Protein kinase domain containing protein

Overview
NameProtein kinase domain containing protein
Smed IDSMED30008475
Length (bp)1035
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain containing protein (SMED30008475) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain containing protein (SMED30008475) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008475

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30008475SMESG000056960.1 SmedASXL_000398SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30008475SMESG000056960.1 dd_Smed_v4_62157_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30008475SMESG000056960.1 dd_Smed_v4_62157_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Match: ULK2 (unc-51 like autophagy activating kinase 2 [Source:HGNC Symbol;Acc:HGNC:13480])

HSP 1 Score: 88.5817 bits (218), Expect = 1.519e-18
Identity = 76/244 (31.15%), Postives = 117/244 (47.95%), Query Frame = 1
Query:  178 DIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFS-------------MKTNVCFDKNTALRHPVIKRNKK--LLNLLSGMLEENPLKRLSVEACISHPWM 864
            ++A+K  + K L+        EIKIL+ +QH + +V L D    PN  VFL M +   GDL  +  A    K   ++  IR  + Q+   +  L S+ IIHRD+K +NI++     +  +   I IK+ DF  A             G+  Y APEV+ ++  D K D+WS+ TV++                  + ++KN +L  P I R     L NLL G+L+ N   R+  EA  SHP++
Sbjct:   35 EVAIKSINKKNLSKSQILLGKEIKILKELQH-ENIVALYDVQELPN-SVFLVMEYCNGGDLADYLQA----KGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSSVSGIRIKIADFGFARYLHSNMMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLM-PSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFL 271          
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Match: ULK2 (unc-51 like autophagy activating kinase 2 [Source:HGNC Symbol;Acc:HGNC:13480])

HSP 1 Score: 88.5817 bits (218), Expect = 1.519e-18
Identity = 76/244 (31.15%), Postives = 117/244 (47.95%), Query Frame = 1
Query:  178 DIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFS-------------MKTNVCFDKNTALRHPVIKRNKK--LLNLLSGMLEENPLKRLSVEACISHPWM 864
            ++A+K  + K L+        EIKIL+ +QH + +V L D    PN  VFL M +   GDL  +  A    K   ++  IR  + Q+   +  L S+ IIHRD+K +NI++     +  +   I IK+ DF  A             G+  Y APEV+ ++  D K D+WS+ TV++                  + ++KN +L  P I R     L NLL G+L+ N   R+  EA  SHP++
Sbjct:   35 EVAIKSINKKNLSKSQILLGKEIKILKELQH-ENIVALYDVQELPN-SVFLVMEYCNGGDLADYLQA----KGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSSVSGIRIKIADFGFARYLHSNMMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLM-PSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFL 271          
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Match: PASK (PAS domain containing serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:17270])

HSP 1 Score: 85.8853 bits (211), Expect = 1.099e-17
Identity = 65/238 (27.31%), Postives = 118/238 (49.58%), Query Frame = 1
Query:  226 GRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGD-LEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP-QDFKVDIWSLATVLFSMKTNVCFDKN---------TALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNM 906
            G+   EI IL  ++H   +++++D F    ++ F Q+     G  L+ F  A   +  +  +     I  QL+  + +L+ ++IIHRD+K ENI++ + +          IKLIDF  A   +         GT +Y APEVL   P +  ++++WSL   L+++     F++N          A  HP    +K+L++L+SG+L+  P +R ++E  ++ PW+T      +  W  +
Sbjct: 1047 GKVTLEIAILSRVEHA-NIIKVLDIF---ENQGFFQLVMEKHGSGLDLF--AFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDF---------TIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTL----VFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEV 1265          
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Match: PASK (PAS domain containing serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:17270])

