Cyclic nucleotide gated cation channel

Overview
NameCyclic nucleotide gated cation channel
Smed IDSMED30008477
Length (bp)2185
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclic nucleotide gated cation channel (SMED30008477) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclic nucleotide gated cation channel (SMED30008477) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclic nucleotide gated cation channel (SMED30008477) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclic nucleotide gated cation channel (SMED30008477) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008477

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008477SMESG000033757.1 SmedASXL_007765SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008477SMESG000033757.1 SmedASXL_010741SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30008477SMESG000033757.1 dd_Smed_v6_26043_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30008477SMESG000033757.1 dd_Smed_v6_66610_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30008477SMESG000033757.1 dd_Smed_v6_47393_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30008477SMESG000033757.1 OX_Smed_1.0.10955ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30008477SMESG000033757.1 Contig53957newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30008477SMESG000033757.1 Contig53957uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Human
Match: CNGB1 (cyclic nucleotide gated channel subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:2151])

HSP 1 Score: 373.629 bits (958), Expect = 7.178e-114
Identity = 214/578 (37.02%), Postives = 329/578 (56.92%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRP-ITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFK-LPSFETIFLHTFES-RNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKI-----WNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKL 1948
            INDRL+ + + F ER E VK ++I P +T + +    +P +  P+ +          PD +  E   +        +   C FK  P  +  F  + +   N  Y++WL    +A  +N   IP+R     + +PY+       W + DY+ D IY LDI +FQ RLQ++  G I  + K    NY+K  +FKM++LS++P D   L +      LRL R  K   FFE    L+ ++   ++ R ++T +Y++Y +H  +C YY  S + G  S  +V+       ++YI C+Y+A+KT  +IG  P P    E  F  + + +G+F F+V+IGQ+RD+  AA A QT YR  MD+T+ YM    + +S+  +V  W+ Y W     LDE+ L+  LP K++ DLAI  ++N +SKV+LFQ C+R ++ D++ +LR V++LPND++CKKGEIG EMYI+  GQV+V+GGP+   V  TLK GSVFGEISLLA+ GGNRRTA+V + GF+ LF L K+D  E +  YP + +LL+ KA ++L       N+  KE +  +++P +  T  L    L +
Sbjct:  558 INDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPEPA----------PDTKPAEA--EPVEEEHYCDMLCCKFKHRPWKKYQFPQSIDPLTNLMYVLWLFFVVMAWNWNCWLIPVR-----WAFPYQTPDNIHHWLLMDYLCDLIYFLDITVFQTRLQFVRGGDIITDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKV-GVNPLLRLPRCLKYMAFFEFNSRLESILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYD---GVGNSYIRCYYFAVKTLITIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLR-----SNNKPKEEKSVLILPPRAGTPKLFNAALAM 1109          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Human
Match: CNGB1 (cyclic nucleotide gated channel subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:2151])

HSP 1 Score: 373.629 bits (958), Expect = 9.704e-114
Identity = 214/578 (37.02%), Postives = 329/578 (56.92%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRP-ITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFK-LPSFETIFLHTFES-RNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKI-----WNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKL 1948
            INDRL+ + + F ER E VK ++I P +T + +    +P +  P+ +          PD +  E   +        +   C FK  P  +  F  + +   N  Y++WL    +A  +N   IP+R     + +PY+       W + DY+ D IY LDI +FQ RLQ++  G I  + K    NY+K  +FKM++LS++P D   L +      LRL R  K   FFE    L+ ++   ++ R ++T +Y++Y +H  +C YY  S + G  S  +V+       ++YI C+Y+A+KT  +IG  P P    E  F  + + +G+F F+V+IGQ+RD+  AA A QT YR  MD+T+ YM    + +S+  +V  W+ Y W     LDE+ L+  LP K++ DLAI  ++N +SKV+LFQ C+R ++ D++ +LR V++LPND++CKKGEIG EMYI+  GQV+V+GGP+   V  TLK GSVFGEISLLA+ GGNRRTA+V + GF+ LF L K+D  E +  YP + +LL+ KA ++L       N+  KE +  +++P +  T  L    L +
Sbjct:  564 INDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPEPA----------PDTKPAEA--EPVEEEHYCDMLCCKFKHRPWKKYQFPQSIDPLTNLMYVLWLFFVVMAWNWNCWLIPVR-----WAFPYQTPDNIHHWLLMDYLCDLIYFLDITVFQTRLQFVRGGDIITDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKV-GVNPLLRLPRCLKYMAFFEFNSRLESILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYD---GVGNSYIRCYYFAVKTLITIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLR-----SNNKPKEEKSVLILPPRAGTPKLFNAALAM 1115          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Human
Match: CNGB3 (cyclic nucleotide gated channel subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:2153])

HSP 1 Score: 353.984 bits (907), Expect = 5.003e-110
Identity = 214/603 (35.49%), Postives = 340/603 (56.38%), Query Frame = 2
Query:  230 LINEKINDRLRNIHRKFSERIESVKSQIIRP--ITPETDDESKNPKENGP-KDSNVKADE---------IKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKI-----WNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENRRQSSMAR 1981
            +INE  + +L N+ ++  +R    K +++     +PE   ++  P    P K+S+ K  E         +KK P  E L              KRI   KLP+  +I  +T    +R YL+WLL+  +A  +N   IPLR  F     PY+       W + D + D IY+ D+L  Q RLQ++  G I ++      +Y   +KF+++V SIIP D+  L         R  R+ K  +FFE    L+ ++   +I R ++T  Y+++++H  AC YY  S + G  +  +V+     + + Y+ C+YWA++T  +IG  P P    E  F  + + SG+FVF+ LIGQ+RD+  AA ANQ  +R  MD TI YM N ++ + + K+V  W+ Y W+  + LDE+ L+++LPT ++  LAI  +F+ +SKV LF+ C+  ++ D++L+L+ VL+LP DF+CKKGEIG EMYI+  G+V+V+GGP+ + V  TLK GSVFGEISLLA  GGNRRTA+V + GF+ L +L K+  +E +  YP +  +L  KA  +L +      +T    ++ ++ P K++T  L +T   L+    ++S+AR
Sbjct:  123 VINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEASPQTAKPTAVPPVKESDDKPTEHYYRLLWFKVKKMPLTEYL--------------KRI---KLPN--SIDSYT----DRLYLLWLLLVTLAYNWNCCFIPLRLVF-----PYQTADNIHYWLIADIICDIIYLYDMLFIQPRLQFVRGGDIIVDSNELRKHYRTSTKFQLDVASIIPFDICYLFF-GFNPMFRANRMLKYTSFFEFNHHLESIMDKAYIYRVIRTTGYLLFILHINACVYYWASNYEGIGTTRWVYD---GEGNEYLRCYYWAVRTLITIGGLPEPQTLFEIVFQLLNFFSGVFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRVRTWYEYTWDSQRMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKGCDTQMIYDMLLRLKSVLYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGGGNRRTANVVAHGFANLLTLDKKTLQEILVHYPDSERILMKKARVLLKQKAKTAEATPPRKDLALLFPPKEETPKLFKT---LLGGTGKASLAR 690          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Human
Match: CNGA2 (cyclic nucleotide gated channel subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:2149])

HSP 1 Score: 340.117 bits (871), Expect = 2.129e-106
Identity = 180/470 (38.30%), Postives = 272/470 (57.87%), Query Frame = 2
Query:  518 LHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRL--FKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPD-QYS----AYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVI-ENSTKKESEIEI 1894
            L   +    +Y  WL V  + V+YN+  +  R CF      Y  +W V DYV+D +YI D L  + R  +L  G++  + K    NY+   +FK++V SIIPTDL    +  H   +R  RL  F   FE FD  +      +I R    + YI+ +IH+ AC YY  SK IGF  D++V+    D +Y      YIYC YW+  T T+IG  P P    EY F+   +L G+ +FA ++G +  +    NA +  ++ K+D    YM+   +S+ M  KVI WF+Y W + KT+DE  ++++LP KL++++AI+ H +TL KV +F DCE  LL +L+LKLRP +F P D+IC+KG+IG EMYI+  G++ VV   +    +A L  GS FGEIS+L + G   GNRRTA+++S G+S LF LSK D  EA+ +YP A ++L+ +  ++L +  ++ EN      E+++
Sbjct:  130 LFVLDPAGDWYYCWLFVIAMPVLYNWCLLVARACFSDLQKGYYLVWLVLDYVSDVVYIAD-LFIRLRTGFLEQGLLVKDTKKLRDNYIHTLQFKLDVASIIPTDLIYFAVDIHSPEVRFNRLLHFARMFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIYYAISKSIGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKGMEAKVIRWFDYLWTNKKTVDEREILKNLPAKLRAEIAINVHLSTLKKVRIFHDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVV-ADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDV 597          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Human
Match: CNGA3 (cyclic nucleotide gated channel subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:2150])

HSP 1 Score: 338.191 bits (866), Expect = 2.800e-105
Identity = 188/511 (36.79%), Postives = 292/511 (57.14%), Query Frame = 2
Query:  359 KENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRL--FKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFS----PAPDQYS-AYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIE 1861
            KE   ++SN +A+   + P +      P     +   N      K    + I +    S N YY  WL    + V YN+  +  R CF+     Y  +W V DY AD +Y+LD+L+ + R  +L  G++  +      +Y   ++FK++VLS++PTDL  L +  +   +R  RL  F   FE FD  +      ++ R    + YI+ +IH+ AC Y+  SKFIGF +DS+V+     P   + S  YIY  YW+  T T+IG  P P    EY F+ V +L G+ +FA ++G +  +    NA++  ++ K+D+   YM+   +++ +  +VI WF+Y W + KT+DE  +++SLP KLK+++AI+ H +TL KV +FQDCE  LL +L+LKLRP +F P D+ICKKG+IG EMYI+  G++ VV   +    F  L +GS FGEIS+L + G   GNRRTA+++S G+S LF LSK D  EA+ +YP A + L+ K  ++L +  +I+
Sbjct:  108 KEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDP--SSNLYY-RWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLV-RARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYLKVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISIPEHGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVV-ADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLID 613          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Celegans
Match: tax-2 (TAX2 [Source:UniProtKB/TrEMBL;Acc:G5EEE2])

HSP 1 Score: 400.593 bits (1028), Expect = 2.364e-128
Identity = 216/567 (38.10%), Postives = 323/567 (56.97%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKI-----WNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPA--------PDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKK---ESEIE 1891
            + +RL +I ++   R  +V+  +IR          + P++     SNV      +P     + L  + +  ++   K    F L         TF    R+Y+ WL +  +  ++N   IPLR      +YPY+       W + DY  D +Y++D+LL + RL++   GI    +K    +Y+    FK+++LSI+PTDL            R+ R+ K  +F+ LFD+LD+   + + +R  +T+SY+IY+IH  +C YY  S    F   +++ +           +Q +AYI CFY+    ATS GNNP+PT   EY +M   W+ G+FVFA+L+GQIRDI   AN N+  +++KMD  +   K L L      +V  WF Y W+  KTLDE  LIE LP KL++DLA+  H+ TLSKV LFQDC+R LL DL+LKLRPV+FLP D IC KG++G EMYI+  G ++VVGG +N  +FA L +G+VFGEISLLA+ G NRRTA +++KG+ TLF L+K+D  + +  YP A  +L+ KA  +L   K  +  T+K   ++E+E
Sbjct:  137 MRERLHSIAKEVHRRTSAVREDLIR----------ETPEDTVSMASNVPKQNEHRPSLMSLIGLQNRSESPTVDTVKNCFGFSLKG-------TFHPYGRFYMTWLSLVTLCFLFNAFCIPLRS-----SYPYQTADNWMYWFIVDYSCDLVYVIDMLLIKPRLRFTRGGIQVKIYKDTQRHYLMTRTFKLDILSILPTDLMYFFF-GKMPIWRINRVLKINSFWLLFDMLDNSFANPYAIRIARTLSYMIYIIHCNSCVYYKLSALQAFGQIAYLENGKWYLNKWVYNNQGNAYIRCFYFTAAVATSTGNNPAPTNVIEYIYMTCSWMMGVFVFALLLGQIRDIVSNANRNREEFQRKMDLALGECKKLGLKMETTNRVRDWFIYTWQQQKTLDEKKLIEKLPLKLQTDLALSVHYTTLSKVQLFQDCDRALLRDLVLKLRPVIFLPGDMICLKGDVGKEMYIINQGILQVVGGDHNEKIFAELAQGAVFGEISLLAIGGNNRRTASIRAKGYCTLFVLAKEDLNDVIRYYPQAQTILRRKAAAMLKNDKKSDEKTEKIKAQAELE 680          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Celegans
Match: tax-4 (Cyclic nucleotide-gated cation channel [Source:UniProtKB/Swiss-Prot;Acc:Q03611])

HSP 1 Score: 274.633 bits (701), Expect = 1.972e-81
Identity = 160/472 (33.90%), Postives = 268/472 (56.78%), Query Frame = 2
Query:  566 VSYVAVMYNFLTIPLRECFEIYNYP---------YEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFV-----LILKNHKAALRLTRL--FKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFS-----PAPDQYS-----AYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVI-ENSTKKESEIE 1891
             + V   YN LT  ++E      YP         +  +W  FD + D +Y++D  L  +R+ Y++ G++    +     Y +  +++++ +S+IP D  +      I       LRL RL  +K      +  +      +  R V  + YI+ +IH+ AC Y+  S++IG  +D++V+        PD  +      Y+Y FYW+    T+IG  PSP    EY F+ +  + G+ +FA ++G +  +    +A +T ++ KMD    YM+   +S+ +  +VI WF+Y W + ++L +  +++ LP KL++++A+  HF TL KV +FQDCE  LL++L+LKL+  +F P DFICKKG+IG EMYIV  G+++VV   +   VF TL+EGSVFGE+S+L ++G   GNRRTA+V+S G++ LF LSK D   A+ +YP A +LL  K  ++L +  ++ EN+ +++  +E
Sbjct:  167 TTQVECTYNMLT-NMKEMPTYSQYPDLGWSKYWHFRMLWVFFDLLMDCVYLIDTFL-NYRMGYMDQGLVVREAEKVTKAYWQSKQYRIDGISLIPLDYILGWPIPYINWRGLPILRLNRLIRYKRVRNCLERTETRSSMPNAFRVVVVVWYIVIIIHWNACLYFWISEWIGLGTDAWVYGHLNKQSLPDDITDTLLRRYVYSFYWSTLILTTIGEVPSPVRNIEYAFVTLDLMCGVLIFATIVGNVGSMISNMSAARTEFQNKMDGIKQYMELRKVSKQLEIRVIKWFDYLWTNKQSLSDQQVLKVLPDKLQAEIAMQVHFETLRKVRIFQDCEAGLLAELVLKLQLQVFSPGDFICKKGDIGREMYIVKRGRLQVVDD-DGKKVFVTLQEGSVFGELSILNIAGSKNGNRRTANVRSVGYTDLFVLSKTDLWNALREYPDARKLLLAKGREILKKDNLLDENAPEEQKTVE 635          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Celegans
Match: cng-1 (Cyclic Nucleotide Gated channel [Source:UniProtKB/TrEMBL;Acc:A8WI01])

HSP 1 Score: 194.126 bits (492), Expect = 8.451e-53
Identity = 154/555 (27.75%), Postives = 260/555 (46.85%), Query Frame = 2
Query:  530 ESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKTFFELFDV---LDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFS----------------------------------SDSFVFSPAPD---QYSAYIYCFYWAMKTAT----------------------SIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKT-LDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGG---NRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKL--MENRRQSSMARDNE 1990
            E  N +YL   LVS VA+  + L       F+   +P+ +     + + D + ILD L+   R++Y+ NG+   N      + +K + F ++V++++P +  + I  +     R+ RL K  + LFD     D    S H     K +   + + H+  C Y+  SK   ++                                  +D  + +  P+   Q++   Y   W  KT T                      ++G  PSP    +  F     L G+ +FAV++G + ++  A N  ++ +   +D    +M    +   + KK + +F Y W H    +DE  + E LP +L  ++A+  H +TL KV LF+ C+  LL +LILKL+  ++ P D+ICKKG++GTEMYIV  G VEVV     +I F TL  G VFGE+S+L + G    N RTA V+SKG+S L+ L K+D  EA+ +YP A + L  K  ++L + K+I+ +   + +     P +    +L   +LK+  M ++ +  + + N+
Sbjct:   75 EHSNTFYLWTGLVSLVAL--HPLVFTALSVFQDV-HPFLRNTGPLNLLLDLVNILD-LIAHTRIEYVENGVAVKNLSKLMHHRLKSTFFILDVIAVVPAES-LHIFGDSFFWSRINRLTKC-YRLFDFSTQTDTRTTSPHAFGLFKLIFICVVIFHWNGCLYFYISKVYNYTTARLEHWIFSYDKIINPILATCVTDIPNHRDFCDTDDLLITHLPENEVQFTVTDYMTTWENKTTTIKFANFFRQYALSFYWSALTLVTLGEQPSPCTTFQNAFEIGDTLLGLVIFAVIVGDVGNMVVAINLRKSEFENVLDGCKRFMVYRKVPNLLRKKAVEYFAYVWAHGGAQVDEEEIAEFLPPRLFGEIAVEIHMDTLKKVKLFESCDPRLLYELILKLQLRVYSPMDYICKKGDVGTEMYIVKEGFVEVVSEDGQTI-FVTLPAGFVFGELSILNIPGNKNKNLRTASVRSKGYSDLYVLDKEDLWEALHEYPQAKDSLIQKGIQILEKDKMIDPNMVDDEDESFNGPIEDYMEHLEHEILKITKMIDQAEDKIHKSNQ 622          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Celegans
Match: cng-2 (Cyclic Nucleotide Gated channel [Source:UniProtKB/TrEMBL;Acc:Q9N4C1])

