9.348e-2045.45SRY-box transcription factor 8b [Source:ZFIN;Acc:Z... [more]
sox121.735e-1947.95SRY-box transcription factor 12 [Source:ZFIN;Acc:Z... [more]
sox4b1.767e-1941.84SRY-box transcription factor 4b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SOXP-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp4f21.329e-1947.95cytochrome P450 family 4 subfamily F member 2 [Sou... [more]
smad91.572e-1949.32SMAD family member 9 [Source:Xenbase;Acc:XB-GENE-4... [more]
sox73.032e-1936.04SRY-box 7 [Source:NCBI gene;Acc:549080][more]
SOX83.411e-1945.45SRY-box 8 [Source:NCBI gene;Acc:100497725][more]
sox17b.33.659e-1942.39SRY-box 17 alpha [Source:NCBI gene;Acc:395066][more]
back to top
BLAST of SOXP-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sox87.030e-2145.45SRY (sex determining region Y)-box 8 [Source:MGI S... [more]
Sox172.666e-2043.75SRY (sex determining region Y)-box 17 [Source:MGI ... [more]
Sox172.710e-2043.75SRY (sex determining region Y)-box 17 [Source:MGI ... [more]
Sox115.384e-2050.68SRY (sex determining region Y)-box 11 [Source:MGI ... [more]
Sox88.213e-2041.67SRY (sex determining region Y)-box 8 [Source:MGI S... [more]
back to top
BLAST of SOXP-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6IZ48|SOX8_TETNG1.786e-2049.35Transcription factor Sox-8 OS=Tetraodon nigrovirid... [more]
sp|P40657|SOX15_DROME1.222e-1948.72Putative transcription factor SOX-15 OS=Drosophila... [more]
sp|P0C1G9|SOX11_RAT3.766e-1950.68Transcription factor SOX-11 OS=Rattus norvegicus O... [more]
sp|Q7M6Y2|SOX11_MOUSE3.766e-1950.68Transcription factor SOX-11 OS=Mus musculus OX=100... [more]
sp|P35716|SOX11_HUMAN4.363e-1950.68Transcription factor SOX-11 OS=Homo sapiens OX=960... [more]
back to top
BLAST of SOXP-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXV04.629e-16998.82SOXP-3 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
E9GZE61.254e-2043.93HMG box domain-containing protein (Fragment) OS=Da... [more]
A0A1B6CI023.608e-2050.00HMG box domain-containing protein (Fragment) OS=Cl... [more]
A0A482XS964.141e-2048.81HMG box domain-containing protein OS=Laodelphax st... [more]
A0A1B6HFM95.668e-2048.81HMG box domain-containing protein (Fragment) OS=Ho... [more]
back to top
BLAST of SOXP-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox8b9.820e-2148.05SRY-box transcription factor 8 [Source:NCBI gene;A... [more]
sox8b1.012e-2048.05SRY-box transcription factor 8 [Source:NCBI gene;A... [more]
sox9b7.089e-2046.75transcription factor Sox-9 [Source:NCBI gene;Acc:1... [more]
sox9a7.833e-2046.75transcription factor Sox-9-A-like [Source:NCBI gen... [more]
sox9a8.561e-2046.75transcription factor Sox-9-A-like [Source:NCBI gen... [more]
back to top
BLAST of SOXP-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox4b4.932e-2147.95SRY-box transcription factor 4b [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000010223.17.665e-2047.76pep scaffold:Pmarinus_7.0:GL478813:2555:9375:-1 ge... [more]
sox108.203e-1945.07SRY-box transcription factor 10 [Source:ZFIN;Acc:Z... [more]
sox121.016e-1844.44SRY-box transcription factor 12 [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000008165.11.025e-1740.00pep scaffold:Pmarinus_7.0:GL479973:18969:29522:-1 ... [more]
back to top
BLAST of SOXP-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NHP6B2.057e-729.73High-mobility group (HMG) protein; binds to and re... [more]
back to top
BLAST of SOXP-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394491.139e-2250.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437464.219e-2147.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328439.274e-2147.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379741.535e-1949.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326668.268e-1942.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SOXP-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox88.467e-2146.75SRY-box transcription factor 8 [Source:NCBI gene;A... [more]