HSP 1 Score: 85.8853 bits (211), Expect = 1.099e-17
Identity = 65/238 (27.31%), Postives = 118/238 (49.58%), Query Frame = 1
Query:  226 GRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGD-LEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP-QDFKVDIWSLATVLFSMKTNVCFDKN---------TALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNM 906
            G+   EI IL  ++H   +++++D F    ++ F Q+     G  L+ F  A   +  +  +     I  QL+  + +L+ ++IIHRD+K ENI++ + +          IKLIDF  A   +         GT +Y APEVL   P +  ++++WSL   L+++     F++N          A  HP    +K+L++L+SG+L+  P +R ++E  ++ PW+T      +  W  +
Sbjct: 1047 GKVTLEIAILSRVEHA-NIIKVLDIF---ENQGFFQLVMEKHGSGLDLF--AFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDF---------TIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTL----VFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEV 1265          
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Match: PASK (PAS domain containing serine/threonine kinase [Source:HGNC Symbol;Acc:HGNC:17270])

HSP 1 Score: 85.8853 bits (211), Expect = 1.099e-17
Identity = 65/238 (27.31%), Postives = 118/238 (49.58%), Query Frame = 1
Query:  226 GRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGD-LEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP-QDFKVDIWSLATVLFSMKTNVCFDKN---------TALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNM 906
            G+   EI IL  ++H   +++++D F    ++ F Q+     G  L+ F  A   +  +  +     I  QL+  + +L+ ++IIHRD+K ENI++ + +          IKLIDF  A   +         GT +Y APEVL   P +  ++++WSL   L+++     F++N          A  HP    +K+L++L+SG+L+  P +R ++E  ++ PW+T      +  W  +
Sbjct: 1047 GKVTLEIAILSRVEHA-NIIKVLDIF---ENQGFFQLVMEKHGSGLDLF--AFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDF---------TIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTL----VFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEV 1265          
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 77.7962 bits (190), Expect = 6.398e-16
Identity = 60/227 (26.43%), Postives = 110/227 (48.46%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVC-FDKNTALRHPVIKRNKK------------LLNLLSGMLEENPLKRLSVEACISHPWMTNRKGK 882
            EI+I  +++H   +   +  +   +  VF+ + + + G+L  F         K  +    + + QL   L +  S+ +IHRD+K EN+++        +KL  N+KL DF  +V+ D         GT  Y APE+++N+P DF VDIW++  +LF M      F   T  +  +I R K+              +L++ ++++ P +RL +   ++HPW+   K +
Sbjct:   92 EIEIQYHLRHPNILT--LYGYFHDDKRVFVILDYASRGEL--FNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLD-------SKL--NLKLADFGWSVVAD-HSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDK--LIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWIKEMKQR 302          
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 77.7962 bits (190), Expect = 6.398e-16
Identity = 60/227 (26.43%), Postives = 110/227 (48.46%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVC-FDKNTALRHPVIKRNKK------------LLNLLSGMLEENPLKRLSVEACISHPWMTNRKGK 882
            EI+I  +++H   +   +  +   +  VF+ + + + G+L  F         K  +    + + QL   L +  S+ +IHRD+K EN+++        +KL  N+KL DF  +V+ D         GT  Y APE+++N+P DF VDIW++  +LF M      F   T  +  +I R K+              +L++ ++++ P +RL +   ++HPW+   K +
Sbjct:   92 EIEIQYHLRHPNILT--LYGYFHDDKRVFVILDYASRGEL--FNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLD-------SKL--NLKLADFGWSVVAD-HSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDK--LIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWIKEMKQR 302          
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Match: pmk-2 (Mitogen-activated protein kinase pmk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXI4])

HSP 1 Score: 77.411 bits (189), Expect = 1.622e-15
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 1
Query:  160 YNNGHEDIALKKYDSKYLA-LHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYAT----GDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFK-VDIWSLATVL 705
            Y    + +A+KK+   + + +H+ R + E+K+L  +QH   V+E++D F    D   L   ++ +     DL+       MK ++ TD QI+ ++ Q+L+ L ++ S  IIHRD+K  NI V +            +K++DF  A   D +      V T  Y+APE++ N     + VD+WS+  +L
Sbjct:   68 YEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQH-DNVLEMIDVFTPDPDASSLNNVYFVSVLMGSDLQNI-----MKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSNIAVNER---------CEVKILDFGLARAQDAEM--TGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCIL 238          
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Match: pmk-2 (Mitogen-activated protein kinase pmk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXI4])