HSP 1 Score: 174.866 bits (442), Expect = 1.774e-45
Identity = 140/575 (24.35%), Postives = 258/575 (44.87%), Query Frame = 2
Query:  353 NPKENGP-KDSNVKADEIKKPPDNEKLELPP--QEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNG-IIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAAL-RLTRLFKTF--FELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDS---------FVFSPA--------------PD------------QYSAYIYCFY---------------------WAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKE 1879
            + +E+ P +D+     EI    D   L  PP  Q+  T     K I + K      ++       + ++  W  +  + ++YN   + +   F+  ++ Y   W   +   DF ++LD L+   R+ +++ G  +    KM   NY +  + K+++L + P D ++ I  + KA+L R  RL K +  +E   +        H ++ +   S    L H+ AC Y+LFS + G + D           VF P               P+             Y   +Y F+                     W+  T T  G  P P+  ++        L G+ VFA +IG +  +    + N  ++R+ MD    YMK   +  ++  +V+  F Y   H++  DE  ++  LP   ++ +A + H +TLSKVSLF  C++ LL ++++ ++  ++ PND++C+K E   EM+IV  G + V+   +  +   +LKEG  FGE+S++ + G   G+RR+  ++S G+S ++ L + D    + +YP     L   A ++L+   ++E +   E
Sbjct:  166 DERESEPDRDATTTNAEITAADDRSILPSPPIFQQRQTGFTQIKDILTDKC---RKLYYFYVTENSTFFYYWTAIISIGILYNMFAMVIF-IFDDVHFGYFNQWLYVNLFFDFCFLLDCLV-GSRMTFVSEGNEVSQTDKMFK-NYRQSRRCKLDLLCLAPADFYLFI--DTKASLVRAIRLVKAYRLYEFIMLTQRRTDFPHFMKILFLTSSCAILFHWNACVYFLFSLYQGLTEDDPNAFGFSYYKVFDPRFSICDALYDQDCYYPEDTEVLDIRDERPHYMEDMYKFWDKKFNILQIGNFSREYSMTIYWSSLTITKCGQQPWPSKSSQNSLEIFDTLIGVLVFATIIGGVGSVVTQMSQNVNDFREMMDGIKFYMKYRGVQSAIQDRVLNCFLYLNSHNQLYDEEEILSLLPPFFQARIAANLHQDTLSKVSLFYKCDQRLLQEVVMLVKQQVYSPNDYLCRKNEKAKEMFIVKKGLLAVIDD-DTGVELDSLKEGHTFGELSIVQVKGNILGDRRSVSLRSVGYSDVYVLHQDDVTRLLQEYPEERVRLMENARRMLHSRGLLETNELGE 731          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Celegans
Match: che-6 (pep chromosome:WBcel235:IV:2104056:2111408:-1 gene:WBGene00000487.1 transcript:C23H5.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:che-6)

HSP 1 Score: 153.68 bits (387), Expect = 6.180e-39
Identity = 123/515 (23.88%), Postives = 220/515 (42.72%), Query Frame = 2
Query:  539 NRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWN--VFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYI------IYLIHFEACGYYLFSKFIGF---SSDSFVFS---------PAPDQY---------------------------------------------SAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKE 1879
            ++YY +W       VMYN   + +   F   +   +  WN    + + D ++I+DI + Q RL YL+ G    N K    NY      K+ V + I   L +  L     ++ L R  +   ++  ++D V ++     F +    I      I L H+ AC Y+LFS + G    S   F FS         P    Y                                               Y    YW+  T T+ G  P P+  ++        L G+ VFA +IG +  +    +     +R+ MD    YMK   ++ ++ ++ +  F Y   H++  DE  ++  LP +L++++A + H  TL  + +F  CE   + +++L ++  +F PND++C+K E   E++IV  G++ V+       +   L EG+ FGE+S++ + G   G RR   ++S GFS ++ L + D    + ++P  Y+ +   A  +L+   ++E +   E
Sbjct:   65 SKYYYIWSFFVSFGVMYNMFAMVI---FIFADIKTQYFWNWIFLNVMFDMVFIVDIFV-QSRLTYLHEGEEVKNTKKLRKNYFFQ---KLKVANDIFCLLPLDFLLFFDDSMSLVRTIR-IVKVIRLMDFVQRTQQQTTFPRAFKIILLAVSCIVLFHWNACLYFLFSLYEGITEESQTEFGFSYYKVFEPVFPTCQAYYDENCWFGEDIDHTLDLDDVRDSYKKEMAEYWKDKHYRWTTGNFSREYSMSIYWSALTITTCGQQPWPSTSSQNSLEVFDTLIGVLVFATIIGSVGSVVTQMSQTVNEFRQMMDGIKFYMKYREVNSAIQERALSCFMYLMAHNQLDDEEGILSLLPPRLQANIAANLHMETLQNIQIFALCESRFMHEVVLLVKQQVFSPNDYLCRKNEKAKELFIVKKGKLRVIDDDTGEEM-GELTEGATFGELSIVYVKGNLLGTRRCCSLQSVGFSDIYVLYRDDVSRLLQEFPQEYKTIVMNARNLLHSRGLLETTELGE 570          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Fly
Match: CngB (gene:FBgn0266346 transcript:FBtr0342961)

HSP 1 Score: 435.261 bits (1118), Expect = 1.599e-139
Identity = 210/445 (47.19%), Postives = 292/445 (65.62%), Query Frame = 2
Query:  521 HTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRH 1849
             T + + + Y+ WL V  ++ +YN   IPLR  F         IW   D+ AD IY+LD++ F+HR+ YL  G    N  +   NY++  +FK+++L+++P +L    L      LR  R FK  +F+E+F +LD V+ S H VR  KT++Y++Y+IH  A  YY +S + G   + +VFS    +   Y+ CF +A KTATSIG NP P    EY FM V WL G+FVFA+LIGQIRDI   A  N+  YR+  D T+ YM+ LNLS+ +  +V MWF + WE  +TLDE++++++LP  LK+D+AI  H  TLSKV LF DCE  LL DL+LKLR V FLP DF+C+KGE+G EMYIV  GQV+V+GGP++ +V ATL EGSVFGEISLL ++G +RRTADV+SKG+S LF LSK D  E +A YP A  +LK +A +++ ++
Sbjct:  406 RTLDPQGKIYISWLCVVSLSFLYNAWVIPLRASFPFQTKENTNIWLACDFCADIIYLLDVVFFKHRVMYLFEGFWVKNKNLTRKNYMRKLQFKLDLLALLPLELLYFKLGTQAVWLRFPRFFKIQSFWEVFRLLDRVISSPHFVRVAKTLTYMLYMIHITAALYYAYSDYQGLGQNRWVFS---GKGHPYVRCFAFATKTATSIGKNPKPERQGEYVFMTVAWLMGVFVFALLIGQIRDIISTATRNKHEYRQLEDETLEYMRRLNLSQEVQSRVKMWFQFTWEQQRTLDESNILDALPINLKTDIAISVHIQTLSKVQLFADCEEALLRDLVLKLRAVTFLPGDFVCRKGEVGREMYIVKLGQVQVMGGPSSDVVLATLTEGSVFGEISLLGINGADRRTADVRSKGYSNLFVLSKSDLNEVIAYYPTAQAILKKRARQLMRKN 847          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Fly
Match: CngB (gene:FBgn0266346 transcript:FBtr0071675)

HSP 1 Score: 435.647 bits (1119), Expect = 4.133e-139
Identity = 210/445 (47.19%), Postives = 292/445 (65.62%), Query Frame = 2
Query:  521 HTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRH 1849
             T + + + Y+ WL V  ++ +YN   IPLR  F         IW   D+ AD IY+LD++ F+HR+ YL  G    N  +   NY++  +FK+++L+++P +L    L      LR  R FK  +F+E+F +LD V+ S H VR  KT++Y++Y+IH  A  YY +S + G   + +VFS    +   Y+ CF +A KTATSIG NP P    EY FM V WL G+FVFA+LIGQIRDI   A  N+  YR+  D T+ YM+ LNLS+ +  +V MWF + WE  +TLDE++++++LP  LK+D+AI  H  TLSKV LF DCE  LL DL+LKLR V FLP DF+C+KGE+G EMYIV  GQV+V+GGP++ +V ATL EGSVFGEISLL ++G +RRTADV+SKG+S LF LSK D  E +A YP A  +LK +A +++ ++
Sbjct:  459 RTLDPQGKIYISWLCVVSLSFLYNAWVIPLRASFPFQTKENTNIWLACDFCADIIYLLDVVFFKHRVMYLFEGFWVKNKNLTRKNYMRKLQFKLDLLALLPLELLYFKLGTQAVWLRFPRFFKIQSFWEVFRLLDRVISSPHFVRVAKTLTYMLYMIHITAALYYAYSDYQGLGQNRWVFS---GKGHPYVRCFAFATKTATSIGKNPKPERQGEYVFMTVAWLMGVFVFALLIGQIRDIISTATRNKHEYRQLEDETLEYMRRLNLSQEVQSRVKMWFQFTWEQQRTLDESNILDALPINLKTDIAISVHIQTLSKVQLFADCEEALLRDLVLKLRAVTFLPGDFVCRKGEVGREMYIVKLGQVQVMGGPSSDVVLATLTEGSVFGEISLLGINGADRRTADVRSKGYSNLFVLSKSDLNEVIAYYPTAQAILKKRARQLMRKN 900          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Fly
Match: CngA (gene:FBgn0261612 transcript:FBtr0302924)

HSP 1 Score: 300.056 bits (767), Expect = 2.163e-91
Identity = 163/461 (35.36%), Postives = 254/461 (55.10%), Query Frame = 2
Query:  557 WLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAA---------LRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQ----YSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESE 1885
            WL +  +AV+YN + +  R  F   N      W   DY+ DFIY+LD L+  H   +L+ G++  +      +Y     + ++VLS++PTDL  +       +         +RL RL +    +E FD  +      +  R  K +  I+ LIH+ AC Y+  S  IGFSSDS+V++    +       YIY FYW+  T T+IG  P+P    EY F+   +L+G+ +FA ++G I  +    N  +  ++ +MD    YM    +   +  +VI WF Y W     LDE  ++ +LP KLK+++AI  H +TL +V +F D E  LL  L+LKL+  +F P D+IC+KG++G EMYIV  G++ VV G +   V ATL  GSVFGE+S+L ++G   GNRRTA+V+S G+S LF L+K+D  E ++DYP A   L  +  ++L +  +++     +S+
Sbjct:  110 WLAIVSLAVLYNIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHE-GFLDQGLLVRDAFRLRRHYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTETATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVYNLNGTRNNTLQRQYIYSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEFQNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVHMDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVV-GDDGITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQ 568          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Fly
Match: CngA (gene:FBgn0261612 transcript:FBtr0302925)

HSP 1 Score: 299.671 bits (766), Expect = 1.168e-89
Identity = 163/461 (35.36%), Postives = 254/461 (55.10%), Query Frame = 2
Query:  557 WLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAA---------LRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQ----YSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESE 1885
            WL +  +AV+YN + +  R  F   N      W   DY+ DFIY+LD L+  H   +L+ G++  +      +Y     + ++VLS++PTDL  +       +         +RL RL +    +E FD  +      +  R  K +  I+ LIH+ AC Y+  S  IGFSSDS+V++    +       YIY FYW+  T T+IG  P+P    EY F+   +L+G+ +FA ++G I  +    N  +  ++ +MD    YM    +   +  +VI WF Y W     LDE  ++ +LP KLK+++AI  H +TL +V +F D E  LL  L+LKL+  +F P D+IC+KG++G EMYIV  G++ VVG  +   V ATL  GSVFGE+S+L ++G   GNRRTA+V+S G+S LF L+K+D  E ++DYP A   L  +  ++L +  +++     +S+
Sbjct:  285 WLAIVSLAVLYNIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHE-GFLDQGLLVRDAFRLRRHYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTETATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVYNLNGTRNNTLQRQYIYSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEFQNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVHMDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGD-DGITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQ 743          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0299573)

HSP 1 Score: 291.967 bits (746), Expect = 6.536e-86
Identity = 161/447 (36.02%), Postives = 254/447 (56.82%), Query Frame = 2
Query:  527 FESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVF--SPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLAL-SGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHK 1852
            F+   R    W +V  +A +YNF  I  R  F+  N     IW   DY++DF+Y++DIL F  R  YL +G+++ +      +Y+  + F ++ L ++P D   L +    + LR  RL K   F+   D  +      ++ R    + Y++ + H+  C Y++  K  GF S ++V+  S + D    Y+  +YW     T+IG+ P P    EY F+ +  L G+ +FA ++G + +I  + +A +  ++ K+D    YM+   +   +  KVI WF+Y W   K  DE   +  LP KLK+++AI+ H +TL +V +FQ+ E   L +L+L+LRPVLF P D+IC+KGE+G EMYIV  G+++VV   N   V A+LK GS FGEIS+L + + GNRRTA V+S G+S LF LSK+D  + + +YPAA   L++ A K L ++K
Sbjct:  298 FDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDIL-FHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSI-GFNSILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHDSESADVVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVV-ADNGKTVMASLKAGSYFGEISILNMGTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRLEKYK 741          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Zebrafish
Match: cngb1b (cyclic nucleotide gated channel subunit beta 1b [Source:ZFIN;Acc:ZDB-GENE-090831-4])

HSP 1 Score: 377.867 bits (969), Expect = 3.990e-119
Identity = 209/596 (35.07%), Postives = 337/596 (56.54%), Query Frame = 2
Query:  218 SRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNV-----KADEIKKPPDNEK---------LELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYE-KIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLME 1954
            S  S  +  +N+RL+ + + F ER E VK ++I P   + D     P +  P          KA++       EK          ++ PQ  +       R+  ++ P+    F + F      Y++WL    +A  +N   IP+R  F  Y  P    +W + DY+ D +YILD+L FQ RLQ++  G I  + K+   NY+K ++FK++VLS++     +         LRL R+ K   FFE    L+ ++ + +I R ++T +Y+++ +H  AC YY  S + G     + +  A +   +YI C+Y+A++   +IG    PT   E  F  + + SG+FVF+++IGQ+RD+  AA A QTNYR  +D T+ YM +  + + + K+V  W++Y W+    LDE  L++ LP K+K D+A+   ++ +SKV LFQ C+R ++ D++ +L+ V++LP D++CKK E+G EMYI+  G+V+VVGGP+   VF TLK G+VFGE+SLLA+ GGNRRTA+V ++GF+ LF L+K+D  E M  YP + +LL+ KA K+L + K       +E E   +IP + +T  L +  L++ E
Sbjct:  174 SSASQASTVVNERLQELVKLFKERTERVKEKLIDPDNSDDDTPPATPSKQAPAPPPEPPAEQKAEQEAPEAPAEKEEEKIKFLCFKVKPQSRIG------RLLRYRFPASIDPFTNLF------YVLWLFCVSLAFNWNAWMIPVRSTFP-YQTPENIHVWLLIDYLCDSVYILDVLAFQPRLQFVQYGDIVSDKKLMRANYIKTARFKLDVLSLL-PLELLYFKTGINPLLRLPRILKFMAFFEFNKRLEAILTNPYIYRVIRTTTYLLFAVHCNACLYYWGSSYEGLGISEWTYDGAGN---SYIRCYYFAVRALLTIGGLAGPTTLFELVFQLINYFSGVFVFSIMIGQMRDVVGAATAAQTNYRACVDNTVKYMASYRIPKDVQKRVKTWYSYTWQSQGMLDEQELLDQLPDKMKLDIAVDVSYSIISKVPLFQGCDRQMIFDMLKRLKSVVYLPGDYVCKKDEVGREMYIIKAGEVQVVGGPDGKTVFVTLKAGAVFGEVSLLAVGGGNRRTANVVARGFANLFILTKKDLNEIMVHYPESQKLLRKKAKKMLMKDKKPAEKKGEEKEPVPIIPPRAETPKLLKAALEMTE 752          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Zebrafish
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 367.466 bits (942), Expect = 1.383e-117
Identity = 208/617 (33.71%), Postives = 336/617 (54.46%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKR-----------------ICSFKLPS----FETIFLHTFESR-----NRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEK-----IWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENRRQSSMARDNEVY 1996
            +++RL+ + + F  R E  + +++ P   E+DDES +            A   KKP +      PP++   + +                     +  FK+P        I  + F S      +  Y++WL     A  +N   IP+R  F     PY+       W + DY  D IYI+DI + Q RLQ++  G I  +      NY +  +FKM+V+S+ P D+ + +    K+ LR  RL K   FFE  D L+  +   +I R ++T +Y++Y +H  AC +Y  S + G  S  +V++    + ++YI C+Y+A+KT  +IG  P PT   E  F  V +  G+F F+++IGQ+RD+  AA A +  YR  +D+T+ YM +  +   +  ++  W++Y W+    LDE  L+  LP K++ D+A   +++ +SKV+LFQ C+R ++ D++ +L+ V++LP DF+C+KGEIG EMYI+  G+V+VVGGP+   VF TL+ GSVFGEISLLA  GGNRRTA+VK+ GF+ LF L K+D  E +  YP + +LL+ KA K+L + K    +  +  +   VIP + +T  L++  L++   +   + +R  E Y
Sbjct:   17 VHERLQELVKLFKGRTERRRDKLVDP--DESDDESPS------------ASPAKKPGEAPPPPPPPEQKKEAEEKPVEEEEEEVQIYEFMGYKIPVPQFKIPQMPEWLRAILAYRFPSSIDPYTDLIYVVWLFFVTFAWNWNVWLIPVRCTF-----PYQTPDNIHWWLLMDYFCDSIYIMDIFVVQPRLQFVRGGDIVCDKNDMRENYRQTERFKMDVISLFPLDV-LYVFTGVKSLLRFPRLLKYNAFFEFNDRLEAWMSKAYIYRVIRTSAYLLYSLHCNACIFYWGSDYEGLGSTKWVYN---GKGNSYIRCYYFAVKTLITIGGLPDPTTVFEIVFQLVNYFVGVFAFSIMIGQMRDVIGAATAGEAYYRHSVDSTVKYMTSYRIPRDVQNRIKTWYDYTWKSQGMLDEQELLIQLPDKMRLDIAADVNYSIVSKVALFQGCDRQMIFDMLKRLKSVVYLPGDFVCEKGEIGREMYIIKAGEVQVVGGPDGKTVFVTLRAGSVFGEISLLAGGGGNRRTANVKAHGFANLFILDKKDLAEILVHYPESQKLLRKKAKKMLTKDKKPAEAKGEVKDTGEVIPQRPETPKLYKAALEVATGQ---TFSRLKEAY 607          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Zebrafish
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 368.622 bits (945), Expect = 1.233e-115
Identity = 204/593 (34.40%), Postives = 332/593 (55.99%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFE---------TIFLHTFESR-----NRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEK-----IWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENR 1960
            +++RL+ + + F  R E  + +++ P   E+DDES  P + G                 E+ +   ++ V   +   +I  F +P F+          I  + F S      +  Y++WL     A  +N   IP+R C     +PY+       W + DY  D IYI+DI + Q RLQ++  G I  +      NY +  +FKM+V+S+ P D+ + +    K+ LR  RL K   FFE  D L+  +   +I R ++T +Y++Y +H  AC +Y  S + G  S  +V++    + ++YI C+Y+A+KT  +IG  P PT   E  F  V +  G+F F+++IGQ+RD+  AA A +  YR  +D+T+ YM +  +   +  ++  W++Y W+    LDE  L+  LP K++ D+A   +++ +SKV+LFQ C+R ++ D++ +L+ V++LP DF+C+KGEIG EMYI+  G+V+VVGGP+   VF TL+ GSVFGEISLLA  GGNRRTA+VK+ GF+ LF L K+D  E +  YP + +LL+ KA K+L + K    +  +  +   VIP + +T  L++  L++   +
Sbjct:  152 VHERLQELVKLFKGRTERRRDKLVDP--DESDDES--PSKPGEAPPPPPP--------PEQKKEAEEKPVEEEEEEVQIYEFMVPQFKIPQMPEWLRAILAYRFPSSIDPYTDLIYVVWLFFVTFAWNWNVWLIPVR-C----TFPYQTPDNIHWWLLMDYFCDSIYIMDIFVVQPRLQFVRGGDIVCDKNDMRENYRQTERFKMDVISLFPLDV-LYVFTGVKSLLRFPRLLKYNAFFEFNDRLEAWMSKAYIYRVIRTSAYLLYSLHCNACIFYWGSDYEGLGSTKWVYN---GKGNSYIRCYYFAVKTLITIGGLPDPTTVFEIVFQLVNYFVGVFAFSIMIGQMRDVIGAATAGEAYYRHSVDSTVKYMTSYRIPRDVQNRIKTWYDYTWKSQGMLDEQELLIQLPDKMRLDIAADVNYSIVSKVALFQGCDRQMIFDMLKRLKSVVYLPGDFVCEKGEIGREMYIIKAGEVQVVGGPDGKTVFVTLRAGSVFGEISLLAGGGGNRRTANVKAHGFANLFILDKKDLAEILVHYPESQKLLRKKAKKMLTKDKKPAEAKGEVKDTGEVIPQRPETPKLYKAALEVATGQ 723          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Zebrafish
Match: cngb1b (cyclic nucleotide gated channel subunit beta 1b [Source:ZFIN;Acc:ZDB-GENE-090831-4])

