Slc43a-4

Overview
NameSlc43a-4
Smed IDSMED30008501
Length (bp)1087
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008501

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30008501h1SMcG0009623 Contig31399uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008501h1SMcG0009623 Contig31399newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Slc43a-4 vs. TrEMBL
Match: A0A0H3YJG6 (Slc43a-4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc43a-4 PE=2 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 4.088e-156
Identity = 256/327 (78.29%), Postives = 293/327 (89.60%), Query Frame = 1
Query:    1 ISNSAIADTYGIRKNXXXXXXXXXXXXXXXVFNMIKFLYDHEIAVYISFTVLAVASMVITISGSMLLLDSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFLENLHMDEIPVGSYKIYHKVFVAPLAXXXXXXXXXXXXXGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGLSLLTHFPLVKYAAANQHPLIINYILIACPALSLLHPI 981
            ISNSAIADTYGIRKNLMISILSGLSGSSLLVFN+IKFLYDH IAVYISFTVLAVASM+ITI+ S+ LLDSIRLPSI+  +N  S DIP+YSENEMEHRTFVK IN KRQDYL+KTFP LSKAI+SRLY+ ++++YI+ITYRLNFFLSQLASQLNYLFP+   L++H KFYCNIFLALN FG+F +GILIDY+LK+ANI LENLH++EIPV  ++IYHK +V P  + S S+II+SCLIGIAN++VFYGIF   CIGRSF  CL+G+YILNVFPKQYFGSL AI+VLLSGLSLLTHFPLVKYAAANQHPLIINY+LIACP LSL+HPI
Sbjct:  181 ISNSAIADTYGIRKNLMISILSGLSGSSLLVFNIIKFLYDHGIAVYISFTVLAVASMMITITSSIFLLDSIRLPSIISSRNDESVDIPYYSENEMEHRTFVKEINEKRQDYLVKTFPTLSKAITSRLYITHLVFYIMITYRLNFFLSQLASQLNYLFPRRFTLIDHFKFYCNIFLALNFFGAFFIGILIDYNLKRANIILENLHLEEIPVKKFRIYHKAYVVPFMVASFSIIIASCLIGIANRYVFYGIFTLVCIGRSFTGCLLGSYILNVFPKQYFGSLVAISVLLSGLSLLTHFPLVKYAAANQHPLIINYMLIACPILSLIHPI 507          
BLAST of Slc43a-4 vs. TrEMBL
Match: A0A0H3YFM8 (Slc43a-5 OS=Schmidtea mediterranea OX=79327 GN=slc43a-5 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 3.094e-62
Identity = 131/329 (39.82%), Postives = 206/329 (62.61%), Query Frame = 1
Query:    7 NSAIADTYGIRKNXXXXXXXXXXXXXXXVFNMIKFLYDHEIAVYISFTVLAVASMVITISGSMLLL----DSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFLENLHMDEIPVGSYKIYHKVFVAPLAXXXXXXXXXXXXXGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGLSLLTHFPLVKYAAANQHPLIINYILIACPALSLLHPI 981
            N ++AD +G  KNLMISI SG+ GSS+LVF MI  LY   + +Y SFTVLA++S++  I  S  +L     ++ +PS        ++D     ++E   +  +  +   RQ +L+  FP + KA  S+ Y++NML++ +  YRL FFLSQ+ SQL YLF  D+A+V+ L+F  N+F A  +F S   G+L+D+ LK     +   +M +     + +Y +V++ P  +C+ ++ I S L+GI N++V+Y IF   CIGRSF  CL+G++I++ FPK+YFG+L  IT+L SG+  L+     K A  +++PL++NY +I+CP +S LHPI
Sbjct:  147 NFSLADNFGSHKNLMISIESGVMGSSMLVFTMISLLYSIGVPLYGSFTVLAISSLITIICSSYFVLPYFIRTVDIPSFKSNYETITQDD---FKDEEAKQELIVTMGLHRQRFLMNCFPTIWKAFFSKRYILNMLFFSMTLYRLIFFLSQMGSQLTYLFKNDMAMVKKLQFQSNLFFAFGIFASLFSGLLLDFQLKNTTAKVMKFYMTKQSDKHFYLYDQVYIIPCLMCATAIFIPSLLVGIPNQYVYYMIFVLFCIGRSFNACLLGSFIISSFPKKYFGTLVGITILFSGVINLSQILFNKLATPDKYPLVVNYAMISCPIISFLHPI 472          
BLAST of Slc43a-4 vs. TrEMBL
Match: A0A0H3YJM1 (Slc43a-7 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc43a-7 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.293e-16
Identity = 78/243 (32.10%), Postives = 127/243 (52.26%), Query Frame = 1
Query:  172 VITISGSMLLLDSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILID----YSLKKANIFLENLHMDEIPVGSYKIYHKVFVAPLAXXXXXXXXXXXXXGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSG-LSLLTH 885
            VI I GS+ +L + R   ++ K  G  E++   S N   +    K IN      + +TFP +   + S  Y++ M Y+ ++ +R  FFLSQ++S  +YLFP D A+  HL    N F   ++  S   G+L+D    Y++K      EN    E P   Y   ++ F  P  ICS ++I+SS L+ ++N++ FY +F    + +S +  +  +YI + FPK+YFG+L     L +G L+LL  
Sbjct:  176 VIIILGSLTILKN-RANEVISKDKG--EEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSILISPIFGVLLDKYQKYTIKS---LAEN--KVESPREIYNRVNRCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQ 410          
BLAST of Slc43a-4 vs. TrEMBL
Match: A0A3Q0KSI6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.405e-14
Identity = 69/214 (32.24%), Postives = 112/214 (52.34%), Query Frame = 1
Query:  259 IPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFLENLHM-DEIPVGSYKIYHKV---FVAPLAXXXXXXXXXXXXXGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGL-SLLTH 885
            + +  E+ +E  + V + + +  + + + FP L K I S  Y +  L+ IL  +R   FLSQL  QL +LFP D  LVEHL    ++F     F +   G++ID SL+++   + N+ + ++  V + ++Y+      V  L I  I  +I S ++ IAN    Y  F    I RS +     +Y+L  FP +YFG+L  I+  ++GL SLL H
Sbjct:    3 LSYSKESCLEESSSVDV-DKELSNVIDERFPTLRKCIFSASYALINLWLILGLFRFAIFLSQLYRQLFHLFPTDEKLVEHLLEVSSVFSMCGFFAAPISGVIIDLSLRRSRDKVANMLISNKFNVSNREMYYNYICGLVPALTIMGIFAVILSAMMFIANTVAIYTAFVCLVIVRSIMFSAFVSYLLTGFPIRYFGTLNGISSAMAGLFSLLQH 215          
BLAST of Slc43a-4 vs. TrEMBL
Match: A0A4Z2CQ55 (Solute carrier family 43 member 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_008422 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.889e-14
Identity = 84/278 (30.22%), Postives = 137/278 (49.28%), Query Frame = 1
Query:  142 SFTVLAVASMVITISGSMLLLDSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFLENLHMD-EIPVGSYKIYHKV---FVAPLAXXXXXXXXXXXXXGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGL-SLLTH-FPLVKYAAANQHPLIINYILIACP 957
            SF  LA+ S+++ I  ++ +L    +      +    E I    E+ +E  + V I + +  + + + FP L K + S  Y +  L+++L  +R   FLSQL  QL YLFP D  LV+HL    ++F       +   G++ID SL++    + N+ ++ +  + + K+Y+      V  L I SI  II S ++ I NK   Y  F    I RS +     +Y+L  FP +YFG+L  I+  ++GL SLL H F     + AN   L+ +  L   P
Sbjct:  185 SFVSLAIGSLIMGIFIALFVLSKKSVDMAKFARVNEKESIFRSRESCLEESSSVDI-DKELSNVINERFPTLKKCVFSASYALINLWFLLGLFRFAMFLSQLYKQLVYLFPTDQQLVDHLLEVSSVFSMCGFLVAPISGLIIDLSLRRTRDKVANMLINSKFNLSNKKMYYTYICGLVPALIIMSIFAIILSAMMFIPNKTAIYTAFVCLVIVRSLLFSSFVSYLLTGFPIRYFGTLNGISSAIAGLFSLLQHIFLHTSGSVANSVSLVASISLFIAP 461          
BLAST of Slc43a-4 vs. Planmine SMEST
Match: SMESG000051639.1 (SMESG000051639.1)