HSP 1 Score: 77.0258 bits (188), Expect = 1.822e-15
Identity = 55/188 (29.26%), Postives = 96/188 (51.06%), Query Frame = 1
Query:  160 YNNGHEDIALKKYDSKYLA-LHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYAT----GDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFK-VDIWSLATVL 705
            Y    + +A+KK+   + + +H+ R + E+K+L  +QH   V+E++D F    D   L   ++ +     DL+       MK ++ TD QI+ ++ Q+L+ L ++ S  IIHRD+K  NI V +            +K++DF  A   D +      V T  Y+APE++ N     + VD+WS+  +L
Sbjct:   68 YEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQH-DNVLEMIDVFTPDPDASSLNNVYFVSVLMGSDLQNI-----MKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSNIAVNER---------CEVKILDFGLARAQDAEM--TGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCIL 238          
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Match: R06A10.4 (pep chromosome:WBcel235:I:1089666:1095796:-1 gene:WBGene00019911.1 transcript:R06A10.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R06A10.4)

HSP 1 Score: 76.6406 bits (187), Expect = 2.427e-15
Identity = 70/276 (25.36%), Postives = 124/276 (44.93%), Query Frame = 1
Query:  118 FTFRYTIEDEKVSVYNNGHEDIALK---KYDSKYLALH--SGRCFA---EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAV-IYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVC-FDKNTALR------------HPVIKRNKKLL-NLLSGMLEENPLKRLSVEACISHPWMTNRK 876
            F  R   + E ++V   G     L+   +   KY A+   +G C A   E+ IL  + H   V+ L + F + + ++F+ M   + G++     A    K ++++ + R  +  LL  L +L S  + HRD+K EN++  D   + + +L I     DF  A     P     +  GT +Y APE+L   P   KVD+W++  + + + + +  FD +   R            +P      +L    +  +LE N ++RLS  A + H W+T  +
Sbjct:   63 FDSRLVCKYEVLAVVGKGSFSQVLRVQHRVTRKYFAVKVVNGDCGAVNNELNILSRLSH-PFVIRLEEVFKS-SSKLFIVMQMASGGEMYDRVVA----KGRYSEEEARNALKMLLTGLTYLHSIRVTHRDLKPENLLYADS--RPEARLLIT----DFGLAYQATKPNETMTETCGTPEYIAPELLLRVPYTQKVDMWAVGVIAYILMSGIMPFDDDCRSRLYTHIITANYVYYPQFWSGSELAKQFVDSLLETNSVERLSSSAAMKHEWLTGER 326          
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Match: bt (gene:FBgn0005666 transcript:FBtr0344988)

HSP 1 Score: 85.1149 bits (209), Expect = 1.316e-17
Identity = 64/226 (28.32%), Postives = 110/226 (48.67%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDL-EKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWS---LATVLFSMKTNVCFDKNTALRHPVIKRN------------KKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            EI I+  + H K ++ L D+F   +DE+ L + F + G+L E+ TA   +     T++++   M Q+ + +  +  QNIIH D+K ENI+ +       T+   N+KLIDF  A   DP    +   GT ++ APE++  +P  F  D+W+   L+ VL S  +    D +      V   +            ++  + +  +L  N  KR++   C+ HPW+T 
Sbjct: 7703 EIDIMNQLHHQK-LINLHDAFED-DDEMILILEFLSGGELFERITAEGYV----MTEAEVINYMRQICEGIRHMHEQNIIHLDIKPENIMCQ-------TRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTLKNVKACDWDFDVESFKYISEEAKDFIRKLLVRNKEKRMTAHECLLHPWLTG 7915          
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Match: bt (gene:FBgn0005666 transcript:FBtr0334482)