HSP 1 Score: 377.096 bits (967), Expect = 1.303e-114
Identity = 207/587 (35.26%), Postives = 334/587 (56.90%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNV-----KADEIKKPPDNEK---------LELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYE-KIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLME 1954
            +N+RL+ + + F ER E VK ++I P   + D     P +  P          KA++       EK          ++ PQ  +       R+  ++ P+    F       N +Y++WL    +A  +N   IP+R  F  Y  P    +W + DY+ D +YILD+L FQ RLQ++  G I  + K+   NY+K ++FK++VLS++     +         LRL R+ K   FFE    L+ ++ + +I R ++T +Y+++ +H  AC YY  S + G     + +  A    ++YI C+Y+A++   +IG    PT   E  F  + + SG+FVF+++IGQ+RD+  AA A QTNYR  +D T+ YM +  + + + K+V  W++Y W+    LDE  L++ LP K+K D+A+   ++ +SKV LFQ C+R ++ D++ +L+ V++LP D++CKK E+G EMYI+  G+V+VVGGP+   VF TLK G+VFGE+SLLA+ GGNRRTA+V ++GF+ LF L+K+D  E M  YP + +LL+ KA K+L + K       +E E   +IP + +T  L +  L++ E
Sbjct:  707 VNERLQELVKLFKERTERVKEKLIDPDNSDDDTPPATPSKQAPAPPPEPPAEQKAEQEAPEAPAEKEEEKIKFLCFKVKPQSRIG------RLLRYRFPASIDPFT------NLFYVLWLFCVSLAFNWNAWMIPVRSTFP-YQTPENIHVWLLIDYLCDSVYILDVLAFQPRLQFVQYGDIVSDKKLMRANYIKTARFKLDVLSLL-PLELLYFKTGINPLLRLPRILKFMAFFEFNKRLEAILTNPYIYRVIRTTTYLLFAVHCNACLYYWGSSYEGLGISEWTYDGA---GNSYIRCYYFAVRALLTIGGLAGPTTLFELVFQLINYFSGVFVFSIMIGQMRDVVGAATAAQTNYRACVDNTVKYMASYRIPKDVQKRVKTWYSYTWQSQGMLDEQELLDQLPDKMKLDIAVDVSYSIISKVPLFQGCDRQMIFDMLKRLKSVVYLPGDYVCKKDEVGREMYIIKAGEVQVVGGPDGKTVFVTLKAGAVFGEVSLLAVGGGNRRTANVVARGFANLFILTKKDLNEIMVHYPESQKLLRKKAKKMLMKDKKPAEKKGEEKEPVPIIPPRAETPKLLKAALEMTE 1276          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Zebrafish
Match: cngb3.2 (cyclic nucleotide gated channel subunit beta 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-091118-102])

HSP 1 Score: 346.28 bits (887), Expect = 5.468e-109
Identity = 184/545 (33.76%), Postives = 305/545 (55.96%), Query Frame = 2
Query:  221 RESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALS--GGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLN 1843
            R  LI+E+I+  L  + +K  +R E  K ++I P        + +P+ + P     +++ +K+        +  Q    ++   +    F    F   FL         Y+ WL +  +A  YN   +P+R  F  ++     +W   D +ADFIYI D++ FQ RLQ+   G I  + ++    Y +  +F+ +V++++P DL  +      +  RL RL K  +FFE  D L+ ++   +I R ++T+ Y+++++H  AC YY+ S   G  S  +V+S    + SAY++ +Y+A++T  +IG  P P    E  F    +  G+FVF+ LIGQ+RD+  AA A QT +R  MD  + YM   ++ + +  +V  W+NY W+    LDE+ L+  +P  +++ +A+  +  T  K+ LF+ C+  +L D++L+L+ +++LP DF+ KKG+IG EMYI+  G+V+V+GGP+N IVF TLK G VFGEISLL  S  GGNRRTA+V + GF+ LF L K+D  + +  YP + ++L  K  K+L 
Sbjct:   78 RPILISEEIDTHLIEMIQKLRQRTEQFKEKVIDPY-------ASSPERSPPA---TESEVLKQKQKQAHFHIEEQGQYVNVLKQQPFVDF----FSPFFL---------YITWLSMVTIAFNYNLWFVPVRMAFPYHSPEVVPLWFTLDIIADFIYIFDMIFFQPRLQFSKGGDIIYDREVIKKKYRESGRFQNDVIAVLPIDLLYIPF-GFNSVFRLNRLMKVESFFEFSDRLEGLLTRAYIWRVIRTIGYLLFILHLNACLYYVASVSQGIGSTKWVYS---GKGSAYLHSYYFAVRTLINIGGLPEPHTIFEISFQLTNFFVGVFVFSSLIGQMRDVIGAATAGQTYFRASMDACVAYMVTNHIPKMVQSRVRTWYNYTWDSQGMLDESELLGQMPLVMRTAIAVDINLATFQKIELFKGCDNQMLVDMLLRLKSIVYLPGDFVVKKGDIGKEMYIIKAGEVQVIGGPDNKIVFVTLKAGCVFGEISLLQSSANGGNRRTANVAAHGFANLFVLDKKDLNDILIHYPESQKVLARKGRKLLK 595          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Xenopus
Match: nit2 (nitrilase family member 2 [Source:Xenbase;Acc:XB-GENE-946902])

HSP 1 Score: 361.688 bits (927), Expect = 1.610e-114
Identity = 195/555 (35.14%), Postives = 321/555 (57.84%), Query Frame = 2
Query:  341 DESKNPKE-----NGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRL--FKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAY-----IYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENR 1960
            D+ + P        GP+   V+A++ K+P  +EK +   ++D    K ++++C           L   +   ++Y  WLLV  + V+YN+  + +R CF+     Y  +W   DY+ D IYI DI++ + R  +L  G++  + K  + NY++  +FK++++SI+PTDL    +  H+  LR  RL  F   FE FD  +      +I R    + YI+ +IH+  C YY FSK IGF +DS+V+    D    Y     +YC YW+  T T+IG+ P P    EY F+   +L G+ +FA ++G +  +    NA +T ++ K+D    YM+   +S+ +  KVI+WF+Y W + KT+DE  ++++LP KL++++AI+ H +TL KV +FQ+CE  LL +L+LKLRP +F P D+IC+KG+IG EMYI+  G++ VV G +    +A L  GS FGEIS+L + G   GNRRTA ++S G+S LF LSK D  EA+ +YP A ++L+ +  ++L +  +++ + +K   I +   + ++   L E+ L ++  R
Sbjct:   95 DQDQRPDSFLDRFRGPE---VQAND-KQPAKDEKEQDKVEQD--KKKNDRKVCE----------LFVVDPSGKWYYRWLLVITLPVLYNWFLLVVRACFDDLQTSYVALWFTLDYICDVIYIADIVI-RFRTGFLEQGLLVRDPKTLSNNYIRTLQFKLDIISILPTDLGYFAVGIHRPELRFNRLLHFPRMFECFDQTETRTSYPNIFRIFNLVLYILLIIHWNGCIYYAFSKAIGFGADSWVYPNLTDPKHGYLAREYVYCLYWSTLTLTTIGDTPQPMTDTEYLFVIFDFLVGVLIFATIVGNVGSMISNMNATRTEFQSKIDAIKHYMQFRRVSKDLEAKVILWFDYLWTNKKTVDEREVLKNLPDKLRAEIAINVHLDTLKKVRIFQNCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVV-GEDGITHYAVLTSGSCFGEISILNIEGSKMGNRRTASIRSIGYSDLFCLSKDDLMEALVEYPDAKKILEERGREILIKEGLLDETKEK---ISVKGKSSEERLELVESNLDILHTR 628          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Xenopus
Match: scap (SREBF chaperone [Source:Xenbase;Acc:XB-GENE-996521])

HSP 1 Score: 345.125 bits (884), Expect = 1.189e-109
Identity = 181/480 (37.71%), Postives = 286/480 (59.58%), Query Frame = 2
Query:  467 VNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTK-----ANKVLNRHKVIENSTKKESE 1885
            + K +  FKLPS  +I  +T    +R YL+WL    V+  +N   IP+R  F +        W + DY+ D +Y++DI +FQ RLQ++  G I ++ K    NY   +KF+++V S+IP DL  ++    +   R  RL K  +FFE  D L+ V++  +I R ++T  Y+++++H  AC YY  S + G +S  +V+    + Y   + C+Y+A++T  +IG    P    E  F  + + +G+FVF+ LIGQ+RD+  AA A Q+ YR  +D T+ YM +  + + +  +V  W+ Y W+    LDE+ L+E +PTK++  +AI  +F  + +V LF+ C+  ++ DL+L+L+ +++LP DF+CKKGEIG EMYI+  G V+V+GGP+N  V  TLK G+VFGEISLL+  GGNRRTA+V + GF+ LF L K+   E +  YP + +LL  K     AN  L +  +I N   ++ E
Sbjct:   80 LKKSLQKFKLPS--SIDAYT----DRSYLLWLFFVAVSFNWNCWLIPMRCVFPVQTPNNILYWMISDYICDALYLIDIFIFQPRLQFVKGGDIIVSRKQTKANYWDSTKFRLDVASVIPFDLLYMVF-GFQPVFRANRLLKYTSFFEFNDRLEAVMEKAYIYRVIRTTGYLLFILHINACIYYWASSYEGIASTKWVYDGKGNMY---LRCYYFAVRTLITIGGLAEPQTVFEIVFQLLNYFTGVFVFSSLIGQMRDVIGAATAGQSYYRASVDKTVSYMSSNKIPKVVQNRVRTWYEYTWDSQGMLDESELLEEMPTKMQLAIAIDVNFAIVDRVDLFKGCDSQMIQDLLLRLKSIVYLPGDFVCKKGEIGREMYIIKQGAVQVLGGPDNQKVLVTLKAGAVFGEISLLSAGGGNRRTANVVAYGFANLFILDKKSLNEILVHYPDSKKLLTKKAKAYLANYFLQKAYIIFNILYRDKE 549          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Xenopus
Match: scap (SREBF chaperone [Source:Xenbase;Acc:XB-GENE-996521])

HSP 1 Score: 333.569 bits (854), Expect = 5.171e-105
Identity = 172/460 (37.39%), Postives = 272/460 (59.13%), Query Frame = 2
Query:  467 VNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKTFFELFDVLDHVVKSGHI---VRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKV 1837
            + K +  FKLPS  +I  +T    +R YL+WL    V+  +N   IP+R  F +        W + DY+ D +Y++DI +FQ RLQ++  G I    K    NY   +KF+++V S+IP DL  ++    +   R  RL+           H++  GH    ++F++T  Y+++++H  AC YY  S + G +S  +V+    + Y   + C+Y+A++T  +IG    P    E  F  + + +G+FVF+ LIGQ+RD+  AA A Q+ YR  +D T+ YM +  + + +  +V  W+ Y W+    LDE+ L+E +PTK++  +AI  +F  + +V LF+ C+  ++ DL+L+L+ +++LP DF+CKKGEIG EMYI+  G V+V+GGP+N  V  TLK G+VFGEISLL+  GGNRRTA+V + GF+ LF L K+   E +  YP + +LL  KA +V
Sbjct:  101 LKKSLQKFKLPS--SIDAYT----DRSYLLWLFFVAVSFNWNCWLIPMRCVFPVQTPNNILYWMISDYICDALYLIDIFIFQPRLQFVKGGDIITERKQTKANYWDSTKFRLDVASVIPFDLLYMVF-GFQPVFRANRLYL----------HLI--GHYAIYLQFIRTTGYLLFILHINACIYYWASSYEGIASTKWVYDGKGNMY---LRCYYFAVRTLITIGGLAEPQTVFEIVFQLLNYFTGVFVFSSLIGQMRDVIGAATAGQSYYRASVDKTVSYMSSNKIPKVVQNRVRTWYEYTWDSQGMLDESELLEEMPTKMQLAIAIDVNFAIVDRVDLFKGCDSQMIQDLLLRLKSIVYLPGDFVCKKGEIGREMYIIKQGAVQVLGGPDNQKVLVTLKAGAVFGEISLLSAGGGNRRTANVVAYGFANLFILDKKSLNEILVHYPDSKKLLTKKAKEV 538          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 330.872 bits (847), Expect = 9.146e-104
Identity = 184/500 (36.80%), Postives = 289/500 (57.80%), Query Frame = 2
Query:  413 PDN--EKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRL--FKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFS----PAPDQYS-AYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKK 1876
            PD+  E+   P  ++V+S + N +      P+ E   +   +  +  Y  WL +  V V+YN+  +  R CF+        +W V DY AD IYI D L+ + R  +L  G++  + K    NY K  +FK+++LS++PTDL  L +  +   LR  RL  F   FE FD  +      +I R    + YI+ +IH+ AC Y+  SK IGF +D++V+     P   + +  YIY  YW+  T T+IG  P P    E+ F+   +L G+ +FA ++G +  +    NA++  ++ K+D+   YM+   +++ +  +VI WF+Y W + KT+DE  +++SLP KLK+++AI+ H +TL KV +FQDCE  LL +L+LKLRP +F P D+IC+KG+IG EMYI+  G++ VV   +    F  L +GS FGEIS+L + G   GNRRTA+++S G+S LF LSK D  EA+ +YP A  +L+ K  ++L +  +I+    K
Sbjct:   15 PDSFLERFRGPDLKEVSSRESNIQ----SNPTAERPKIFVIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLV-RFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYLKIGLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYPNISHPEYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVAD-DGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK 508          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 329.717 bits (844), Expect = 5.479e-103
Identity = 178/458 (38.86%), Postives = 272/458 (59.39%), Query Frame = 2
Query:  533 SRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRL--FKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFS----PAPDQYS-AYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKK 1876
            S N YY  WL +  V V+YN+  +  R CF+        +W V DY AD IYI D L+ + R  +L  G++  + K    NY K  +FK+++LS++PTDL  L +  +   LR  RL  F   FE FD  +      +I R    + YI+ +IH+ AC Y+  SK IGF +D++V+     P   + +  YIY  YW+  T T+IG  P P    E+ F+   +L G+ +FA ++G +  +    NA++  ++ K+D+   YM+   +++ +  +VI WF+Y W + KT+DE  +++SLP KLK+++AI+ H +TL KV +FQDCE  LL +L+LKLRP +F P D+IC+KG+IG EMYI+  G++ VV   +    F  L +GS FGEIS+L + G   GNRRTA+++S G+S LF LSK D  EA+ +YP A  +L+ K  ++L +  +I+    K
Sbjct:   84 SSNLYY-RWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLV-RFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYLKIGLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYPNISHPEYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVV-ADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK 538          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Mouse
Match: Cngb1 (cyclic nucleotide gated channel beta 1 [Source:MGI Symbol;Acc:MGI:2664102])

HSP 1 Score: 390.193 bits (1001), Expect = 2.363e-123
Identity = 221/574 (38.50%), Postives = 334/574 (58.19%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKR-ICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKI-----WNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVL 1942
            INDRL+ + + F ER E VK ++I P    +D+ES  P    P     + D  +KP + E  E     D+   K  +R +  ++ P  ++I   T    N  Y++WL    +A  +N   IP+R     + +PY++      W + DY+ DFIY+LDI +FQ RLQ++  G I  + K    NY+K  +FKM++L ++P D   L L      LRL R  K   FFE  + L+ ++   ++ R ++T +Y++Y +H  +C YY  S F G  S  +V+       ++YI C+YWA+KT  +IG  P P    E  F  + + +G+F F+V+IGQ+RD+  AA A QT YR  MD+T+ YM    +  S+  +V  W+ Y W     LDE+ L+  LP K++ DLAI  +++ +SKV+LFQ C+R ++ D++ +LR V++LPND++CKKGEIG EMYI+  GQV+V+GGP+   V  TLK GSVFGEISLLA+ GGNRRTA+V + GF+ LF L K+D  E +  YP + +LL+ KA ++L       N+  KE +  +++P +  T  L    L
Sbjct:  181 INDRLQELVKMFKERTEKVKEKLIDPDV-TSDEESPKPS---PAKKAPEPDPAQKPAEAEVAEEEHYCDMLCCKFKRRPLKMYRFP--QSIDPLT----NLMYILWLFFVVLAWNWNCWLIPVR-----WAFPYQRADNIHFWLLMDYLCDFIYLLDITVFQMRLQFVKGGDIITDKKEMRNNYLKSRRFKMDLLCLLPLDFLYLKL-GINPLLRLPRCLKYMAFFEFNNRLEAILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAFQGIGSTHWVYD---GVGNSYIRCYYWAVKTLITIGGLPDPQTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYSIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKAVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLR-----NNNKPKEEKSVLILPPRAGTPKLFNAAL 730          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Mouse
Match: Cngb1 (cyclic nucleotide gated channel beta 1 [Source:MGI Symbol;Acc:MGI:2664102])