sox4b1.354e-1947.95SRY-box transcription factor 4b [Source:ZFIN;Acc:Z... [more]
sox141.466e-1946.67SRY-box transcription factor 14 [Source:NCBI gene;... [more]
ENSORLT00000029054.12.595e-1947.37transcription factor Sox-14-like [Source:NCBI gene... [more]
sox95.344e-1945.45SRY-box transcription factor 9 [Source:NCBI gene;A... [more]
back to top
BLAST of SOXP-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051170.13.997e-17799.61SMESG000051170.1[more]
SMESG000011244.12.157e-2139.37SMESG000011244.1[more]
SMESG000011244.12.212e-2139.37SMESG000011244.1[more]
SMESG000050484.13.813e-1738.39SMESG000050484.1[more]
SMESG000067682.15.246e-1735.34SMESG000067682.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30008505
GenBankAFD29621.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008505 ID=SMED30008505|Name=SOXP-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1052bp
CTTCGTGATATTAATTTACCTGCAAAATTCAGTTAAGGTTGGTTTTAGGC
AGCAAATTGTGCTACCATTCATGTTTTTCCATGCGACGCAAAAAGATACA
AAGAGAGTAGTAAAAATGCAGTTAAAAGAATGATTCATGCTTCTTGTTAA
AACATGAGTGATACATTTTACAGCCATGGATGAACATGAAGATAGCATGA
AATGTGTTTCGACTCGCATGACTTATTTTCTATTAAAACAAATTACTCTG
CAGTTATAAATCATAATTTGTTGAGCATGTTTCTAAATACTCCAGTAACC
ATGAATTATTGTGAAAACACCGAAAATTACCTGTGCAGACAATTCGAAGA
TTATCCAACTATCAAAGATAAAATTCAAGTAAATCGAGAAATGAAAGAAT
TCAAAGACATAACAAAGAAATCAGTGAAAAATTCCAACCACATTAAAATT
CCCATGAATGCTTTTATGGTTTGGGCAAAAATTAATCGAAAACTCATGGC
TAGCCAATATCCGAATTTCTCAAATTTAGATATCAGTAAATTGCTTGGGA
AAAAATGGAATGAAATGTCAGCTGAAGAACGGACTCCGTTTATTAATGAG
GCCAAGCAGCTTCGAATTGAGCATTTGAATCAGTATCCAGAATTTAGATA
TCAGCCCCGAAGACGACAAAAGAAATCAAAAAAATCAAAACCAATCAAAA
CCGATTTGGCTTCTCCGACCAATCAGTGTTCTGCAGATTTTCACAGTTTT
GAAAATTTAAATTTACCTAAAATATCAAATTTCAATTTTACCGATATGAA
TAATTTCGAGGTGAAAAATATCTACGATTATCAACCGGCCTCGATCAATT
ACAATTCCGAGATCAATTTATTTAATGATTATTTTGACCATACTATTGAT
TCGGGTTTCCAGCCAATCGACAGCAACCTCCCATCCGTCAGTTCCTTGAT
CTACAACAGTCATCCGTATACTTTCAATTATAACTGCGAAAAATCATTAG
CGCAATTTAATTACTTGGAACATGAATTGTTTTTGTAGTTTGATTTTTTC
TA
back to top

protein sequence of SMED30008505-orf-1

>SMED30008505-orf-1 ID=SMED30008505-orf-1|Name=SMED30008505-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=279bp
MCFDSHDLFSIKTNYSAVINHNLLSMFLNTPVTMNYCENTENYLCRQFED
YPTIKDKIQVNREMKEFKDITKKSVKNSNHIKIPMNAFMVWAKINRKLMA
SQYPNFSNLDISKLLGKKWNEMSAEERTPFINEAKQLRIEHLNQYPEFRY
QPRRRQKKSKKSKPIKTDLASPTNQCSADFHSFENLNLPKISNFNFTDMN
NFEVKNIYDYQPASINYNSEINLFNDYFDHTIDSGFQPIDSNLPSVSSLI
YNSHPYTFNYNCEKSLAQFNYLEHELFL*
back to top
Aliases
The feature 'SOXP-3' has the following synonyms
Synonym
sox9-1
soxP-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036910HMG_box_dom_sf
IPR009071HMG_box_dom
Vocabulary: molecular function
TermDefinition
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009071High mobility group box domainSMARTSM00398hmgende2coord: 80..150
e-value: 5.5E-21
score: 85.7
IPR009071High mobility group box domainPFAMPF00505HMG_boxcoord: 82..149
e-value: 4.1E-19
score: 68.7
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 81..149
score: 17.973
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 75..157
e-value: 6.1E-23
score: 82.9
IPR036910High mobility group box domain superfamilySUPERFAMILYSSF47095HMG-boxcoord: 68..153
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 151..172
NoneNo IPR availablePANTHERPTHR10270:SF161SOX DOMAIN-CONTAINING PROTEIN DICHAETE-RELATEDcoord: 48..173
NoneNo IPR availablePANTHERPTHR10270SOX TRANSCRIPTION FACTORcoord: 48..173
NoneNo IPR availableCDDcd01388SOX-TCF_HMG-boxcoord: 80..150
e-value: 6.31701E-27
score: 97.7541