HSP 1 Score: 85.1149 bits (209), Expect = 1.327e-17
Identity = 64/226 (28.32%), Postives = 110/226 (48.67%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDL-EKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWS---LATVLFSMKTNVCFDKNTALRHPVIKRN------------KKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            EI I+  + H K ++ L D+F   +DE+ L + F + G+L E+ TA   +     T++++   M Q+ + +  +  QNIIH D+K ENI+ +       T+   N+KLIDF  A   DP    +   GT ++ APE++  +P  F  D+W+   L+ VL S  +    D +      V   +            ++  + +  +L  N  KR++   C+ HPW+T 
Sbjct: 7528 EIDIMNQLHHQK-LINLHDAFED-DDEMILILEFLSGGELFERITAEGYV----MTEAEVINYMRQICEGIRHMHEQNIIHLDIKPENIMCQ-------TRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTLKNVKACDWDFDVESFKYISEEAKDFIRKLLVRNKEKRMTAHECLLHPWLTG 7740          
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Match: bt (gene:FBgn0005666 transcript:FBtr0334483)

HSP 1 Score: 85.1149 bits (209), Expect = 1.341e-17
Identity = 64/226 (28.32%), Postives = 110/226 (48.67%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDL-EKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWS---LATVLFSMKTNVCFDKNTALRHPVIKRN------------KKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            EI I+  + H K ++ L D+F   +DE+ L + F + G+L E+ TA   +     T++++   M Q+ + +  +  QNIIH D+K ENI+ +       T+   N+KLIDF  A   DP    +   GT ++ APE++  +P  F  D+W+   L+ VL S  +    D +      V   +            ++  + +  +L  N  KR++   C+ HPW+T 
Sbjct: 7967 EIDIMNQLHHQK-LINLHDAFED-DDEMILILEFLSGGELFERITAEGYV----MTEAEVINYMRQICEGIRHMHEQNIIHLDIKPENIMCQ-------TRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTLKNVKACDWDFDVESFKYISEEAKDFIRKLLVRNKEKRMTAHECLLHPWLTG 8179          
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Match: bt (gene:FBgn0005666 transcript:FBtr0089793)

HSP 1 Score: 85.1149 bits (209), Expect = 1.443e-17
Identity = 64/226 (28.32%), Postives = 110/226 (48.67%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDL-EKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWS---LATVLFSMKTNVCFDKNTALRHPVIKRN------------KKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            EI I+  + H K ++ L D+F   +DE+ L + F + G+L E+ TA   +     T++++   M Q+ + +  +  QNIIH D+K ENI+ +       T+   N+KLIDF  A   DP    +   GT ++ APE++  +P  F  D+W+   L+ VL S  +    D +      V   +            ++  + +  +L  N  KR++   C+ HPW+T 
Sbjct: 7749 EIDIMNQLHHQK-LINLHDAFED-DDEMILILEFLSGGELFERITAEGYV----MTEAEVINYMRQICEGIRHMHEQNIIHLDIKPENIMCQ-------TRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTLKNVKACDWDFDVESFKYISEEAKDFIRKLLVRNKEKRMTAHECLLHPWLTG 7961          
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Match: bt (gene:FBgn0005666 transcript:FBtr0301340)

HSP 1 Score: 84.7297 bits (208), Expect = 1.554e-17
Identity = 64/226 (28.32%), Postives = 110/226 (48.67%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDL-EKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWS---LATVLFSMKTNVCFDKNTALRHPVIKRN------------KKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            EI I+  + H K ++ L D+F   +DE+ L + F + G+L E+ TA   +     T++++   M Q+ + +  +  QNIIH D+K ENI+ +       T+   N+KLIDF  A   DP    +   GT ++ APE++  +P  F  D+W+   L+ VL S  +    D +      V   +            ++  + +  +L  N  KR++   C+ HPW+T 
Sbjct: 8034 EIDIMNQLHHQK-LINLHDAFED-DDEMILILEFLSGGELFERITAEGYV----MTEAEVINYMRQICEGIRHMHEQNIIHLDIKPENIMCQ-------TRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTLKNVKACDWDFDVESFKYISEEAKDFIRKLLVRNKEKRMTAHECLLHPWLTG 8246          
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Match: stk17a (serine/threonine kinase 17a [Source:ZFIN;Acc:ZDB-GENE-030131-5556])