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 327/328 (99.70%), Postives = 327/328 (99.70%), Query Frame = 1
Query:    1 ISNSAIADTYGIRKNXXXXXXXXXXXXXXXVFNMIKFLYDHEIAVYISFTVLAVASMVITISGSMLLLDSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFLENLHMDEIPVGSYKIYHKVFVAPLAXXXXXXXXXXXXXGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGLSLLTHFPLVKYAAANQHPLIINYILIACPALSLLHPII 984
            ISNSAIADTYGIRKNLMISILSGLSGSSLLVFNMIKFLYDHEIAVYISFTVLAVASMVITISGSMLLLDSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFLENLHMDEIPVGSYKIYHKVFVAPLAICSISLIISSCLIGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGLSLLTHFPLVKYAA NQHPLIINYILIACPALSLLHPII
Sbjct:  119 ISNSAIADTYGIRKNLMISILSGLSGSSLLVFNMIKFLYDHEIAVYISFTVLAVASMVITISGSMLLLDSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFLENLHMDEIPVGSYKIYHKVFVAPLAICSISLIISSCLIGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGLSLLTHFPLVKYAATNQHPLIINYILIACPALSLLHPII 446          
BLAST of Slc43a-4 vs. Planmine SMEST
Match: SMESG000051637.1 (SMESG000051637.1)