HSP 1 Score: 390.193 bits (1001), Expect = 2.363e-123
Identity = 221/574 (38.50%), Postives = 334/574 (58.19%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKR-ICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKI-----WNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVL 1942
            INDRL+ + + F ER E VK ++I P    +D+ES  P    P     + D  +KP + E  E     D+   K  +R +  ++ P  ++I   T    N  Y++WL    +A  +N   IP+R     + +PY++      W + DY+ DFIY+LDI +FQ RLQ++  G I  + K    NY+K  +FKM++L ++P D   L L      LRL R  K   FFE  + L+ ++   ++ R ++T +Y++Y +H  +C YY  S F G  S  +V+       ++YI C+YWA+KT  +IG  P P    E  F  + + +G+F F+V+IGQ+RD+  AA A QT YR  MD+T+ YM    +  S+  +V  W+ Y W     LDE+ L+  LP K++ DLAI  +++ +SKV+LFQ C+R ++ D++ +LR V++LPND++CKKGEIG EMYI+  GQV+V+GGP+   V  TLK GSVFGEISLLA+ GGNRRTA+V + GF+ LF L K+D  E +  YP + +LL+ KA ++L       N+  KE +  +++P +  T  L    L
Sbjct:  181 INDRLQELVKMFKERTEKVKEKLIDPDV-TSDEESPKPS---PAKKAPEPDPAQKPAEAEVAEEEHYCDMLCCKFKRRPLKMYRFP--QSIDPLT----NLMYILWLFFVVLAWNWNCWLIPVR-----WAFPYQRADNIHFWLLMDYLCDFIYLLDITVFQMRLQFVKGGDIITDKKEMRNNYLKSRRFKMDLLCLLPLDFLYLKL-GINPLLRLPRCLKYMAFFEFNNRLEAILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAFQGIGSTHWVYD---GVGNSYIRCYYWAVKTLITIGGLPDPQTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYSIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKAVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLR-----NNNKPKEEKSVLILPPRAGTPKLFNAAL 730          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Mouse
Match: Cngb1 (cyclic nucleotide gated channel beta 1 [Source:MGI Symbol;Acc:MGI:2664102])

HSP 1 Score: 389.037 bits (998), Expect = 3.218e-119
Identity = 221/574 (38.50%), Postives = 334/574 (58.19%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKR-ICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKI-----WNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVL 1942
            INDRL+ + + F ER E VK ++I P    +D+ES  P    P     + D  +KP + E  E     D+   K  +R +  ++ P  ++I   T    N  Y++WL    +A  +N   IP+R     + +PY++      W + DY+ DFIY+LDI +FQ RLQ++  G I  + K    NY+K  +FKM++L ++P D   L L      LRL R  K   FFE  + L+ ++   ++ R ++T +Y++Y +H  +C YY  S F G  S  +V+       ++YI C+YWA+KT  +IG  P P    E  F  + + +G+F F+V+IGQ+RD+  AA A QT YR  MD+T+ YM    +  S+  +V  W+ Y W     LDE+ L+  LP K++ DLAI  +++ +SKV+LFQ C+R ++ D++ +LR V++LPND++CKKGEIG EMYI+  GQV+V+GGP+   V  TLK GSVFGEISLLA+ GGNRRTA+V + GF+ LF L K+D  E +  YP + +LL+ KA ++L       N+  KE +  +++P +  T  L    L
Sbjct:  640 INDRLQELVKMFKERTEKVKEKLIDPDV-TSDEESPKPS---PAKKAPEPDPAQKPAEAEVAEEEHYCDMLCCKFKRRPLKMYRFP--QSIDPLT----NLMYILWLFFVVLAWNWNCWLIPVR-----WAFPYQRADNIHFWLLMDYLCDFIYLLDITVFQMRLQFVKGGDIITDKKEMRNNYLKSRRFKMDLLCLLPLDFLYLKL-GINPLLRLPRCLKYMAFFEFNNRLEAILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAFQGIGSTHWVYD---GVGNSYIRCYYWAVKTLITIGGLPDPQTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYSIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKAVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLRN-----NNKPKEEKSVLILPPRAGTPKLFNAAL 1189          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Mouse
Match: Cngb3 (cyclic nucleotide gated channel beta 3 [Source:MGI Symbol;Acc:MGI:1353562])

HSP 1 Score: 356.295 bits (913), Expect = 2.619e-112
Identity = 198/597 (33.17%), Postives = 326/597 (54.61%), Query Frame = 2
Query:  227 SLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFES-RNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVL---------KLMENRRQSSMAR 1981
            S+INE  +  L N+  +  ER    K  +         +E   P+      + +  +   K  +N KL+    +D  S K  +      L     I   + +S  +R YL+WLL+  +A  +N   +P+R  F       +  W + D V D IY+ DILL Q RLQ++  G I ++      NY   +KF+M+V S++P ++  +         R  R+ K  +FFE    L+ ++   ++ R ++T  Y+++L+H  AC YY  S + G  S  +V++    + + Y+ CFYWA++T  +IG  P P    E  F  + + SG+FVF+ LIGQ+RD+  AA ANQ  ++  MD  I YM   ++ +S+  +V  W  Y W   + LDE++L+E+LPT ++  +A+  +F+ + KV LF+ C+  ++ DL+L+L+  ++LP DF+CKKGEIG EMYI+  G+V+V+GGP+ + V  TLK GSVFGEISLLA  GGNRRTADV + GF+ L +L K+  +E +  YP + +LL  KA  +L++      +         + P K++T  + + +L         +L++ +R+++  +
Sbjct:  114 SIINEYTDAHLHNLVERMRERTALYKKTLT--------EEENFPEVEASSQTAMSTNISPKQENNSKLK--EHQDTFSFKPQRVPVKEHLRRM--ILPRSIDSYTDRVYLLWLLLVTIAYNWNCWLLPVRLVFPCQTPDNKNYWIITDIVCDIIYLCDILLIQPRLQFVRGGEIIVDSNELKRNYRSSTKFRMDVASLLPFEVLYIFF-GVNPIFRANRILKYTSFFEFNHHLESIMDKAYVYRVIRTTGYLLFLLHINACVYYWASDYEGIGSTKWVYN---GEGNKYLRCFYWAVRTLITIGGLPEPQTSFEIVFQFLNFFSGVFVFSSLIGQMRDVIGAATANQNYFQACMDHIIAYMNKYSIPQSVQYRVRTWLEYTWNSQRILDESNLLENLPTAMQLSIALDINFSIIDKVELFKGCDTQMIYDLLLRLKSTIYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGAQVLVTLKAGSVFGEISLLAKGGGNRRTADVVAHGFANLLTLDKKTLQEILLHYPTSKKLLMKKAKILLSQKGKTTQAIPARPGPAFLFPPKEETPRMLKVLLGNTGKVDLGRLLKGKRKTTTQK 694          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Mouse
Match: Cnga2 (cyclic nucleotide gated channel alpha 2 [Source:MGI Symbol;Acc:MGI:108040])

HSP 1 Score: 339.732 bits (870), Expect = 2.327e-106
Identity = 180/470 (38.30%), Postives = 273/470 (58.09%), Query Frame = 2
Query:  518 LHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRL--FKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPD-QYS----AYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVI-ENSTKKESEIEI 1894
            L   +    +Y  WL V  + V+YN+  +  R CF      Y  +W V DY +D +YI D L+ + R  +L  G++  + K    NY+   +FK++V SIIPTDL    +  H   +R  RL  F   FE FD  +      +I R    + YI+ +IH+ AC YY  SK IGF  D++V+    D +Y      YIYC YW+  T T+IG  P P    EY F+   +L G+ +FA ++G +  +    NA +  ++ K+D    YM+   +S+ M  KVI WF+Y W + KT+DE  ++++LP KL++++AI+ H +TL KV +FQDCE  LL +L+LKLRP +F P D+IC+KG+IG EMYI+  G++ VV   +    +A L  GS FGEIS+L + G   GNRRTA+++S G+S LF LSK D  EA+ +YP A ++L+ +  ++L +  ++ EN      E+++
Sbjct:  132 LFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQRNYFVVWLVLDYFSDTVYIAD-LIIRLRTGFLEQGLLVKDPKKLRDNYIHTLQFKLDVASIIPTDLIYFAVGIHSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSIGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKDMEAKVIKWFDYLWTNKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVAD-DGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVAASMEVDV 599          
BLAST of Cyclic nucleotide gated cation channel vs. UniProt/SwissProt
Match: sp|Q28181|CNGB1_BOVIN (Cyclic nucleotide-gated cation channel beta-1 OS=Bos taurus OX=9913 GN=CNGB1 PE=1 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 4.477e-116
Identity = 221/575 (38.43%), Postives = 335/575 (58.26%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKL-PSFETIFLHTFES-RNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEK-----IWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVL 1942
            INDRL+ + + F ER E VK ++I P    T DE ++PK +  K +   A E+K P +  ++E   +E    +      C FK  P  +  F  + +   N  Y++WL    +A  +N   IP+R     + +PY+      +W + DY+ D IY+LDI +FQ RLQ++  G I  + K    NYVK  +FKM++L ++P DL  L        LRL R  K   FFE  + L+ ++   ++ R ++T +Y++Y +H  +C YY  S + G  S  +V+       ++YI C+YWA+KT  +IG  P P    E  F  + + +G+F F+V+IGQ+RD+  AA A QT YR  MD+T+ YM    +  S+  +V  W+ Y W     LDE+ L+  LP K++ DLAI  +++ +SKV+LFQ C+R ++ D++ +LR V++LPND++CKKGEIG EMYI+  GQV+V+GGP+   V  TLK GSVFGEISLLA+ GGNRRTA+V + GF+ LF L K+D  E +  YP + +LL+ KA ++L       N+  KE  + +++P +  T  L    L
Sbjct:  678 INDRLQELVKLFKERTEKVKEKLIDPDV--TSDE-ESPKPSPAKKAPEPAPEVK-PAEAGQVE---EEHYCEM----LCCKFKRRPWKKYQFPQSIDPLTNLMYILWLFFVVLAWNWNCWLIPVR-----WAFPYQTPDNIHLWLLMDYLCDLIYLLDITVFQMRLQFVRGGDIITDKKEMRNNYVKSQRFKMDMLCLLPLDLLYLKF-GVNPLLRLPRCLKYMAFFEFNNRLESILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYEGLGSTHWVYDGV---GNSYIRCYYWAVKTLITIGGLPDPRTLFEIVFQGLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYSIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLRN-----NNKPKEKSV-LILPPRAGTPKLFNAAL 1226          
BLAST of Cyclic nucleotide gated cation channel vs. UniProt/SwissProt
Match: sp|Q14028|CNGB1_HUMAN (Cyclic nucleotide-gated cation channel beta-1 OS=Homo sapiens OX=9606 GN=CNGB1 PE=1 SV=2)

HSP 1 Score: 373.629 bits (958), Expect = 4.660e-113
Identity = 214/578 (37.02%), Postives = 329/578 (56.92%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRP-ITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFK-LPSFETIFLHTFES-RNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKI-----WNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKL 1948
            INDRL+ + + F ER E VK ++I P +T + +    +P +  P+ +          PD +  E   +        +   C FK  P  +  F  + +   N  Y++WL    +A  +N   IP+R     + +PY+       W + DY+ D IY LDI +FQ RLQ++  G I  + K    NY+K  +FKM++LS++P D   L +      LRL R  K   FFE    L+ ++   ++ R ++T +Y++Y +H  +C YY  S + G  S  +V+       ++YI C+Y+A+KT  +IG  P P    E  F  + + +G+F F+V+IGQ+RD+  AA A QT YR  MD+T+ YM    + +S+  +V  W+ Y W     LDE+ L+  LP K++ DLAI  ++N +SKV+LFQ C+R ++ D++ +LR V++LPND++CKKGEIG EMYI+  GQV+V+GGP+   V  TLK GSVFGEISLLA+ GGNRRTA+V + GF+ LF L K+D  E +  YP + +LL+ KA ++L       N+  KE +  +++P +  T  L    L +
Sbjct:  564 INDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPEPA----------PDTKPAEA--EPVEEEHYCDMLCCKFKHRPWKKYQFPQSIDPLTNLMYVLWLFFVVMAWNWNCWLIPVR-----WAFPYQTPDNIHHWLLMDYLCDLIYFLDITVFQTRLQFVRGGDIITDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKV-GVNPLLRLPRCLKYMAFFEFNSRLESILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYD---GVGNSYIRCYYFAVKTLITIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLR-----SNNKPKEEKSVLILPPRAGTPKLFNAALAM 1115          
BLAST of Cyclic nucleotide gated cation channel vs. UniProt/SwissProt
Match: sp|Q9JJZ9|CNGB3_MOUSE (Cyclic nucleotide-gated cation channel beta-3 OS=Mus musculus OX=10090 GN=Cngb3 PE=1 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 1.832e-111
Identity = 198/597 (33.17%), Postives = 326/597 (54.61%), Query Frame = 2
Query:  227 SLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFES-RNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVL---------KLMENRRQSSMAR 1981
            S+INE  +  L N+  +  ER    K  +         +E   P+      + +  +   K  +N KL+    +D  S K  +      L     I   + +S  +R YL+WLL+  +A  +N   +P+R  F       +  W + D V D IY+ DILL Q RLQ++  G I ++      NY   +KF+M+V S++P ++  +         R  R+ K  +FFE    L+ ++   ++ R ++T  Y+++L+H  AC YY  S + G  S  +V++    + + Y+ CFYWA++T  +IG  P P    E  F  + + SG+FVF+ LIGQ+RD+  AA ANQ  ++  MD  I YM   ++ +S+  +V  W  Y W   + LDE++L+E+LPT ++  +A+  +F+ + KV LF+ C+  ++ DL+L+L+  ++LP DF+CKKGEIG EMYI+  G+V+V+GGP+ + V  TLK GSVFGEISLLA  GGNRRTADV + GF+ L +L K+  +E +  YP + +LL  KA  +L++      +         + P K++T  + + +L         +L++ +R+++  +
Sbjct:  114 SIINEYTDAHLHNLVERMRERTALYKKTLT--------EEENFPEVEASSQTAMSTNISPKQENNSKLK--EHQDTFSFKPQRVPVKEHLRRM--ILPRSIDSYTDRVYLLWLLLVTIAYNWNCWLLPVRLVFPCQTPDNKNYWIITDIVCDIIYLCDILLIQPRLQFVRGGEIIVDSNELKRNYRSSTKFRMDVASLLPFEVLYIFF-GVNPIFRANRILKYTSFFEFNHHLESIMDKAYVYRVIRTTGYLLFLLHINACVYYWASDYEGIGSTKWVYN---GEGNKYLRCFYWAVRTLITIGGLPEPQTSFEIVFQFLNFFSGVFVFSSLIGQMRDVIGAATANQNYFQACMDHIIAYMNKYSIPQSVQYRVRTWLEYTWNSQRILDESNLLENLPTAMQLSIALDINFSIIDKVELFKGCDTQMIYDLLLRLKSTIYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGAQVLVTLKAGSVFGEISLLAKGGGNRRTADVVAHGFANLLTLDKKTLQEILLHYPTSKKLLMKKAKILLSQKGKTTQAIPARPGPAFLFPPKEETPRMLKVLLGNTGKVDLGRLLKGKRKTTTQK 694          
BLAST of Cyclic nucleotide gated cation channel vs. UniProt/SwissProt
Match: sp|Q9NQW8|CNGB3_HUMAN (Cyclic nucleotide-gated cation channel beta-3 OS=Homo sapiens OX=9606 GN=CNGB3 PE=1 SV=2)

HSP 1 Score: 353.984 bits (907), Expect = 2.402e-109
Identity = 214/603 (35.49%), Postives = 340/603 (56.38%), Query Frame = 2
Query:  230 LINEKINDRLRNIHRKFSERIESVKSQIIRP--ITPETDDESKNPKENGP-KDSNVKADE---------IKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKI-----WNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENRRQSSMAR 1981
            +INE  + +L N+ ++  +R    K +++     +PE   ++  P    P K+S+ K  E         +KK P  E L              KRI   KLP+  +I  +T    +R YL+WLL+  +A  +N   IPLR  F     PY+       W + D + D IY+ D+L  Q RLQ++  G I ++      +Y   +KF+++V SIIP D+  L         R  R+ K  +FFE    L+ ++   +I R ++T  Y+++++H  AC YY  S + G  +  +V+     + + Y+ C+YWA++T  +IG  P P    E  F  + + SG+FVF+ LIGQ+RD+  AA ANQ  +R  MD TI YM N ++ + + K+V  W+ Y W+  + LDE+ L+++LPT ++  LAI  +F+ +SKV LF+ C+  ++ D++L+L+ VL+LP DF+CKKGEIG EMYI+  G+V+V+GGP+ + V  TLK GSVFGEISLLA  GGNRRTA+V + GF+ L +L K+  +E +  YP +  +L  KA  +L +      +T    ++ ++ P K++T  L +T   L+    ++S+AR
Sbjct:  123 VINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEASPQTAKPTAVPPVKESDDKPTEHYYRLLWFKVKKMPLTEYL--------------KRI---KLPN--SIDSYT----DRLYLLWLLLVTLAYNWNCCFIPLRLVF-----PYQTADNIHYWLIADIICDIIYLYDMLFIQPRLQFVRGGDIIVDSNELRKHYRTSTKFQLDVASIIPFDICYLFF-GFNPMFRANRMLKYTSFFEFNHHLESIMDKAYIYRVIRTTGYLLFILHINACVYYWASNYEGIGTTRWVYD---GEGNEYLRCYYWAVRTLITIGGLPEPQTLFEIVFQLLNFFSGVFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRVRTWYEYTWDSQRMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKGCDTQMIYDMLLRLKSVLYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGGGNRRTANVVAHGFANLLTLDKKTLQEILVHYPDSERILMKKARVLLKQKAKTAEATPPRKDLALLFPPKEETPKLFKT---LLGGTGKASLAR 690          
BLAST of Cyclic nucleotide gated cation channel vs. UniProt/SwissProt
Match: sp|Q28718|CNGA2_RABIT (Cyclic nucleotide-gated olfactory channel OS=Oryctolagus cuniculus OX=9986 GN=CNGA2 PE=2 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 3.442e-106
Identity = 183/482 (37.97%), Postives = 277/482 (57.47%), Query Frame = 2
Query:  518 LHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRL--FKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPD-QYS----AYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVI-ENSTKKESEIEIVIPNKKDTSNLH 1930
            L   +    +Y  WL V  + V+YN+  +  R CF      Y  +W V DY +D +YI D L  + R  +L  G++  + K    NY+   +FK++V SIIPTDL    +  H   LR  RL  F   FE FD  +      +I R    + YI+ +IH+ AC YY  SK IGF  D++V+    D +Y      YIYC YW+  T T+IG  P P    EY F+   +L G+ +FA ++G +  +    NA +  ++ K+D    YM+   +S+ M  KVI WF+Y W + KT+DE  ++++LP KL++++AI+ H +TL KV +FQDCE  LL +L+LKLRP +F P D+IC+KG+IG EMYI+  G++ VV   +    +A L  GS FGEIS+L + G   GNRRTA+++S G+S LF LSK D  EA+ +YP A ++L+ +  ++L +  ++ EN      E+++    K+  +N+ 
Sbjct:  130 LFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQRGYFLVWLVLDYFSDVVYIAD-LFIRLRTGFLEQGLLVKDPKKLRDNYIHTLQFKLDVASIIPTDLIYFAVGIHNPELRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISKSIGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEAKVIKWFDYLWTNKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVAD-DGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVAASMEVDVQEKLKQLETNME 609          
BLAST of Cyclic nucleotide gated cation channel vs. TrEMBL
Match: A0A4E0RMV4 (Cyclic nucleotide gated cation channel OS=Fasciola hepatica OX=6192 GN=D915_002191 PE=4 SV=1)