HSP 1 Score: 86.2705 bits (212), Expect = 1.883e-18
Identity = 61/230 (26.52%), Postives = 116/230 (50.43%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVC----FDKNTA---LRHPVIKRNKKLLNLLSG--------MLEENPLKRLSVEACISHPWMTNRKGKL 885
            EI +LE    C  VV L + +  P+ E+ L + + A G++  F   +  +   FT+ +++++M Q+L+ + FL + N++H D+K +NI++      S++ L  +IK++DF  + +       ++ +GT +Y APEVL  +P     D+WS+  +++ M T +      DK      +    I  +++ L  L G        +L + P  R + E C+ H W+   +  L
Sbjct:   92 EIAVLELAAACPRVVNLHEVYEMPS-EMVLVLEYAAGGEI--FNQCVADRDEAFTEQEVKRLMKQILEGVSFLHNNNVVHLDLKPQNILLT-----SESPLG-DIKIVDFGLSRLLSNSHEVREIMGTPEYVAPEVLNYEPISTATDMWSIGVLVYVMLTGISPFLGDDKQETFLNISQINISYSEEELEQLDGSAIRFIKSLLIKEPENRATAEDCLKHQWLQTEEQDL 312          
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Match: ulk1a (unc-51 like autophagy activating kinase 1a [Source:ZFIN;Acc:ZDB-GENE-080723-31])

HSP 1 Score: 80.1073 bits (196), Expect = 1.010e-16
Identity = 56/182 (30.77%), Postives = 92/182 (50.55%), Query Frame = 1
Query:  178 DIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTN 723
            ++A+K  + K LA        EIKIL+ ++H + +V L+D F   +  V+L M +   GDL ++  +    K   ++  IR ++ QL   +  L+S+ IIHRD+K +NI++     +      I IKL DF  A             G+  Y APEV+ +   D K D+WS+ T+++   T 
Sbjct:   35 EVAVKCINRKNLAKSQSLLGKEIKILKELKH-ENIVSLLD-FQEISGCVYLVMEYCNGGDLAEYLHS----KGCLSEDTIRVLLQQLAGAMSVLRSKGIIHRDLKPQNILLSYSTGRKSNPNNICIKLADFGFARYLQGNTMAATLCGSPMYMAPEVIMSHNYDAKADLWSVGTIIYQCLTG 210          
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Match: ulk2 (unc-51 like autophagy activating kinase 2 [Source:ZFIN;Acc:ZDB-GENE-090218-30])

HSP 1 Score: 82.4185 bits (202), Expect = 1.068e-16
Identity = 57/177 (32.20%), Postives = 89/177 (50.28%), Query Frame = 1
Query:  178 DIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLF 708
            ++A+K  + K L+        EIKIL+ +QH + +V L D   TP+  VFL M +   GDL  +  A    K    +  +R  + Q+   +  L S+ IIHRD+K +NI++     K  +   I IK+ DF  A             G+  Y APEV+ ++  D K D+WS+ TV++
Sbjct:   35 EVAIKSINKKNLSKSQILLGKEIKILKELQH-ENIVALYDVQETPS-SVFLVMEYCNGGDLADYLQA----KGTLREDTLRVFLQQIAAAMRILNSKGIIHRDLKPQNILLSYTGRKKSSINGIRIKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQNYDAKADLWSIGTVIY 205          
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Match: si:dkey-201l21.2 (si:dkey-201l21.2 [Source:ZFIN;Acc:ZDB-GENE-060531-97])