HSP 1 Score: 457.988 bits (1177), Expect = 1.125e-159
Identity = 256/327 (78.29%), Postives = 293/327 (89.60%), Query Frame = 1
Query:    1 ISNSAIADTYGIRKNXXXXXXXXXXXXXXXVFNMIKFLYDHEIAVYISFTVLAVASMVITISGSMLLLDSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFLENLHMDEIPVGSYKIYHKVFVAPLAXXXXXXXXXXXXXGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGLSLLTHFPLVKYAAANQHPLIINYILIACPALSLLHPI 981
            ISNSAIADTYGIRKNLMISILSGLSGSSLLVFN+IKFLYDH IAVYISFTVLAVASM+ITI+ S+ LLDSIRLPSI+  +N  S DIP+YSENEMEHRTFVK IN KRQDYL+KTFP LSKAI+SRLY+ ++++YI+ITYRLNFFLSQLASQLNYLFP+   L++H KFYCNIFLALN FG+F +GILIDY+LK+ANI LENLH++EIPV  ++IYHK +V P  + S S+II+SCLIGIAN++VFYGIF   CIGRSF  CL+G+YILNVFPKQYFGSL AI+VLLSGLSLLTHFPLVKYAAANQHPLIINY+LIACP LSL+HPI
Sbjct:  180 ISNSAIADTYGIRKNLMISILSGLSGSSLLVFNIIKFLYDHGIAVYISFTVLAVASMMITITSSIFLLDSIRLPSIISSRNDESVDIPYYSENEMEHRTFVKEINEKRQDYLVKTFPTLSKAITSRLYITHLVFYIMITYRLNFFLSQLASQLNYLFPRRFTLIDHFKFYCNIFLALNFFGAFFIGILIDYNLKRANIILENLHLEEIPVKKFRIYHKAYVVPFMVASFSIIIASCLIGIANRYVFYGIFTLVCIGRSFTGCLLGSYILNVFPKQYFGSLVAISVLLSGLSLLTHFPLVKYAAANQHPLIINYMLIACPILSLIHPI 506          
BLAST of Slc43a-4 vs. Planmine SMEST
Match: SMESG000051641.1 (SMESG000051641.1)

HSP 1 Score: 216.083 bits (549), Expect = 8.604e-66
Identity = 131/329 (39.82%), Postives = 206/329 (62.61%), Query Frame = 1
Query:    7 NSAIADTYGIRKNXXXXXXXXXXXXXXXVFNMIKFLYDHEIAVYISFTVLAVASMVITISGSMLLL----DSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFLENLHMDEIPVGSYKIYHKVFVAPLAXXXXXXXXXXXXXGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGLSLLTHFPLVKYAAANQHPLIINYILIACPALSLLHPI 981
            N ++AD +G  KNLMISI SG+ GSS+LVF MI  LY   + +Y SFTVLA++S++  I  S  +L     ++ +PS        ++D     ++E   +  +  +   RQ +L+  FP + KA  S+ Y++NML++ +  YRL FFLSQ+ SQL YLF  D+A+V+ L+F  N+F A  +F S   G+L+D+ LK     +   +M +     + +Y +V++ P  +C+ ++ I S L+GI N++V+Y IF   CIGRSF  CL+G++I++ FPK+YFG+L  IT+L SG+  L+     K A  +++PL++NY +I+CP +S LHPI
Sbjct:  147 NFSLADNFGSHKNLMISIESGVMGSSMLVFTMISLLYSIGVPLYGSFTVLAISSLITIICSSYFVLPYFIRTVDIPSFKSNYETITQDD---FKDEEAKQELIVTMGLHRQRFLMNCFPTIWKAFFSKRYILNMLFFSMTLYRLIFFLSQMGSQLTYLFKNDMAMVKKLQFQSNLFFAFGIFASLFSGLLLDFQLKNTTAKVMKFYMTKQSDKHFYLYDQVYIIPCLMCATAIFIPSLLVGIPNQYVYYMIFVLFCIGRSFNACLLGSFIISSFPKKYFGTLVGITILFSGVINLSQILFNKLATPDKYPLVVNYAMISCPIISFLHPI 472          
BLAST of Slc43a-4 vs. Planmine SMEST
Match: SMESG000075262.1 (SMESG000075262.1)