HSP 1 Score: 528.094 bits (1359), Expect = 1.417e-173
Identity = 267/540 (49.44%), Postives = 361/540 (66.85%), Query Frame = 2
Query:  416 DNEKLELPPQED-------VTSIKVNKRICSFKLPSF----ETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNR--------------HKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLME 1954
            DN+K  +PP ED       +         CS  +P++      IF  +F   + +YL WL+    AV+YNF+TIPLRE F+IY+  Y   W + + ++D +Y+LD+++ + RL+++ NG+I  + K CA +YVK ++FK +++S++P DL  L  +   A  R+ R+FK  TF+E FD LD  + +G  VR  +T+ Y+IY+IH E+CGYY F+++ G   ++  +S      S Y+Y FY  MKTATSIG+ P+ T   E+ FM  YWLSGIFV A+LIGQI DI D+A++N+ NYRK MD T+  M +L+    ++ KV  WF YNWE  KT DENSL+++LP KLKSDL I  HFNTLSKV+LFQ+CER L+ D+ILKLRPV+FLP D+IC+KGE+G EMYIV +G VEVVGGPNNS+VF TLKEGSVFGEISLLALSG NRRTADV+SKGFSTLFSLSK+DFEE M +YP A+ LLK ++ ++LNR              H         E E+  VIP +  T  L +TV + +E
Sbjct:  170 DNQKEPVPPAEDQNDQYEIIGQEPFEAWECSCPIPAWIPGPNVIFASSFSPYSAFYLFWLMCLTFAVLYNFVTIPLREAFDIYDEDYRFYWYIGNAISDGLYLLDMIIVRPRLEFIENGLITTDFKSCARHYVKSTQFKCDIVSVLPLDLCSLFYQQEMARFRILRIFKVYTFWETFDRLDQRLNAGFAVRLARTIIYMIYIIHLESCGYYAFNRWQGM--EATTWSIPVGNISPYVYSFYVCMKTATSIGSLPAATNPLEFLFMTCYWLSGIFVSAILIGQIIDILDSASSNKDNYRKIMDATLSCMHHLHAPVHVVDKVRTWFMYNWEQQKTFDENSLLDTLPIKLKSDLTISVHFNTLSKVTLFQNCERALIYDMILKLRPVVFLPMDYICRKGEVGKEMYIVKSGIVEVVGGPNNSVVFVTLKEGSVFGEISLLALSGKNRRTADVRSKGFSTLFSLSKEDFEEIMKNYPQAHHLLKKRSQRMLNRDKKKAKEEEKARKLHDPTNEVELPEDEVVEVIPERPPTPRLVDTVAQALE 707          
BLAST of Cyclic nucleotide gated cation channel vs. TrEMBL
Match: G4LY66 (Cyclic-nucleotide-gated cation channel,putative OS=Schistosoma mansoni OX=6183 GN=Smp_155040 PE=4 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 9.858e-172
Identity = 270/565 (47.79%), Postives = 372/565 (65.84%), Query Frame = 2
Query:  383 NVKADEIKKPPDNEKLELPPQEDVTSIKVNK----------------RICSFKLPSF----ETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYE-KIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHK---------------VIENSTKKESEIEI--VIPNKKDTSNLHETVLKLMEN 1957
            N+    I+ P DNEK E   Q +V  +KV++                +  S  LP++    + +F  T    +  YL+WL    +AV+YN++TIPLRE F IY+      +W   + + D +Y++DILL + R+++L+ GI + + K CA++Y K  +FK++++SI P DLF L  +   A  R+ RL K   F+E F+ LD  + +G+ VR  +T+ Y+IY+IH E CGYY F+++ G    S+   P P   S Y+Y FY  MKTATSIG+ P+ T  +E+ FM  YWLSGI V A+LIGQ+ DI D+A+AN+ NYRK MD T+  M+ L+  + ++ KV  WF YNW+  KT +ENSL E LP KLKSDLAI  HF+TLSKV+LFQ+CE+ L+ D+ILKL+PV+FLP D+IC+KGE+G EMYIV +G VEVVGGPNNSIVF TLKEGSVFGEISLLALSG NRRTADV+SKGFSTLFSLSKQDFEE M +YP A+ELLK ++ ++LNR K                 +++   + ++ +  VIP +  T  L ETV+K++E+
Sbjct:  166 NLPCFSIQNPEDNEKQE---QGEVKVVKVSEQEMEQPEIIGQECVKLKQISIPLPAWLVGLKDVFSATISPYSNIYLLWLGFLLIAVLYNYITIPLREAFNIYDDEDNMTLWYTLNSLMDILYLMDILLLKPRIEFLDQGITKTDFKSCALHYFKSLQFKIDIISITPLDLFSLFYEKDMARFRVLRLVKINAFWEAFEKLDQRLNAGYAVRLARTIIYMIYIIHLETCGYYAFNRWQGIGETSWTIQPGP--ISPYVYSFYVCMKTATSIGSLPAATNSSEFLFMTCYWLSGILVSAILIGQVIDILDSASANKVNYRKVMDATLSSMQQLHAPQHVVDKVRSWFMYNWDQQKTFNENSLFECLPIKLKSDLAISVHFHTLSKVTLFQNCEKALIYDMILKLKPVVFLPKDYICRKGEVGKEMYIVKSGAVEVVGGPNNSIVFVTLKEGSVFGEISLLALSGKNRRTADVRSKGFSTLFSLSKQDFEEIMKNYPQAHELLKKRSQRMLNRDKKKATDEAVKEKKKLQKEKSNELNDGDVAVIEVIPERPATPKLIETVVKVIES 725          
BLAST of Cyclic nucleotide gated cation channel vs. TrEMBL
Match: A0A504YBV8 (Cyclic nucleotide gated cation channel OS=Fasciola gigantica OX=46835 GN=FGIG_06514 PE=4 SV=1)

HSP 1 Score: 520.39 bits (1339), Expect = 2.099e-171
Identity = 259/522 (49.62%), Postives = 356/522 (68.20%), Query Frame = 2
Query:  482 CSFKLPSF----ETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNR--------------HKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENRRQSSMARDN 1987
            CS  +P++    + IF  +F   + +YL WL+    AV+YNF+TIPLRE F+IY+  Y   W + + ++D +Y+LD+++ + R++++ NG+I  + K CA +YVK ++FK +++S++P DL  L  +   A  R+ R+FK  TF+E FD LD  + +G  VR  +T+ Y+IY+IH E+CGYY F+++ G  + ++  S      S Y+Y FY  MKTATSIG+ P+ T   E+ FM  YWLSGIFV A+LIGQI DI D+A++N+ NYRK MD T+  M +L+    ++ KV  WF YNWE  KT DENSL+++LP KLKSDL I  HFNTLSKV+LFQ+CER L+ D+ILKL+PV+FLP D+IC+KGE+G EMYIV +G VEVVGGPNNS+VF TLKEGSVFGEISLLA+SG NRRTADV+SKGFSTLFSLSK+DFEE M +YP A+ LLK ++ ++LNR              H    +    E E+  VIP +  T  L +TV + +E      +A  N
Sbjct:  137 CSCPIPAWIPGPKVIFASSFSPYSAFYLFWLMCLTFAVLYNFVTIPLREAFDIYDEDYRFYWYIGNAISDGLYLLDMIIVRPRMEFIENGLITTDFKSCARHYVKSTQFKCDIVSVLPLDLCSLFYQQEMARFRILRIFKVYTFWETFDRLDQRLNAGFAVRLARTIIYMIYIIHLESCGYYAFNRWQGMEATTW--SIPVGNISPYVYSFYVCMKTATSIGSLPAATNPLEFLFMTCYWLSGIFVSAILIGQIIDILDSASSNKDNYRKIMDATLSCMHHLHAPVHVVDKVRTWFMYNWEQQKTFDENSLLDTLPIKLKSDLTISVHFNTLSKVTLFQNCERALIYDMILKLKPVVFLPMDYICRKGEVGKEMYIVKSGIVEVVGGPNNSVVFVTLKEGSVFGEISLLAISGKNRRTADVRSKGFSTLFSLSKEDFEEIMKNYPQAHHLLKKRSQRMLNRDKKKAKEEEKARKLHDSTNDIELPEDEVVEVIPERPPTPRLVDTVAQALEVACPEKLATQN 656          
BLAST of Cyclic nucleotide gated cation channel vs. TrEMBL
Match: A0A1I8HBV2 (Cyclic nucleotide-binding domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 511.531 bits (1316), Expect = 9.208e-171
Identity = 258/514 (50.19%), Postives = 337/514 (65.56%), Query Frame = 2
Query:  554 MWLLVSYVAVMYNFLTIPLRECFEIYNYPY---EKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTL--------------------------------------DENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENRRQSS 1972
            MWL +  +A+ YN+  IPLR  F IY+ P       W   DY++D IY+LDI + + R++++N GI+E + K C  +Y+  + FK++                      L  L + F+ELFD+LD + K+GH++R V+T+ Y+I++IH EAC +Y  SK+ G  S+++V+ P  +  +AY+YCFY+A   AT+IG+NP PT Y EY FM  YWLSGIFVFA+LIGQI +I  AANAN+TNYR  MD T  YM++LN+ E M+ KV  WF+YNWE  KTL                                      DENSL+E LP KLK+DLAI  HF  LSKVSLFQDCER LLSDLILKL+PVL+LP D+IC+KGE+G EMYI+M GQVEVVGGPNNSIVF TLKEGSVFGEISL++LSGGNRRTADV+SKGF+TLF+LSK DFEEAM DYP AY LLK +A K L + K  + + K+  + E VI  ++ T  L +TV++ +   +  S
Sbjct:    1 MWLCLLTLAMAYNYFAIPLRSTFTIYDLPGSVGRTTWLCLDYLSDVIYVLDIFI-KMRVRFVNQGILEKDPKACRKHYIGKADFKLD----------------------LAALLQAFWELFDMLDKMAKNGHVIRIVRTILYMIFIIHVEACIFYQVSKWEGLGSNTWVYDPESN-VTAYVYCFYFATSLATNIGDNPPPTNYIEYLFMTCYWLSGIFVFALLIGQIGEIVQAANANKTNYRSTMDITTWYMRSLNVPEYMLDKVRTWFDYNWEQQKTLGKLQKFALRLCRTCYSGQWGNCACSLIRKSYLSYLKSSDENSLLEGLPRKLKTDLAISVHFTILSKVSLFQDCERALLSDLILKLKPVLYLPGDYICRKGEVGMEMYIIMNGQVEVVGGPNNSIVFVTLKEGSVFGEISLMSLSGGNRRTADVRSKGFATLFTLSKADFEEAMQDYPQAYALLKKRAKKTLTKGKATK-TEKRIVQTEEVIKEREPTPKLLKTVIQAVSKEKPKS 489          
BLAST of Cyclic nucleotide gated cation channel vs. TrEMBL
Match: A0A1I8HRR1 (Cyclic nucleotide-binding domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 1.017e-170
Identity = 259/516 (50.19%), Postives = 344/516 (66.67%), Query Frame = 2
Query:  554 MWLLVSYVAVMYNFLTIPLRECFEIYNYPY---EKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTL--------------------------------------DENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENRRQSS 1972
            MWL +  +A+ YN+  IPLR  F IY+ P       W   DY++D IY+LDI + + R++++N GI+E + K C  +Y+  + FK+++ +++P DL    +      +R  RL K   F+ELFD+LD + K+GH++R V+T+ Y+I++IH EAC +Y  SK+ G  S+++V+ P  +  +AY+YCFY+A   AT+IG+NP PT Y EY FM  YWLSGIFVFA+LIGQI +I  AANAN+TNYR  MD T  YM++LN+ E M+ KV  WF+YNWE  KTL                                      DENSL+E LP KLK+DLAI  HF  LSKVSLFQDCER LLSDLILKL+PVL+LP D+IC+KGE+G EMYI+M GQVEVVGGPNNSIVF    +GSVFGEISL++LSGGNRRTADV+SKGF+TLF+LSK DFEEAM DYP AY LLK +A K L + K  + + K+  + E VI  ++ T  L +TV++ +   +  S
Sbjct:    1 MWLCLLTLAMAYNYFAIPLRSTFTIYDLPGSVGRTTWLCLDYLSDVIYVLDIFI-KMRVRFVNQGILEKDPKACRKHYIGKADFKLDLAALVPLDLLYFAI-GIVPIVRFPRLLKLQAFWELFDMLDKMAKNGHVIRIVRTILYMIFIIHVEACIFYQVSKWEGLGSNTWVYDPESN-VTAYVYCFYFATSLATNIGDNPPPTNYIEYLFMTCYWLSGIFVFALLIGQIGEIVQAANANKTNYRSTMDITTWYMRSLNVPEYMLDKVRTWFDYNWEQQKTLGKLQKFALRLCRTCYSGQWGNCACSLIRKSYLSYLKSSDENSLLEGLPRKLKTDLAISVHFTILSKVSLFQDCERALLSDLILKLKPVLYLPGDYICRKGEVGMEMYIIMNGQVEVVGGPNNSIVF----QGSVFGEISLMSLSGGNRRTADVRSKGFATLFTLSKADFEEAMQDYPQAYALLKKRAKKTLTKGKATK-TEKRIVQTEEVIKEREPTPKLLKTVIQAVSKEKPKS 508          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Cavefish
Match: cngb1b (cyclic nucleotide gated channel subunit beta 1b [Source:ZFIN;Acc:ZDB-GENE-090831-4])

HSP 1 Score: 370.933 bits (951), Expect = 3.266e-117
Identity = 214/607 (35.26%), Postives = 341/607 (56.18%), Query Frame = 2
Query:  215 NSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETD-DESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQED----VTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKK------------DTSNLHETVLKLMENRRQSSMA 1978
             S  S  +  +N+RL+ + + F ER E  K ++I P   + D   +      GP  + VK  E +    +   E  P+E+    V   KVN +     L  +   F  + +     Y++WL    +A  +N   IP+R  F         +W + DY+ D IYI+DILLFQ R+Q++  G I  + K    NY++  +FK++V S++P +LF  I       LR  RL K  +FFE    L+ ++   + V  ++T +Y++Y +H  AC YY  S   G  S  +V+S        YI C+Y+A+KT  +IG  P PT   E  F  V +  G+F F+++IGQ+RD+  AA A+QT+YR  MD+T+ YM +  + + +  +V  W+NY W+    LDE  L+  LP K++ D+A+  +++ +SKV LF+ C+R ++ D++ +L+ V++LP D++CKK E+G EMYI+ +G+V+VVGGP   IVFATLK G+VFGEI LLA+ GGNRRTA+V + GF+ LF L K+   E +  YP + ++L+ KA K+L   K +E   +++  + ++ P  +            + S L  T+ KL E  ++SS++
Sbjct:  168 TSSASQTSTVVNERLQELVKLFKERTERAKEKLIDPDDSDNDTPPAPTVTAPGPSSNTVKETEAEGEAQDTPAEKEPKEEKYSRVLCFKVNPQSRMSHLLQYR--FPASIDPFTLVYVLWLFFVTLAWNWNLWMIPVRWAFPFQTRDNIHLWLMTDYLCDTIYIMDILLFQPRMQFIRGGDIVSDSKETRKNYMRALRFKLDVASLLPLELFYFI-TGINPLLRCPRLLKIMSFFEFNMRLEAILTKAY-VYVIRTTTYLLYSLHCNACLYYWISANQGLGSTHWVYS----GEGNYIRCYYFAVKTLITIGGLPDPTNLKEIIFQLVNYFVGVFAFSIMIGQMRDVVGAATADQTHYRSCMDSTVKYMGSNRIPKDVQNRVKTWYNYTWQSQGMLDEQELLVQLPDKMRLDIAVDVNYSIVSKVPLFEGCDRQMIYDMLKRLKSVVYLPGDYVCKKDEVGREMYIIKSGEVQVVGGPGGKIVFATLKAGAVFGEI-LLAVGGGNRRTANVIAHGFANLFILEKKGLNEILVHYPESQKVLRKKA-KMLAEKKPVEKKEEEKEPVHVIPPRPETPKLFKAALEMTEKSGLRGTLAKLKEQTKKSSLS 764          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Cavefish
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 353.214 bits (905), Expect = 2.419e-111
Identity = 205/586 (34.98%), Postives = 329/586 (56.14%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDN--------EKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEK-----IWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMEN 1957
            +N RL+ + + F ER +  + +++ P   E+D+ES +  +  P        + +             + LE  PQ       + + I  ++ PS  +I  +TF      Y++WL     A  YN   IP+R  F     PY+      +W + DY  D IYI+DI++FQ RLQ++  G +  + K    NY++  +FKM+++S++P ++ +      K+ LR  R+ K   FFE  D L+  +K  +I  F +T  Y+IY +H  AC +Y  S + G  S  +V++        YI C+Y+A+KT  +IG  P PT   E  F  V +  G+F F+++IGQ+RD+  AA A Q  YR  +D+T+ YM +  +   +  +V  W++Y W+    L E  L++ LP K++ D+A+  +++ +SKV+LFQ C+R ++ D++ +L+ V++LP DF+CKKGEIG EMYI+  G+V+VVGGP+ + VF TL+ GSVFGEI LLA  GGNRRTA+VK+ GF+ LF L K+D  + +  YP + ++L+ KA  +    K  E   K   E   VIP + +T  L +  L++ + 
Sbjct:   54 VNVRLQELVKLFKERTDRTRDRLVDP--DESDEESPSKADAPPPPPPPPEGQKEAAEAEKEVEEEEEQFLEFMPQIPKMPDWL-RAILEYRFPS--SIDPYTF-----IYVVWLFFVTCAWNYNVWLIPVRMFF-----PYQTPENIYLWLLADYTCDAIYIMDIVIFQPRLQFVRAGDVVCDKKDMKENYMQTERFKMDIISMMPLEV-LYYFTGVKSILRFPRILKYQAFFEFNDRLESFMKKAYIYVF-RTSVYLIYSLHINACLFYWGSDYEGLGSTKWVYNGK----GNYIRCYYFAVKTLITIGGLPDPTTVFEIIFQCVNYFVGVFAFSIMIGQMRDVVGAATAGQAYYRACVDSTVNYMTSYRIPREVQNRVKTWYDYTWQSQGML-ERDLLDQLPDKMRLDIAVDVNYSIVSKVALFQGCDRQMIFDMLTRLKSVVYLPGDFVCKKGEIGREMYIIKAGEVQVVGGPDGTTVFVTLRAGSVFGEI-LLAGGGGNRRTANVKAHGFANLFILDKKDLADILVHYPESQKILRKKAKMLTKDKKPDEKEGKDTGE---VIPPRPETPKLFKAALEVAKG 613          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Cavefish
Match: cngb3.2 (cyclic nucleotide gated channel subunit beta 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-091118-102])