HSP 1 Score: 78.1814 bits (191), Expect = 3.661e-16
Identity = 71/253 (28.06%), Postives = 120/253 (47.43%), Query Frame = 1
Query:  148 KVSVYNNGHEDIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYD-PQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSM------------KTNVCFDKNTALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMT 867
            KV +  N  ED+ + K  +   A +  +   E++IL+ ++H   +V  V+SF       ++ M + A GDL       K+K   F + QI   ++Q+   L ++  +N++HRD+K +NI + +  Y       INI   DF C+ + D      Q  VGT+ Y +PE   NK  + K DIW+L  +L  +            + N     N  + H   + +K+L  L+S ML  +P  R S    ++ P++T
Sbjct:   22 KVFLVKNKDEDLCIIKEINCRDATNLEKVQKEVEILKTLKH-GYIVTYVESFEDKAGFFYIVMEYCAGGDLGNRMNIQKVKSF-FEEEQILDWLVQICLALQYIHEKNVLHRDLKPQNIFLTEEGY-------INIG--DFGCSKVLDRADAYAQSAVGTDLYFSPEGYENK-YNSKSDIWALGWLLHDLCMLDIWADIKKRRFNHALSINGTIPHISERYSKELRKLISQMLSCDPKDRPSAAEILTRPFLT 262          
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Match: camk1ga (calcium/calmodulin-dependent protein kinase IGa [Source:ZFIN;Acc:ZDB-GENE-030131-7594])

HSP 1 Score: 79.337 bits (194), Expect = 6.850e-16
Identity = 68/245 (27.76%), Postives = 114/245 (46.53%), Query Frame = 1
Query:  217 LHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVC--FDKN-TALRHPVIKR------------NKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNM 906
            LH      EI++L+ I+H   VV L D F       +L M   + G+L  F   L   +  +T+    +++ Q+L+ + +L   +I+HRD+K EN++    YY       I I   DF  + + D         GT  Y APEVL  KP    VD WS+  + + + +     +++N T L   ++K             ++   + +  MLE+NP KR + E  +SHPW+       ++I H++
Sbjct:   57 LHHSNLENEIQVLKRIKH-SNVVGLED-FYESRTHYYLVMELVSGGEL--FDRILD--RGVYTEKDASRVINQVLEAVSYLHQNSIVHRDLKPENLL----YYSPDENAKIMIS--DFGLSKMSDHGVM-STACGTPGYVAPEVLAQKPYSKAVDCWSIGVITYILLSGYPPFYEENETRLFSKIMKAEYAFHSPYWDDISESAKDFIRHMLEKNPSKRYTTEQALSHPWIIGDTAHNDNIIHSV 288          
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Match: ENSXETT00000029423.1 (serine/threonine-protein kinase 17A-like [Source:NCBI gene;Acc:101732252])

HSP 1 Score: 87.4261 bits (215), Expect = 8.118e-19
Identity = 61/232 (26.29%), Postives = 112/232 (48.28%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVC-FDKNT---------------------ALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            EI ILE  +    VV+L + + T N E+ L M + A G++  F   +  +   FT+  + +++ Q+LQ +L L   N++H D+K +NI++      + +    +I+++DF  +   D     ++ +GT +Y APEVL+ +P     D+WS+  + + M T V  F  +T                      +  P I       + +  +L +NP KR+  + C+ HPW+ +
Sbjct:   71 EIAILEMARLSPYVVDLHEVYET-NSEIVLVMEYAAGGEI--FEQCVADQDEAFTEKDVVRLISQILQGVLHLHRSNVVHLDLKPQNILL------TSSSPLGDIRIVDFGLSRQVDAIKEIREILGTPEYVAPEVLSYEPISTATDMWSVGVLTYVMLTGVSPFLGDTKQETFLNISQVNIQYSQEDFQGISEPAI-------DFIKSLLVKNPRKRIRADQCLKHPWLNS 286          
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Match: ULK2 (unc-51 like autophagy activating kinase 2 [Source:NCBI gene;Acc:100487396])