HSP 1 Score: 109.383 bits (272), Expect = 3.314e-26
Identity = 87/272 (31.99%), Postives = 142/272 (52.21%), Query Frame = 1
Query:  172 VITISGSMLLLDSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILID----YSLKKANIFLENLHMDEIPVGSYKIYHKVFVAPLAXXXXXXXXXXXXXGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGLSLLTHFPLVKYAAANQHPLIINYILIACPALSLLH 975
            VI I GS+ +L + R   ++ K  G  E++   S N   +    K IN      + +TFP +   + S  Y++ M Y+ ++ +R  FFLSQ++S  +YLFP D A+  HL    N F   ++F S   G+L+D    Y++K      EN    E P   Y   +  F  P  ICS ++I+SS L+ ++N++ FY +F    + +S +  +  +YI + FPK+YFG+L     L +G   L    ++ +AAA+  P ++NYIL+     +L H
Sbjct:  189 VIIILGSLTILKN-RANEVISKDKG--EEVNIESINTESNPEGNKHINDLYNQSVEETFPTVKACVLSPEYLIQMAYFAIMLFRFTFFLSQMSSHFSYLFPTDQAIANHLLSVSNTFFIGSIFISPIFGVLLDKYQKYTIKS---LAEN--KVESPREIYNRVNGCFFVPSIICSCAMIVSSSLMFVSNQYSFYVVFSSITVMKSLLFAINASYIFSAFPKKYFGTLIGAVFLTTGFLNLLQQVIIPFAAADSRPDLVNYILLGVCLTTLAH 452          
BLAST of Slc43a-4 vs. Planmine SMEST
Match: SMESG000005041.1 (SMESG000005041.1)