HSP 1 Score: 343.199 bits (879), Expect = 6.063e-108
Identity = 166/439 (37.81%), Postives = 267/439 (60.82%), Query Frame = 2
Query:  539 NRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHK--AALRLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALS--GGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLN 1843
            +R Y+ WL +  +A  YN   IP+R  F  +      IW   D +AD +Y++D+++FQ RLQ+   G I  +  +   +Y + SKF+  ++S++P D+  +    H    A RL R F+ FFE  D L+ ++   +I R ++T+ Y+++++H  AC YY+ S + G  +  +V+S      SAY+ C+Y+A++T  +IG  P P    E  F    +  G+FVF+ LIGQ+RD+  AA A QT +R  MD+ + YM    + + +  +V  W+NY W+    LDE+ L+  +P  +++ +A+  +  T  K+ LF+ C+  +L D++L+L+ +++LP DF+CKKG+IG EMYI+  G+V+V+GGP+N IVF TLK G VFGEISLL  S  GGNRRTA+V + GF+ LF L K+D  + +  YP + ++L  K  K++ 
Sbjct:  159 DRRYITWLSIVTIAFNYNLWFIPVRMAFPYHTPGMIPIWFTLDILADLMYLIDMVIFQPRLQFCRGGDIIFDRAVIKKHYRETSKFQNALISVLPLDVLYIPFGFHSIYRANRLMR-FEAFFEFSDRLEGILTKAYIWRVIRTIGYLLFILHLNACVYYVASAYEGIGTTKWVYSGVG---SAYLRCYYFAVRTLINIGGLPEPHTVFEISFQLTNFFVGVFVFSSLIGQMRDVIGAATAGQTYFRASMDSCVAYMVTNRIPKLVQHRVRTWYNYTWDSQGMLDESELLVQMPLVMRTAIAVDINLATFQKIELFKGCDNQMLVDMLLRLKSIVYLPGDFVCKKGDIGKEMYIIKAGEVQVIGGPDNKIVFVTLKAGCVFGEISLLQSSANGGNRRTANVAAHGFANLFVLDKKDLNDILVHYPESQKVLARKGRKLMK 593          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Cavefish
Match: cngb3.2 (cyclic nucleotide gated channel subunit beta 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-091118-102])

HSP 1 Score: 343.199 bits (879), Expect = 6.063e-108
Identity = 166/439 (37.81%), Postives = 267/439 (60.82%), Query Frame = 2
Query:  539 NRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHK--AALRLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALS--GGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLN 1843
            +R Y+ WL +  +A  YN   IP+R  F  +      IW   D +AD +Y++D+++FQ RLQ+   G I  +  +   +Y + SKF+  ++S++P D+  +    H    A RL R F+ FFE  D L+ ++   +I R ++T+ Y+++++H  AC YY+ S + G  +  +V+S      SAY+ C+Y+A++T  +IG  P P    E  F    +  G+FVF+ LIGQ+RD+  AA A QT +R  MD+ + YM    + + +  +V  W+NY W+    LDE+ L+  +P  +++ +A+  +  T  K+ LF+ C+  +L D++L+L+ +++LP DF+CKKG+IG EMYI+  G+V+V+GGP+N IVF TLK G VFGEISLL  S  GGNRRTA+V + GF+ LF L K+D  + +  YP + ++L  K  K++ 
Sbjct:  159 DRRYITWLSIVTIAFNYNLWFIPVRMAFPYHTPGMIPIWFTLDILADLMYLIDMVIFQPRLQFCRGGDIIFDRAVIKKHYRETSKFQNALISVLPLDVLYIPFGFHSIYRANRLMR-FEAFFEFSDRLEGILTKAYIWRVIRTIGYLLFILHLNACVYYVASAYEGIGTTKWVYSGVG---SAYLRCYYFAVRTLINIGGLPEPHTVFEISFQLTNFFVGVFVFSSLIGQMRDVIGAATAGQTYFRASMDSCVAYMVTNRIPKLVQHRVRTWYNYTWDSQGMLDESELLVQMPLVMRTAIAVDINLATFQKIELFKGCDNQMLVDMLLRLKSIVYLPGDFVCKKGDIGKEMYIIKAGEVQVIGGPDNKIVFVTLKAGCVFGEISLLQSSANGGNRRTANVAAHGFANLFVLDKKDLNDILVHYPESQKVLARKGRKLMK 593          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Cavefish
Match: cngb3.2 (cyclic nucleotide gated channel subunit beta 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-091118-102])

HSP 1 Score: 342.813 bits (878), Expect = 9.178e-108
Identity = 166/439 (37.81%), Postives = 267/439 (60.82%), Query Frame = 2
Query:  539 NRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHK--AALRLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALS--GGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLN 1843
            +R Y+ WL +  +A  YN   IP+R  F  +      IW   D +AD +Y++D+++FQ RLQ+   G I  +  +   +Y + SKF+  ++S++P D+  +    H    A RL R F+ FFE  D L+ ++   +I R ++T+ Y+++++H  AC YY+ S + G  +  +V+S      SAY+ C+Y+A++T  +IG  P P    E  F    +  G+FVF+ LIGQ+RD+  AA A QT +R  MD+ + YM    + + +  +V  W+NY W+    LDE+ L+  +P  +++ +A+  +  T  K+ LF+ C+  +L D++L+L+ +++LP DF+CKKG+IG EMYI+  G+V+V+GGP+N IVF TLK G VFGEISLL  S  GGNRRTA+V + GF+ LF L K+D  + +  YP + ++L  K  K++ 
Sbjct:  159 DRRYITWLSIVTIAFNYNLWFIPVRMAFPYHTPGMIPIWFTLDILADLMYLIDMVIFQPRLQFCRGGDIIFDRAVIKKHYRETSKFQNALISVLPLDVLYIPFGFHSIYRANRLMR-FEAFFEFSDRLEGILTKAYIWRVIRTIGYLLFILHLNACVYYVASAYEGIGTTKWVYSGVG---SAYLRCYYFAVRTLINIGGLPEPHTVFEISFQLTNFFVGVFVFSSLIGQMRDVIGAATAGQTYFRASMDSCVAYMVTNRIPKLVQHRVRTWYNYTWDSQGMLDESELLVQMPLVMRTAIAVDINLATFQKIELFKGCDNQMLVDMLLRLKSIVYLPGDFVCKKGDIGKEMYIIKAGEVQVIGGPDNKIVFVTLKAGCVFGEISLLQSSANGGNRRTANVAAHGFANLFVLDKKDLNDILVHYPESQKVLARKGRKLMK 593          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Sea Lamprey
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 344.739 bits (883), Expect = 2.636e-111
Identity = 178/432 (41.20%), Postives = 269/432 (62.27%), Query Frame = 2
Query:  539 NRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKA 1828
            +R YL+WL +  +A  ++   +PLR  F ++       W + DY  D IY+LDIL+ Q RLQ+++ G I  + K  +  Y    KFK ++LS++P D+  L      A  RL RL K   FFE  D L+ ++   +I R ++T  Y+++ +H  AC YY  S   G  S  +V++    +Y   I C+YWA+KT  +IG  P P+   E  F    +  G+FV +++IGQ+ D+  AA A Q  YR  MD T+ YM   ++S ++  +V MW+ Y W     LDE+ L+E LP K++ ++AI  ++  ++KV+LF+ C+R ++ D++L+L+ V++LP DF+CKKGE+G EMYI+  G+V+VVGGP+N IVF TL+ GSVFGEISLLA+ GGNRRTA+V + GF+ LF L K+D  E +  YP + +LL+ KA
Sbjct:   51 DRIYLIWLTLVMLAFQWSCWFLPLRLSFPVHTPNTMSFWYIGDYTCDAIYLLDILVMQCRLQFVHRGDIITDQKETSKFYYHSEKFKSDLLSLLPLDILYLKF-GPSAMFRLPRLIKYYAFFEFNDRLEAIMSKAYIYRVIRTTGYLLFSLHLNACFYYFVSDMEGLGSTRWVYNGKGYRY---IRCYYWAVKTLITIGGLPEPSNLIEIVFQLSNYFLGVFVVSIMIGQMGDVIGAATAGQNYYRTCMDNTLSYMNMYHISRAVQNRVRMWYEYTWASQGMLDESELLEKLPIKMRLEIAIDVNYTIVNKVALFKGCDRQMIYDMLLRLKSVVYLPGDFVCKKGELGREMYIIKAGEVQVVGGPDNKIVFVTLRTGSVFGEISLLAVGGGNRRTANVMAHGFANLFILDKRDLNEILRIYPESEKLLRKKA 478          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005594.1 (pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1 gene:ENSPMAG00000005049.1 transcript:ENSPMAT00000005594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 1.664e-22
Identity = 109/524 (20.80%), Postives = 210/524 (40.08%), Query Frame = 2
Query:  380 SNVKADE-IKKPPDNEKLELPPQEDVTSIKVNKRICSF------KLPSFE----TIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEK----------IWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINH-KMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAA-------LRLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKF---------------------IGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIG-NNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYP 1798
            S+ ++D+ +  PP +EK  +PP+    +  V +++          LP ++     I   T    + +  +W  +  + V+Y  +  P    F + +   E             N+ D + D ++++DI +   R  Y+N     ++H    AI+Y KG  F +++++ IP DL +    +           L+  RL +    +   LD   + G  V  V  M     + H+ AC +Y                          IG   +    S  P     Y+   Y+   + TS+G  N SP    E  F     L G  ++A + G +  I     +    Y  +M     +++   +   + +++  +F + W +   +D N +++  P  L++D+ +H +   L     F    +  L  L +K +     P D +   G++ T MY +  G +E++      IV A L +  +FGE  +   S   + +ADV++  +  L  + ++D  E +  YP
Sbjct:   31 SDFRSDKTVVTPPSSEKNFIPPKVKEKTHHVTEKVTQVLSLGADVLPEYKLQAPRIHKWTILHYSPFKAVWDWLILLLVIYTAIFTPYTAAFLLSDQQVENERQKCGYSCNPLNIVDLMVDIMFMVDIFI-NFRTTYINKNEEVVSHPGKIAIHYFKGW-FLIDMVAAIPFDLLIFGSGSGSGETTTLIGLLKTARLLR-LVRVARKLDRYSEYGAAV-LVLLMCTFALIAHWLACIWYAIGNMERPVDSLAKDRIGWLDQLGGQIGKPYNDTDTSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNYEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNMVLKGFPECLQADICLHLNRTLLESCKAFNGASKGCLRALAMKFKTTHAPPGDTLVHSGDVITAMYFLSRGSIEIL---REDIVVAILGKNDIFGE-PVNQYSRPGKSSADVRALTYCDLHKIVREDMLEVLDMYP 546          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005922.1 (pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-1 gene:ENSPMAG00000005344.1 transcript:ENSPMAT00000005922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 1.999e-21
Identity = 104/488 (21.31%), Postives = 219/488 (44.88%), Query Frame = 2
Query:  443 QEDVTSIKVNKRICSFK--LPSFETIFLHTFESRNRYYLM--------WLLVSYVAVMYNFLTIPLRECFE--IYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLN-NGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLI-HFEACGYYLFSKF-----------IGFSSD--SFVFSP--------APDQYSAYIYCFYWAMKTATSIG-NNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYP 1798
            ++D   +K+N  +   K  LP ++   +     ++R+ L+        W L+  +A  Y  +T+P   CF   + N    +   V D   + ++I+DILL   R  Y++ +G +  + +   ++YV  + F +++++ +P DL      +    + L +  +    L  + +    S +    +  + ++  L+ H+ AC +Y   +            IG+  +    + +P         P   SAYI   Y+A+ + TS+G  N S    AE  F     L G  + AV+ G +  I     + ++ Y  +      +++   L + + ++++ +F   W  +  +D + L++  P +L++D+A+H +   L ++++F+   R  L  L L ++P    P +F+ ++G+     Y V +G +EV+    + +V A L +G + G   L +     +  ADVK+  +  L  +  +   + +  YP
Sbjct:   17 KQDKNKLKINNNVFGEKPSLPEYKVAAIQ----KSRFILLHYGTFKAGWDLLILLATFYVAVTVPYNVCFSETVENISDPRSTAVVDISVEILFIIDILL-NFRTTYVSKSGQVVYDGRSICVHYVT-TWFFIDLIAALPFDLLYAFNVSVTTLVHLLKTVRLLRLLRLLQNLDRYSQYSTVVLTLLMFMFGLLAHWMACIWYKIGRAEIEINDRHSWDIGWLHELGKKLETPFHTNNTGGGPSTRSAYIASLYFALSSLTSVGFGNVSANTDAEKIFSVCAMLIGALMHAVVFGNVTAIIQRMYSRRSQYHTRTKDLKDFIRVHRLPKQLKQRMLEYFQTTWSVNNGIDTHELLKDFPDELRADIAMHMNKEIL-QLAIFESASRGCLRSLSLSIKPSFCAPGEFLIRQGDALQAFYFVCSGSMEVL---KDDMVLAILGKGDLIGS-DLSSKDQVLKTNADVKALTYCDLQCIHLRGLYDVLDLYP 493          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 87.8113 bits (216), Expect = 4.702e-18
Identity = 91/420 (21.67%), Postives = 172/420 (40.95%), Query Frame = 2
Query:  653 WNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKTFF-----ELFDVLDHVVKSG--------HIVRFVK--------------TMSYIIYLI-------HFEACGYYLFSKF----------------------IG----FSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIG-NNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEI----SLLALSGGNRRT 1717
            W V D V D I+++DI+L  H       G +  + K+  +NY+K + F +++LS +P D+ +   +N    +R  ++   F       L D    V   G         +VR ++                + ++ L+       H+ AC +Y    +                      IG    F+   +   P+ D  + YI   Y+ M + TSIG  N +PT   E  F     + G  ++A + G +  IF    AN   Y + +++   ++K   + + + ++V+ +    W   K +D   ++   P  +++D+ +H +    ++   F+      L  L ++ +     P D I   GE    +  V++G +EV+    +  V A L +G VFG++     ++A S  N R 
Sbjct:  230 WLVVDSVVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLK-TWFVIDLLSCLPYDI-INAFENVDEVVRAAQIRGPFGSRSPSRLLDAWPRVAPQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEATNLIRKHSWLYQLGETIGTPYHFNGTQWEGGPSKD--AVYISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLHICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTHHCAPGDLIYHAGESVDTLCFVVSGSLEVI---QDDEVVAILGKGDVFGDVFWKERVIAPSCANVRA 642          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001558.1 (pep scaffold:Pmarinus_7.0:GL480650:659:21543:-1 gene:ENSPMAG00000001411.1 transcript:ENSPMAT00000001558.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 4.184e-15
Identity = 50/210 (23.81%), Postives = 100/210 (47.62%), Query Frame = 2
Query: 1034 SSDSFVFSPAPDQYSAYIYCFYWAMKTATSIG-NNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKE 1660
            S++S V    P   SAYI   Y+ + + TS+G  N S    +E  F     L G  + AV+ G +  I     + ++ Y  +      +++   L + + ++++ +F   W  +  +D N L++  P +L++D+ +H +   L ++ LF+   R  L  L L ++     P +++ ++G+       V++G +EV+    +  V A L E
Sbjct:   86 SANSSVSHCGPPLRSAYITSLYFTLSSITSVGFGNVSANTDSEKIFSICAMLIGALMHAVVFGNVTAIIQRMYSRRSLYLTRTKDLKEFIRIHRLPQPLKQRMLEYFQTTWSVNNGIDTNELLKDFPDELRADVTMHLNKEML-QLPLFEAASRGCLRSLSLNVKTTFCAPGEYLIRQGDALQAFCFVLSGSMEVL---KDGTVLAILGE 291          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Nematostella
Match: EDO35393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM8])

HSP 1 Score: 301.597 bits (771), Expect = 6.070e-95
Identity = 165/448 (36.83%), Postives = 259/448 (57.81%), Query Frame = 2
Query:  533 SRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRL--FKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQY---------SAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLAL-SGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVL 1840
            S +R Y  WLLV  +AV+YN   I LR  F   N     IW + DY  D IYI DIL+   R  +L  GI++        +Y+   +F ++  ++IP D+   I   H+ A R+ R+  F  F+   D  +      ++VR    + +I+ +IH+ AC Y++ S+ IGF SD +V+     +            YIY FYW+  T T+IG  P P    EY  + + +L G+ +FA ++G + +I    NA + +++ KMD    YM+   + + + ++VI WF+Y W + K  DE  ++ SLP KL++++AI+ H ++L KV++FQDCE   L +L+L+LR  LF P D++C+KGE+G EMYIV  G++EVV   + + ++A L+ GS FGEIS+L++ S GNRRTA V+S G++ LF L+K D  E + +YP   E ++  A + L
Sbjct:    1 SGDRLYF-WLLVVSLAVLYNCWAIILRTAFPQINDKITYIWLILDYSCDLIYIADILV-SMRTGFLEEGILQTCSTKMRRHYLHTYEFYLDAGALIPLDI-AYIFIEHEPAFRINRILKFHRFWHFLDRTESRTTFPNVVRLASLVQFILLIIHWNACIYFIVSREIGFGSDVWVYPGVRQEILNSSENTISRMYIYSFYWSTLTLTTIGEVPPPYSEVEYIIVTLDYLIGVLLFATIVGNVGNIITNLNATRLDFQNKMDGIKAYMRFHKIPQHLQRRVIKWFDYLWTYKKHPDEEEILLSLPDKLRAEIAINVHLDSLRKVAIFQDCEAGFLCELVLRLRSQLFSPGDYVCRKGEVGREMYIVNRGKLEVV-SEHGTKIYAVLEAGSYFGEISVLSMSSAGNRRTASVRSVGYTELFCLAKNDLMEVLDEYPNIKEKIEKIAKEKL 444          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Nematostella
Match: EDO34633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW2])

HSP 1 Score: 266.929 bits (681), Expect = 8.406e-82
Identity = 157/441 (35.60%), Postives = 243/441 (55.10%), Query Frame = 2
Query:  557 WLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDL--FVLILKNHKAALRLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVF----SPAPDQYS-AYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG-GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNR-HK 1852
            WL +  VAV+YN++ I  R+CF      +  +W V DY+ D IY +DI++ + R  YL+ G++  + K    NY+   KFK++++SI+P D   F L  +     L          +LF   +      ++++    +  I+ + H+ AC Y+  S+ IGF SD +V+    S   D+ S  Y+Y FYW+ +   +  +   P    E  F+      G   FA L+GQ   I       +  +    ++   YM N  ++  + ++VI W +Y W   ++LD   +++ LP KL+  +A+H +   L  V +F DCE  LL ++++KLR  +F P D+IC+KG++G EMYIV +G ++VV G + + V A L EGS FGEIS+L LSG GNRRTA V+S GFS L  LSK D  EAM+DYP A   L+ +  ++LNR HK
Sbjct:    4 WLYIVSVAVVYNWVFIIARQCFSQLQVRFMTLWFVMDYICDIIYGMDIMV-EFRTAYLDQGLLVRDLKKLRQNYLATVKFKLDMISILPFDFLYFGLGTRFTLCRLLRLLRIHRVVKLFQRGETKSSYPNLLQTFAVVLVILLVFHWNACFYFAISESIGFGSDKWVYPNLSSNNYDKLSRQYLYSFYWSTRMMITGESENPPETDMELLFVVADLTVGYLTFAALVGQFGAILGHIMRARVEFITHSNSIKQYMNNHKVNNDLQERVISWIDYMWHKKRSLDHERILKKLPEKLRGQIAVHVYLAVLRHVPVFADCEPGLLREIVVKLRSQVFSPGDYICRKGDVGREMYIVNSGCLQVV-GDDGTTVLAILSEGSYFGEISILNLSGIGNRRTAAVRSVGFSDLLCLSKDDLLEAMSDYPEARMRLEERGRELLNRTHK 442          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Nematostella
Match: EDO49540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK0])

HSP 1 Score: 265.003 bits (676), Expect = 3.705e-81
Identity = 160/417 (38.37%), Postives = 234/417 (56.12%), Query Frame = 2
Query:  557 WLLVSYVAVMYNFLTIPLRECF-EIYN-YPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINH-KMCAINYVKGSKFKMNVLSIIPTDLFV-LILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSA-YIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVV---GGPNNSIVFATLKEGSVFGEISLLALS-GGNRRTADVKSKGFSTLFSLSKQDF 1774
            W  +   AV YNF  + LR  F E+ N   Y  I+   D ++D IY++DIL+ Q R  Y ++  I IN  K+ A+NY     F ++ LS+ P +  +   L       R  RL K       F + D      + +R VK   Y+   +H+ ACGYY+ S++ G  S+S+V+  A  +    YI   YW++ T T+IG  P P+   E+ F +  +L GIFVFA ++G + D+    NA +T+++ KMD    YM++  + E +  +   W  Y W  H     +  +  LP +L+++LAIH H  TL KV +F+DC+  LL +L+LKLRP +F P D+IC+ GEIG EMYI+  G+VEVV         IV A+L EG+ FGEISLL L  G NRR+ADV+S G+S L  LS++D 
Sbjct:   14 WAALVTFAVFYNFCIVLLRIAFKEVRNELFYRMIYWPLDVISDIIYLVDILV-QFRTAYRDDHGIMINTPKLLALNYCSKIPFFLDALSVFPLETTLPFTLVQPSVWFRCLRLLKWHCVLRFFVISDLRTNKPNRLRVVKLALYLGLALHWVACGYYMISEYEGLGSNSWVYPEASGEDGKKYIKSLYWSILTLTTIGETPEPSTNLEHVFTSAMFLFGIFVFAAVVGNVGDVISNMNAARTDFQTKMDYIKSYMEHHKVPEDLQNRAKRWAYYAWSRH-----SDALGMLPLRLRAELAIHVHLATLKKVKIFKDCDEGLLCELVLKLRPQIFSPGDYICRCGEIGREMYIINHGKVEVVVPDSTTGEKIVVASLTEGNYFGEISLLRLDEGRNRRSADVRSVGYSELLWLSQKDL 424          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Nematostella
Match: EDO39918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S2])

HSP 1 Score: 263.077 bits (671), Expect = 1.434e-80
Identity = 144/425 (33.88%), Postives = 234/425 (55.06%), Query Frame = 2
Query:  539 NRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKTF--FELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALS-GGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAA 1804
             R+  +W      A+ YN   + LR  F      +   W VFDY  DF+Y+LDI++   R  +L  GI+ ++ K  A +Y     F  ++LS+ PTD+  ++       LR+ RL K +  F +  +++        +R    +  +  LI++ A  Y + S+  GF ++++V+      Y  Y+   YW+  T T+IG+ PSP    EY +    +L G+F+FA ++G    I    NAN+ ++ ++ + T  YM+   + + + ++V+MW++Y+W      D NSL   LP KLK+++A+H +  TL KV+  Q C+   L DL+L ++  +F P DFIC+KGE+  EMY+++ G++EVVG      V   L  G  FGEI +L+LS G NRRTAD+++ G+   F LSK+D  +A  DYP A
Sbjct:    6 GRFMYIWFYFVVFAIRYNLWVVILRIAFPAAQDEFTVAWLVFDYFCDFLYVLDIII-NFRTGFLEEGILVVDAKRVARHYAVSKNFIADLLSVFPTDILCVLYPERLPMLRINRLIKAYKSFRIKSLMESHTTYPTFLRVFFLLHLMFLLINWNAGFYIMISRTEGFGTNAWVYPGNGSLYQQYLKSLYWSTLTLTAIGDLPSPATNFEYLYTIACYLCGVFMFATIVGNAGSIIVNRNANRLDFERQREGTNNYMRKNRVPKDLQRRVLMWYDYSWASGGG-DLNSL-TLLPDKLKTEIALHVNLETLRKVTFLQKCQPEFLHDLVLMMKLRIFTPGDFICRKGEVAREMYVIIDGKIEVVGEVGQ--VLKVLSGGDFFGEIGILSLSEGQNRRTADIRTIGYVECFVLSKEDVLKATRDYPEA 425          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Nematostella
Match: EDO35376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM9])

HSP 1 Score: 249.21 bits (635), Expect = 4.037e-75
Identity = 150/434 (34.56%), Postives = 230/434 (53.00%), Query Frame = 2
Query:  545 YYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKTFFELFDVLDHVVKSGH--IVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYS----AYIYCFYWAMKTATSIGNN-----PSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG-GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYE 1810
            +Y +WLL   + V+YN+  + +   F   +    K     DY  D I+ LD L+ Q R+ +L +G++ +        Y     F ++++SI+P D+  L L      LR  RLFK    L       + SG   +    K + Y+  +IH+ AC Y++ S++ GF +D ++      Q S     Y+Y  Y +  + T++G        +P      CF+ V +L+G+ +FA ++G   D+      ++  Y +K++    Y++   L   + K+VI WF+Y W H + ++E  L   L    K+++AIH + +TL +V +F DC+   L +L+LKLRPV+  P DFIC++GE G EMYIV  G +EV+       V ATL  GS FGEISLL + G GN RTA V+S GFS LF LSK D EE +  YP A E
Sbjct:    9 FYFLWLLTVSLGVIYNYWALIVYVAFPSVHEANLKTCIAVDYTFDSIFFLDTLV-QFRVGFLEHGVMVVGCWKLTKKYGCSFGFMLDLISILPFDVLYLYL-GVLPILRFNRLFKAHRFLLFCDRGEIYSGRPKLFNLAKLIHYLFLIIHWVACVYFILSRYEGFGTDEWLHPRLDGQLSKLSMQYLYSLYRSSVSMTTVGAGVIGTIATPRTELTLCFVIVTYLTGVLIFATIVGNAGDMIVEMRRSRERYLRKLNGMKEYIEAYQLPAHLKKRVIHWFDYLWRHKRDMNEQELFHKLNDNFKAEIAIHVNLDTLIRVEMFHDCDPGFLHELVLKLRPVICSPGDFICRQGEKGREMYIVNKGSLEVL--DEKETVLATLSAGSHFGEISLLNMKGIGNLRTASVRSVGFSDLFQLSKTDLEEVLEFYPQAKE 438          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Medaka
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 366.696 bits (940), Expect = 1.881e-116
Identity = 211/597 (35.34%), Postives = 337/597 (56.45%), Query Frame = 2
Query:  215 NSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNP---------KENGPKDSNVKADEIKKPP---DNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSL--FQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMEN 1957
             S  S+ +  + +RL  +   F  R E  K +++ P   E +  +K P          E   +D++  A+E +  P   + +  +LPP  D       + I  ++ PS    F          Y++WL     A  +N   IP+R  F         +W + DY  DFIYILD+++FQ RLQ++  G I  + K    NY+   +FKM+V+S+ P ++F  +     + LR  RL K   FFE  D ++ V+K  +I   ++T +Y++Y +H  AC +Y  S + G  S  +V+     + ++YI C+Y+A+KT  +IG  P PT   E CF  + +  G+F F+++IGQ+RD+  AA A +  YR  MD+T+ YM + N+   +  ++  W++Y W+    L++  L++ LP K++ D+A+  +++ +SKV+L  FQ C+R ++ DL+ +L+ V++LP DF+CKKGEIG EMYI+  G+V+VVGGP+   VF T++ GSVFGEI LLA  GGNRRTA+VK+ GF+ LF L K+D  E +  YP + +LL+ KA  +L + K  E     ++ +E VIP + DT  L +  LK+ E 
Sbjct:   28 QSATSIGSVVVQERLNELVSLFKGRTERQKDRLLDPDESEEESPTKAPPAPPPPPPPGEGKKEDTSAAAEEEEVEPFQFEPQLPKLPPMPDWL-----RAILDYRFPSSIDPFTDLI------YVIWLFCVVAAWNWNVWLIPVRWAFPYQTSENIHLWLLADYTCDFIYILDMVIFQPRLQFVRGGDIVCDKKDMRENYMTTERFKMDVISLFPMEIF-YVFTGVNSLLRFPRLLKYMVFFEFNDRMEAVMKKAYIY-VIRTSTYLLYSLHINACLFYWGSDYEGLGSTKWVYD---GKGNSYIRCYYFAVKTLITIGGLPDPTTVFEICFQLINYFVGVFAFSIMIGQMRDVVGAATAGENYYRACMDSTVKYMNSYNIPREVQNRIKTWYDYTWKSQGMLEQELLVQ-LPAKMRLDIAVDVNYSIVSKVALFQFQGCDRQMVFDLLTRLKSVVYLPGDFVCKKGEIGREMYIIKQGEVQVVGGPDLQTVFVTIRAGSVFGEI-LLAGGGGNRRTANVKAHGFANLFILDKKDLAEILVHYPESQKLLRKKAT-MLTKDKKPEEKRPSKATVE-VIPPRPDTPKLFKAALKVTEQ 604          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Medaka
Match: cngb1b (cyclic nucleotide-gated cation channel beta-1 [Source:NCBI gene;Acc:101157535])

HSP 1 Score: 357.066 bits (915), Expect = 1.352e-113
Identity = 208/597 (34.84%), Postives = 332/597 (55.61%), Query Frame = 2
Query:  245 INDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRY------YLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEK-----IWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILK-NHKAALRLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTK-KESEIEIVIPNKKDTSNLHETVLKLME--NRRQSSMARDNE 1990
            +++RL+ + + F ER E  K ++I    P++ DE             +K  E  +   N +++   + DV    ++  +    LP    +F H       +      Y++W+L+  +A  +N   IP+R     + +PY+       W + DYV D IYILDI +FQ RLQ++  G I +N         K   F+ ++ S++P + F      N    L       +F E  + L+ ++   +I R ++T +Y++Y +HF AC Y+  S FIG  S  +V++      + YI C+Y+A+KT  +IG  P PT  +E  F  + +  G+FVF+++IGQ+RD+  AA A QT YR  +D TI YM +  +   +  +V MW+NY W+    LDE  L+  LP K++ D+AI  +++ +SKV LFQ C+R ++ D++  L  V++LP D++CKKGE+G EMYI+  G+V+VVGGP+   VFATL+ GSVFGEISLLA+ G NRRTA+V + G++ LF L K+D  E +  YP + +LL+ KA K+LN+ K  E   + KE+      P + +T  L    L++ E  +R + +M +  E
Sbjct:    6 VSERLQELVKMFKERTEKAKEKLI---DPDSSDEDSIITCESTCFKKMKKQEHSQEHINLRMDRQQRGDVREFLLHNNV----LPHNTVLFPHLLFLSFPFFFSDFMYVLWMLLVSLAWNWNVWFIPVR-----WAFPYQTPDNILYWLLIDYVCDLIYILDITVFQPRLQFVREGDIVVNED-------KSYCFQFDIASLVPLEFFYFKTGINPLLRLPRLLKIYSFLEFNERLEAILTKAYIYRVIRTTTYLLYCLHFNACLYHWTSAFIGLGSTQWVYN---GDGNGYIRCYYFAVKTLINIGGVPDPTSLSETVFQLINYFIGVFVFSIMIGQMRDVVGAATAAQTYYRTCVDNTIKYMSSYRIPRDVQNRVKMWYNYTWQSQGMLDEQELLTQLPEKMRLDIAIDVNYSIVSKVPLFQGCDRQMIFDMLKSLHSVVYLPGDYVCKKGEVGREMYIIKAGEVQVVGGPDGRTVFATLRAGSVFGEISLLAVGGVNRRTANVIAHGYANLFILDKKDLNEILVHYPESKKLLRKKARKMLNKGKKPETKVEAKEAPQVPAAPLRPETPKLLRAALEMAERSSRLKGAMFKVKE 580          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Medaka
Match: ENSORLT00000007489.2 (cyclic nucleotide-gated cation channel beta-3-like [Source:NCBI gene;Acc:101156692])

HSP 1 Score: 341.658 bits (875), Expect = 3.249e-106
Identity = 166/462 (35.93%), Postives = 275/462 (59.52%), Query Frame = 2
Query:  539 NRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLL--ALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKK 1912
            +R Y+ WL +  +A  YN      R  F  +N    K W   D ++D + ++DI+++Q RLQ++  G I  +  +  ++Y K  +FK +++SI+P DL  L   +  +  RL R  +  +FFE  D L+ ++   +I R  +T  Y++Y++H  AC +Y+ S   G ++ ++V+       +AY+ C+Y+A+++  +IG  P P    E  F    +  G+FVF+ LIGQ+RD+  AA A QT +R  MD  + YM    + + +  ++  W+NY W     LDE+ L++ +P  +K+ +A+  +  T  K++LFQ C++ +L D++L+L+ +++LP DF+ KKG+IG EMYI+ +G V+VVGGP+NSIVF TLK G VFGEISLL  A  GGNRRTA+VK+ GF+ LF L K+D  + +  YP + ++L  K  +++         TK+E +  + +  +K
Sbjct:  236 DRRYISWLTLVALAYNYNVWFCTARLAFPYHNETANKYWITCDIISDIVNVIDIIVWQPRLQFVKAGDIIKDRALTKVHYRKSYRFKTDIISILPLDLLSLQF-SFSSIYRLNRFIRIDSFFEFSDRLESIMAKAYIWRVARTTGYLLYVLHLNACAFYVASVHQGLATTTWVYD---GNGTAYLRCYYFAVRSLINIGGLPEPVTVFEIIFQMANFFIGVFVFSSLIGQMRDVIGAATAGQTYFRASMDGCVAYMNTYTIPKLVQNRIRTWYNYTWAAQGMLDESELLDKMPLVMKTAIAVDINMATFQKIALFQGCDQQMLVDMLLRLKSIIYLPGDFVVKKGDIGKEMYIIKSGAVQVVGGPDNSIVFVTLKAGCVFGEISLLQSAKDGGNRRTANVKAHGFANLFVLEKKDLFDILVHYPESQKVLARKGRQLMKSKAPAGPKTKEEKQKGLALFGQK 693          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Medaka
Match: ENSORLT00000027368.1 (cyclic nucleotide-gated cation channel beta-3-like [Source:NCBI gene;Acc:101156926])

HSP 1 Score: 338.191 bits (866), Expect = 1.057e-105
Identity = 170/450 (37.78%), Postives = 268/450 (59.56%), Query Frame = 2
Query:  506 ETIFLHTFES-RNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALS--GGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVL 1840
            +++  HT +   +R Y+ WL V  +A  YN   +  R CF  +       W  FD VAD IY  D +LFQ R Q++  G I  +  M   +Y    +   +V+S++P DL        K+  R  R+ K  TFFE  D L+ ++   +I R ++T+ Y+++++H  AC YY+ S++ G     +V+S      SAY+ C+Y+A+++  +IG    P    E  F    + +G+FVF+ LIGQ+RD+  AA A QT +R  MD T+ YM N ++   +  +V  W+ Y W+    LDE+ L++ +P  +++ +A+  +  T  K+ LF+ C++ +L D++L+L+ +++LP DF+ KKG+IG EMYI+ +G V+VVGGP+NSIVF TLK G VFGEISLL  S  GGNRRTA+VK+ GF+ LF L K+D  + +  YP + ++L  K  K++
Sbjct:  169 DSVVGHTIDPFTDRRYIAWLSVVTLAFNYNTWFVTARLCFPYHTEAAIPYWFAFDVVADLIYATDAILFQPRKQFVKGGDIIKDRSMTKKHYRDSERCLADVVSVLPFDLLYAQF-GFKSVFRANRILKVDTFFEFSDRLESIMAKAYIWRVIRTIGYLLFMLHLNACCYYVASEYQGIGGTKWVYSGLG---SAYLRCYYFAVRSLINIGGLNEPHTVFEITFQMTNFFTGVFVFSSLIGQMRDVIGAATAGQTYFRASMDNTVAYMVNNHIPPLVQNRVRTWYTYTWDAQGMLDESELLDKMPLVMRTAIAVDVNLATFQKIDLFKGCDQQMLVDMLLRLKSIIYLPGDFVVKKGDIGKEMYIIKSGAVQVVGGPDNSIVFVTLKAGCVFGEISLLQSSKDGGNRRTANVKAYGFANLFVLEKKDLFDILVHYPESQKVLARKGRKLM 614          
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Medaka
Match: cnga1b (cyclic nucleotide-gated channel rod photoreceptor subunit alpha [Source:NCBI gene;Acc:101174653])

HSP 1 Score: 327.405 bits (838), Expect = 2.926e-103
Identity = 171/449 (38.08%), Postives = 267/449 (59.47%), Query Frame = 2
Query:  575 VAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRL--FKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVF-SPAPDQYS----AYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIE 1891
            + VMYN+  I  R CFE     Y  +W   D+V+D +Y+LD ++F+ R  YL  G++  + K     Y+   +FKM+++S+IPTD+F LIL      +RL +L  F    E F   +      + +R    + YI+ +IH+ AC YY FSK IGF +D FV+  PA  ++      Y Y  YW+  T T+IG  P P   +EY F+   +L G+ +FA ++G +  +    NA + +++ ++D    YM    +++ + K+VI WF++ W + K +DE  +++ LP KL++++AI+ H +TL KV +F DCE  LL +L+LKL+P ++ P D+ICKKG+IG EMYI+  G++ VV   +    F  L +GS FGEIS+LA+ G   GNRRTA+++S G+S LF LSK D  EA+ +YP A  LL+ K  ++L +  +++       EIE
Sbjct:    3 MPVMYNWTLIIARACFEELQTDYLILWFFLDFVSDILYLLD-MVFRTRTGYLEQGLLVKDEKKLRERYMISFQFKMDMVSMIPTDIFYLILGVTYPEIRLNKLLRFNRMMEFFQRTETRTNYPNALRISNLVMYILIIIHWNACLYYSFSKAIGFGADRFVYPDPADPEFGRLVRKYAYSMYWSTLTLTTIGETPPPVENSEYFFVVTDFLVGVLIFATIVGNVGSMITNMNAARADFQARIDAIKQYMSFRKVTKDLEKRVIKWFDFLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVAD-DGVTQFVVLSDGSYFGEISILAIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKALLEEKGRQILMKDGLLDLEGPDPKEIE 449          
BLAST of Cyclic nucleotide gated cation channel vs. Planmine SMEST
Match: SMESG000033757.1 (SMESG000033757.1)