HSP 1 Score: 107.842 bits (268), Expect = 9.332e-26
Identity = 98/335 (29.25%), Postives = 176/335 (52.54%), Query Frame = 1
Query:    1 ISNSAIADTYGIRKNXXXXXXXXXXXXXXXVFNMIKFLYDHEIAVY---ISFTVLAV----ASMVITISGSMLLLDSIRLPSIMVKKNGSSEDIPFYSENEMEHRTFVKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLASQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFLENLHMDEIPVGSYKIYHKV---FVAPLAXXXXXXXXXXXXXGIANKFVFYGIFCFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGLSLLTHFPLVKYAAANQHPLIINYILIACPALSLLH 975
            I+N +++  +  R+NL+IS  S L  +S +V  +IK+L+D     +   +S+    V     S++I    +  LL   +     +    + ++  F  +N +  + ++K    +  +   ++FP +   I S  Y + + Y+ ++ +R  FFLSQL+SQL+YLFP  LA+ +HL   CN+F   ++F S   GIL+D   K  N     L M +  + + K+Y++V   F  P  +CS+++I+   L+ I     FY +F    I +S ++ + G+Y+ + FPK++FG+L  +  L +    L    L+ YAA   +P ++NYIL+    L+L H
Sbjct:  133 IANISLSVIFKDRQNLLISFYSSLFDTSAIVMTLIKYLFDFGALFWLVCVSYGCFGVFIILGSVIILKDRAQNLLAYSKTTEYSLSPISTIKETVFSDKNSLASQEYLKHFYERSVE---ESFPTIKSCILSTEYAIQIFYFDILLFRFTFFLSQLSSQLDYLFPNKLAISDHLLTICNVFFIGSIFISPIFGILLD---KYQNYTFVYLSMYKC-ISARKVYNEVNACFCLPSIVCSLTIIVGLSLMFIPKVISFYFVFVSMTIAKSLLLNINGSYMFSAFPKRFFGTLIGLNFLTTSFCNLFQQLLIHYAAPGANPDLVNYILLGFCILTLSH 460          
The following BLAST results are available for this feature:
BLAST of Slc43a-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJG64.088e-15678.29Slc43a-4 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YFM83.094e-6239.82Slc43a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJM13.293e-1632.10Slc43a-7 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A3Q0KSI62.405e-1432.24Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2CQ553.889e-1430.22Solute carrier family 43 member 3 OS=Schistosoma j... [more]
back to top
BLAST of Slc43a-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Slc43a-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051639.10.000e+099.70SMESG000051639.1[more]
SMESG000051637.11.125e-15978.29SMESG000051637.1[more]
SMESG000051641.18.604e-6639.82SMESG000051641.1[more]
SMESG000075262.13.314e-2631.99SMESG000075262.1[more]
SMESG000005041.19.332e-2629.25SMESG000005041.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008501 ID=SMED30008501|Name=Slc43a-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1087bp
ATATCTAATTCCGCTATTGCCGACACTTATGGGATTAGGAAAAACCTTAT
GATATCCATTCTGAGTGGTTTGTCAGGGTCTTCACTGCTAGTATTTAATA
TGATTAAATTTTTATATGATCACGAAATTGCTGTATATATTTCATTCACG
GTTCTTGCTGTTGCATCAATGGTGATTACAATTTCTGGTTCTATGTTACT
CTTAGACAGTATTCGTTTGCCTTCAATTATGGTCAAGAAGAATGGTAGTA
GTGAAGACATTCCATTCTATTCGGAAAACGAAATGGAACATAGGACGTTT
GTCAAGATAATTAACGCAAAAAGACAGGACTATTTATTGAAAACTTTCCC
AAAGCTTTCAAAGGCCATTTCCAGTAGGTTATACGTCATGAATATGCTGT
ATTATATATTAATAACTTATAGGTTAAATTTTTTCTTATCTCAATTGGCA
TCACAATTGAATTATTTATTCCCAAAAGACCTCGCTCTTGTTGAGCATTT
AAAATTTTATTGTAACATTTTTCTAGCTTTGAACCTATTTGGGTCCTTCT
GCGTCGGAATCCTCATTGACTACAGTTTGAAGAAAGCAAATATTTTTCTA
GAAAATTTGCATATGGATGAAATTCCTGTGGGGAGTTACAAAATTTACCA
CAAAGTATTTGTCGCTCCCTTGGCCATTTGTAGCATTTCACTTATAATCT
CTTCATGCCTCATTGGAATAGCGAATAAGTTTGTTTTTTATGGGATATTT
TGTTTTACTTGTATTGGACGTTCATTTATTATTTGTTTAATTGGCGCGTA
TATTCTGAATGTGTTTCCCAAGCAATATTTCGGCAGCCTGGCAGCAATCA
CAGTTCTTCTCTCGGGACTTTCACTTTTAACTCATTTTCCTTTGGTTAAA
TACGCTGCCGCAAATCAGCATCCGTTAATAATTAATTATATATTAATAGC
CTGCCCAGCGTTGTCATTGTTGCATCCGATTATCTTGTATTTTGAATAAT
TTTATTTTTATGTCTTGTTGATGTATTTGCAGGGATTTTTATTCAAATCT
TCAATTATATTTATTATCGAATTGTTTTACTGTGGTT
back to top

protein sequence of SMED30008501-orf-1

>SMED30008501-orf-1 ID=SMED30008501-orf-1|Name=SMED30008501-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=333bp
ISNSAIADTYGIRKNLMISILSGLSGSSLLVFNMIKFLYDHEIAVYISFT
VLAVASMVITISGSMLLLDSIRLPSIMVKKNGSSEDIPFYSENEMEHRTF
VKIINAKRQDYLLKTFPKLSKAISSRLYVMNMLYYILITYRLNFFLSQLA
SQLNYLFPKDLALVEHLKFYCNIFLALNLFGSFCVGILIDYSLKKANIFL
ENLHMDEIPVGSYKIYHKVFVAPLAICSISLIISSCLIGIANKFVFYGIF
CFTCIGRSFIICLIGAYILNVFPKQYFGSLAAITVLLSGLSLLTHFPLVK
YAAANQHPLIINYILIACPALSLLHPIILYFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR20772FAMILY NOT NAMEDcoord: 1..331
NoneNo IPR availablePANTHERPTHR20772:SF2PROTEIN FMP42coord: 1..331
NoneNo IPR availableTMHMMTMhelixcoord: 246..268
NoneNo IPR availableTMHMMTMhelixcoord: 45..67
NoneNo IPR availableTMHMMTMhelixcoord: 16..35
NoneNo IPR availableTMHMMTMhelixcoord: 309..331
NoneNo IPR availableTMHMMTMhelixcoord: 277..299
NoneNo IPR availableTMHMMTMhelixcoord: 219..241
NoneNo IPR availableTMHMMTMhelixcoord: 169..189
NoneNo IPR availableTMHMMTMhelixcoord: 127..149
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 20..329