HSP 1 Score: 1151.35 bits (2977), Expect = 0.000e+0
Identity = 583/614 (94.95%), Postives = 590/614 (96.09%), Query Frame = 2
Query:  161 LDAQXXXXXXXXXXXXXXNSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENRRQSSMARDNEVY 1996
            L+AQTKLRKLKDRKR TKNSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDE KNPKENGPKDSNVKADEIKK      L++    +    K+   I SFKLPSF+TIFL TFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK  TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKL+ENRRQSSMARDNE Y
Sbjct:   22 LNAQTKLRKLKDRKRITKNSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDEGKNPKENGPKDSNVKADEIKK------LQIMKSWNYLLKKI---ISSFKLPSFQTIFLDTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKFQTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLLENRRQSSMARDNESY 626          
BLAST of Cyclic nucleotide gated cation channel vs. Planmine SMEST
Match: SMESG000033757.1 (SMESG000033757.1)

HSP 1 Score: 1132.47 bits (2928), Expect = 0.000e+0
Identity = 559/596 (93.79%), Postives = 564/596 (94.63%), Query Frame = 2
Query:  215 NSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENRRQSSMARDNEVY 1996
            NSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDE KNPKENGPKDSNVKADEIKK                 +++ K         F+TIFL TFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK  TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKL+ENRRQSSMARDNE Y
Sbjct:   55 NSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDEGKNPKENGPKDSNVKADEIKK-----------------LQIMKSWNYLLKKIFQTIFLDTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKFQTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLLENRRQSSMARDNESY 633          
BLAST of Cyclic nucleotide gated cation channel vs. Planmine SMEST
Match: SMESG000033757.1 (SMESG000033757.1)

HSP 1 Score: 1122.07 bits (2901), Expect = 0.000e+0
Identity = 569/614 (92.67%), Postives = 572/614 (93.16%), Query Frame = 2
Query:  161 LDAQXXXXXXXXXXXXXXNSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQEDVTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK--TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLMENRRQSSMARDNEVY 1996
            L+AQTKLRKLKDRKR TKNSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDE KNPKENGPKDSN                                    LPSF+TIFL TFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFK  TFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKL+ENRRQSSMARDNE Y
Sbjct:   22 LNAQTKLRKLKDRKRITKNSRESLINEKINDRLRNIHRKFSERIESVKSQIIRPITPETDDEGKNPKENGPKDSN------------------------------------LPSFQTIFLDTFESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKFQTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLLENRRQSSMARDNESY 599          
BLAST of Cyclic nucleotide gated cation channel vs. Planmine SMEST
Match: SMESG000013398.1 (SMESG000013398.1)

HSP 1 Score: 306.99 bits (785), Expect = 3.922e-95
Identity = 165/476 (34.66%), Postives = 266/476 (55.88%), Query Frame = 2
Query:  530 ESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAAL------RLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAP---------------DQYSA-YIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKES 1882
            +S +  Y  W+    V +++N + +P+R  F I    Y  +W +FDY+ D + I+D L    R  +L  G++  + +    NY+    FK++   I+P +LF LI  +           RLT+++K  FE  D  D      +I R    + +++ +IH+  C ++  S  IG  SD FV+ P                 DQ+S  YIY F+W+  T T++   P P   +E+  M +  L G+ +FA +IG +  +    NA +T+++ K+D    YM+   + + + +++I WF+Y W + ++LDE++++ +LP KLK+++A+  H+ TL  V +FQDCE TLL  LILKLR  +F P D+IC+KG+IG EMYIV  G++ VV   +   VF TLKEGSVFGE+S+L + G   GNRRTA+VKS G+S LF L+K D  + + + P A   L  +  ++L +  +++    K S
Sbjct:   45 DSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIID-LFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYK-LFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVV-ADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNS 517          
BLAST of Cyclic nucleotide gated cation channel vs. Planmine SMEST
Match: SMESG000013398.1 (SMESG000013398.1)

HSP 1 Score: 306.605 bits (784), Expect = 6.835e-95
Identity = 165/476 (34.66%), Postives = 266/476 (55.88%), Query Frame = 2
Query:  530 ESRNRYYLMWLLVSYVAVMYNFLTIPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEINHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAAL------RLTRLFKTFFELFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFVFSPAP---------------DQYSA-YIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFVFAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWFNYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLLSDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFATLKEGSVFGEISLLALSG---GNRRTADVKSKGFSTLFSLSKQDFEEAMADYPAAYELLKTKANKVLNRHKVIENSTKKES 1882
            +S +  Y  W+    V +++N + +P+R  F I    Y  +W +FDY+ D + I+D L    R  +L  G++  + +    NY+    FK++   I+P +LF LI  +           RLT+++K  FE  D  D      +I R    + +++ +IH+  C ++  S  IG  SD FV+ P                 DQ+S  YIY F+W+  T T++   P P   +E+  M +  L G+ +FA +IG +  +    NA +T+++ K+D    YM+   + + + +++I WF+Y W + ++LDE++++ +LP KLK+++A+  H+ TL  V +FQDCE TLL  LILKLR  +F P D+IC+KG+IG EMYIV  G++ VV   +   VF TLKEGSVFGE+S+L + G   GNRRTA+VKS G+S LF L+K D  + + + P A   L  +  ++L +  +++    K S
Sbjct:   52 DSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIID-LFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYK-LFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVV-ADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNS 524          
The following BLAST results are available for this feature:
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNGB17.178e-11437.02cyclic nucleotide gated channel subunit beta 1 [So... [more]
CNGB19.704e-11437.02cyclic nucleotide gated channel subunit beta 1 [So... [more]
CNGB35.003e-11035.49cyclic nucleotide gated channel subunit beta 3 [So... [more]
CNGA22.129e-10638.30cyclic nucleotide gated channel subunit alpha 2 [S... [more]
CNGA32.800e-10536.79cyclic nucleotide gated channel subunit alpha 3 [S... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tax-22.364e-12838.10TAX2 [Source:UniProtKB/TrEMBL;Acc:G5EEE2][more]
tax-41.972e-8133.90Cyclic nucleotide-gated cation channel [Source:Un... [more]
cng-18.451e-5327.75Cyclic Nucleotide Gated channel [Source:UniProtKB... [more]
cng-21.774e-4524.35Cyclic Nucleotide Gated channel [Source:UniProtKB... [more]
che-66.180e-3923.88pep chromosome:WBcel235:IV:2104056:2111408:-1 gene... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CngB1.599e-13947.19gene:FBgn0266346 transcript:FBtr0342961[more]
CngB4.133e-13947.19gene:FBgn0266346 transcript:FBtr0071675[more]
CngA2.163e-9135.36gene:FBgn0261612 transcript:FBtr0302924[more]
CngA1.168e-8935.36gene:FBgn0261612 transcript:FBtr0302925[more]
CG422606.536e-8636.02gene:FBgn0259145 transcript:FBtr0299573[more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cngb1b3.990e-11935.07cyclic nucleotide gated channel subunit beta 1b [S... [more]
cngb1a1.383e-11733.71cyclic nucleotide gated channel subunit beta 1a [S... [more]
cngb1a1.233e-11534.40cyclic nucleotide gated channel subunit beta 1a [S... [more]
cngb1b1.303e-11435.26cyclic nucleotide gated channel subunit beta 1b [S... [more]
cngb3.25.468e-10933.76cyclic nucleotide gated channel subunit beta 3, ta... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nit21.610e-11435.14nitrilase family member 2 [Source:Xenbase;Acc:XB-G... [more]
scap1.189e-10937.71SREBF chaperone [Source:Xenbase;Acc:XB-GENE-996521... [more]
scap5.171e-10537.39SREBF chaperone [Source:Xenbase;Acc:XB-GENE-996521... [more]
nfyb9.146e-10436.80nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb5.479e-10338.86nuclear transcription factor Y subunit beta [Sourc... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cngb12.363e-12338.50cyclic nucleotide gated channel beta 1 [Source:MGI... [more]
Cngb12.363e-12338.50cyclic nucleotide gated channel beta 1 [Source:MGI... [more]
Cngb13.218e-11938.50cyclic nucleotide gated channel beta 1 [Source:MGI... [more]
Cngb32.619e-11233.17cyclic nucleotide gated channel beta 3 [Source:MGI... [more]
Cnga22.327e-10638.30cyclic nucleotide gated channel alpha 2 [Source:MG... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28181|CNGB1_BOVIN4.477e-11638.43Cyclic nucleotide-gated cation channel beta-1 OS=B... [more]
sp|Q14028|CNGB1_HUMAN4.660e-11337.02Cyclic nucleotide-gated cation channel beta-1 OS=H... [more]
sp|Q9JJZ9|CNGB3_MOUSE1.832e-11133.17Cyclic nucleotide-gated cation channel beta-3 OS=M... [more]
sp|Q9NQW8|CNGB3_HUMAN2.402e-10935.49Cyclic nucleotide-gated cation channel beta-3 OS=H... [more]
sp|Q28718|CNGA2_RABIT3.442e-10637.97Cyclic nucleotide-gated olfactory channel OS=Oryct... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RMV41.417e-17349.44Cyclic nucleotide gated cation channel OS=Fasciola... [more]
G4LY669.858e-17247.79Cyclic-nucleotide-gated cation channel,putative OS... [more]
A0A504YBV82.099e-17149.62Cyclic nucleotide gated cation channel OS=Fasciola... [more]
A0A1I8HBV29.208e-17150.19Cyclic nucleotide-binding domain-containing protei... [more]
A0A1I8HRR11.017e-17050.19Cyclic nucleotide-binding domain-containing protei... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cngb1b3.266e-11735.26cyclic nucleotide gated channel subunit beta 1b [S... [more]
cngb1a2.419e-11134.98cyclic nucleotide gated channel subunit beta 1a [S... [more]
cngb3.26.063e-10837.81cyclic nucleotide gated channel subunit beta 3, ta... [more]
cngb3.26.063e-10837.81cyclic nucleotide gated channel subunit beta 3, ta... [more]
cngb3.29.178e-10837.81cyclic nucleotide gated channel subunit beta 3, ta... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cngb1a2.636e-11141.20cyclic nucleotide gated channel subunit beta 1a [S... [more]
ENSPMAT00000005594.11.664e-2220.80pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1... [more]
ENSPMAT00000005922.11.999e-2121.31pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-... [more]
kcnh1b4.702e-1821.67potassium voltage-gated channel, subfamily H (eag-... [more]
ENSPMAT00000001558.14.184e-1523.81pep scaffold:Pmarinus_7.0:GL480650:659:21543:-1 ge... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353936.070e-9536.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346338.406e-8235.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495403.705e-8138.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399181.434e-8033.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353764.037e-7534.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cngb1a1.881e-11635.34cyclic nucleotide gated channel subunit beta 1a [S... [more]
cngb1b1.352e-11334.84cyclic nucleotide-gated cation channel beta-1 [Sou... [more]
ENSORLT00000007489.23.249e-10635.93cyclic nucleotide-gated cation channel beta-3-like... [more]
ENSORLT00000027368.11.057e-10537.78cyclic nucleotide-gated cation channel beta-3-like... [more]
cnga1b2.926e-10338.08cyclic nucleotide-gated channel rod photoreceptor ... [more]
back to top
BLAST of Cyclic nucleotide gated cation channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033757.10.000e+094.95SMESG000033757.1[more]
SMESG000033757.10.000e+093.79SMESG000033757.1[more]
SMESG000033757.10.000e+092.67SMESG000033757.1[more]
SMESG000013398.13.922e-9534.66SMESG000013398.1[more]
SMESG000013398.16.835e-9534.66SMESG000013398.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008477 ID=SMED30008477|Name=Cyclic nucleotide gated cation channel|organism=Schmidtea mediterranea sexual|type=transcript|length=2185bp
AATGATACTTAATATGATTCACTCTAAACATTTCGGTAGTATCCCATATA
AAAACATTGTAAGTGAACCATGCAAAATCTATATTTGTAATTTTATGAGT
ATTCTACAATTGCCATTGATGATCTTAGTTTATAACAATATAACTGAGTT
AATTCATTACTTAGATGCCCAAACAAAACTTAGAAAATTGAAAGACCGAA
AACGGACAACTAAAAATAGTAGAGAATCTTTAATTAATGAAAAAATAAAC
GATCGATTACGTAATATTCACCGGAAATTCTCTGAAAGAATTGAAAGCGT
TAAATCTCAGATTATTCGCCCAATTACTCCAGAAACTGATGATGAAAGCA
AAAATCCAAAAGAAAATGGTCCTAAAGATTCTAATGTGAAAGCAGATGAA
ATTAAAAAACCTCCAGATAATGAAAAGCTGGAATTACCTCCTCAAGAAGA
TGTTACCTCAATTAAAGTTAATAAAAGAATATGTTCATTTAAGTTACCTA
GTTTTGAAACGATATTTCTTCATACATTCGAGTCTCGAAACCGGTATTAC
TTAATGTGGCTACTTGTTAGCTACGTGGCTGTTATGTACAACTTTCTGAC
GATTCCTTTGCGTGAATGTTTTGAAATTTACAACTATCCATATGAAAAGA
TTTGGAATGTCTTTGACTATGTGGCGGATTTCATTTATATTCTTGACATT
CTTCTATTTCAGCATCGTTTGCAGTATCTTAACAATGGCATTATAGAAAT
CAATCATAAAATGTGCGCAATCAATTACGTCAAAGGATCTAAATTCAAAA
TGAATGTTTTGTCCATTATTCCGACAGATTTGTTTGTTTTAATTCTAAAA
AACCACAAAGCAGCACTGAGACTCACCAGACTATTTAAGACATTTTTCGA
ATTATTTGATGTTCTTGATCACGTCGTTAAATCCGGCCACATTGTCAGAT
TCGTGAAAACTATGTCATACATAATTTATTTAATTCATTTTGAGGCCTGT
GGCTACTATTTATTTTCCAAATTCATCGGTTTCAGCAGTGACAGTTTTGT
TTTTTCCCCAGCTCCCGACCAATATTCCGCATATATTTACTGCTTCTATT
GGGCCATGAAAACGGCCACCTCCATTGGGAACAATCCATCACCAACTATC
TATGCTGAATATTGTTTCATGAATGTTTACTGGTTGTCGGGAATTTTTGT
GTTTGCCGTCTTGATAGGACAGATAAGAGATATTTTTGACGCAGCAAATG
CTAATCAAACAAATTACAGGAAAAAAATGGATACCACAATATTGTATATG
AAAAATCTAAATTTATCTGAATCCATGATTAAAAAAGTTATAATGTGGTT
TAATTATAACTGGGAACATCACAAAACATTAGATGAAAATAGTCTAATTG
AGAGTCTTCCAACCAAGTTGAAATCCGACCTTGCTATTCATACGCATTTC
AATACATTGAGCAAAGTATCTCTTTTTCAAGATTGTGAAAGAACATTACT
GTCCGATTTGATTCTGAAACTTCGGCCGGTGCTATTTTTGCCAAATGATT
TCATTTGTAAAAAGGGTGAGATTGGAACAGAAATGTATATAGTTATGACA
GGACAAGTAGAAGTAGTCGGTGGTCCAAATAACAGTATCGTGTTTGCAAC
GTTGAAAGAAGGAAGTGTGTTTGGTGAAATCAGTCTTTTAGCTCTTTCGG
GCGGGAATCGACGGACAGCTGATGTGAAATCAAAAGGATTTTCAACTCTA
TTCAGTTTGTCAAAACAAGACTTTGAAGAAGCTATGGCTGATTACCCAGC
GGCTTATGAATTGTTGAAAACGAAGGCTAACAAAGTCCTCAATCGACACA
AAGTAATTGAAAATTCTACAAAAAAAGAATCTGAGATTGAAATTGTTATT
CCAAATAAAAAAGACACTTCCAATCTTCACGAGACAGTTTTGAAGTTGAT
GGAAAATCGACGACAATCGAGTATGGCAAGAGACAACGAAGTATACTCTT
AATTCATATTTTTACATAATAATTAGTATTAATTTACAGAAAAATGACAT
TAAAAATTTAGAATATTGCGAAAATTCTCATTTTTGCTTACTATAAGAAC
CTGGAATAGGGAATGGGGCTATGAAGGTCATTTCATATGAACCAACGAAT
TCGAGGAGCTTTCAAAATATAGCTAGCAACACTAT
back to top

protein sequence of SMED30008477-orf-1

>SMED30008477-orf-1 ID=SMED30008477-orf-1|Name=SMED30008477-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=667bp
MILNMIHSKHFGSIPYKNIVSEPCKIYICNFMSILQLPLMILVYNNITEL
IHYLDAQTKLRKLKDRKRTTKNSRESLINEKINDRLRNIHRKFSERIESV
KSQIIRPITPETDDESKNPKENGPKDSNVKADEIKKPPDNEKLELPPQED
VTSIKVNKRICSFKLPSFETIFLHTFESRNRYYLMWLLVSYVAVMYNFLT
IPLRECFEIYNYPYEKIWNVFDYVADFIYILDILLFQHRLQYLNNGIIEI
NHKMCAINYVKGSKFKMNVLSIIPTDLFVLILKNHKAALRLTRLFKTFFE
LFDVLDHVVKSGHIVRFVKTMSYIIYLIHFEACGYYLFSKFIGFSSDSFV
FSPAPDQYSAYIYCFYWAMKTATSIGNNPSPTIYAEYCFMNVYWLSGIFV
FAVLIGQIRDIFDAANANQTNYRKKMDTTILYMKNLNLSESMIKKVIMWF
NYNWEHHKTLDENSLIESLPTKLKSDLAIHTHFNTLSKVSLFQDCERTLL
SDLILKLRPVLFLPNDFICKKGEIGTEMYIVMTGQVEVVGGPNNSIVFAT
LKEGSVFGEISLLALSGGNRRTADVKSKGFSTLFSLSKQDFEEAMADYPA
AYELLKTKANKVLNRHKVIENSTKKESEIEIVIPNKKDTSNLHETVLKLM
ENRRQSSMARDNEVYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR005821Ion_trans_dom
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0042391regulation of membrane potential
GO:0071805potassium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
GO:0005249voltage-gated potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 307..425
e-value: 2.0E-24
score: 97.2
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 328..413
e-value: 1.6E-18
score: 66.5
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 307..411
score: 23.872
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 307..416
e-value: 2.27187E-25
score: 98.1669
NoneNo IPR availableGENE3DG3DSA:1.10.287.630coord: 232..298
e-value: 1.5E-16
score: 61.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 3..231
e-value: 3.0E-9
score: 38.7
NoneNo IPR availablePANTHERPTHR45638:SF1CYCLIC NUCLEOTIDE-GATED ION CHANNEL SUBUNIT B, ISOFORM Acoord: 2..472
NoneNo IPR availablePANTHERPTHR45638FAMILY NOT NAMEDcoord: 2..472
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 2..228
NoneNo IPR availableTMHMMTMhelixcoord: 199..221
NoneNo IPR availableTMHMMTMhelixcoord: 139..161
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 300..432
e-value: 7.5E-36
score: 124.6
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 2..233
e-value: 2.5E-16
score: 59.7
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 334..350
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 373..393
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 232..423