HSP 1 Score: 88.1965 bits (217), Expect = 1.752e-18
Identity = 60/177 (33.90%), Postives = 89/177 (50.28%), Query Frame = 1
Query:  178 DIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLF 708
            ++A+K  + K L+        EIKIL+ +QH + +V L D    PN  VFL M F   GDL  +  A    K   ++  IR  + Q+   +  L S+ IIHRD+K +NI++     K  T   I IK+ DF  A             G+  Y APEV+ ++  D K D+WS+ TV++
Sbjct:   35 EVAIKSINKKNLSKSQILLGKEIKILKELQH-ENIVALYDVQEMPN-SVFLVMEFCNGGDLADYLQA----KGTLSEDTIRIFLQQIAAAMRVLHSKGIIHRDLKPQNILLSYASRKKATFSGIRIKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIY 205          
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Match: PASK (PAS domain containing serine/threonine kinase [Source:NCBI gene;Acc:100488299])

HSP 1 Score: 83.5741 bits (205), Expect = 5.559e-17
Identity = 70/245 (28.57%), Postives = 113/245 (46.12%), Query Frame = 1
Query:  226 GRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGD-LEKFTAALKMKKRKFTDSQ-------IRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDF-KVDIWSLATVLFSMKTNVCFDKN---------TALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNM 906
            G+   EI IL  +QH   ++ +VD F    ++ F Q+     GD L+ F          F DSQ          I  QL+  + +L +Q+I+HRD+K ENII+   +         +IKL+DF  A             GT +Y APEVL   P    ++++WSL   L+++     F +N          A  +P    ++KL  L+SG+L+ +P  R++++  +  PW+T      E  W  +
Sbjct:  938 GKVTQEIAILSRVQH-PNIIRVVDVF---ENDTFFQLVMELHGDGLDLF---------DFIDSQPSLDEPLASYIFRQLVSAVGYLHNQHILHRDIKDENIIIAPDF---------SIKLVDFGSAAHLHQGTLFSTFCGTTEYCAPEVLLGNPYPGPELEMWSLGVTLYTL----IFGENPFCEVDEILEAELNPPFNVSQKLQVLISGLLQRDPEIRMTLDELLRDPWVTQPINLAEYTWEEV 1156          
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Match: xpo5 (exportin 5 [Source:Xenbase;Acc:XB-GENE-5947328])

HSP 1 Score: 82.0333 bits (201), Expect = 6.379e-17
Identity = 61/233 (26.18%), Postives = 111/233 (47.64%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVL------TNKPQDFKVDIWSLATVLFSMKTN--------------VCFDKNTALRHPVIK-RNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRK 876
            E++IL ++ +  +++ L+DS+ + +  +FL       G+L  +      +K   ++ + R IM  LL+ + +L S NI+HRD+K ENI++ D          +NIKL DF  + I  P    ++  GT  Y APE+L      T+     +VD+W+   ++F++                 +  D       P    R+  + +L+  +LE  P KRL+ E  + HP+  + +
Sbjct:   42 EMEILHHVSNHPSIISLIDSYES-STFIFLVFDLMKRGELFDYLT----EKVTLSEKETRCIMRSLLEAVTYLHSNNIVHRDLKPENILMDDC---------LNIKLSDFGFSCILKPTEKLRELCGTPGYLAPEILKCSMDETHPGYGREVDLWACGVIMFTLLAGSPPFWHRKQMLMLRMIMDGRFQFGSPEWDDRSSTVKDLICRLLEVCPEKRLTAEQALQHPFFQSHQ 260          
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Match: xpo5 (exportin 5 [Source:Xenbase;Acc:XB-GENE-5947328])

HSP 1 Score: 82.0333 bits (201), Expect = 6.673e-17
Identity = 61/233 (26.18%), Postives = 111/233 (47.64%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVL------TNKPQDFKVDIWSLATVLFSMKTN--------------VCFDKNTALRHPVIK-RNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRK 876
            E++IL ++ +  +++ L+DS+ + +  +FL       G+L  +      +K   ++ + R IM  LL+ + +L S NI+HRD+K ENI++ D          +NIKL DF  + I  P    ++  GT  Y APE+L      T+     +VD+W+   ++F++                 +  D       P    R+  + +L+  +LE  P KRL+ E  + HP+  + +
Sbjct:   37 EMEILHHVSNHPSIISLIDSYES-STFIFLVFDLMKRGELFDYLT----EKVTLSEKETRCIMRSLLEAVTYLHSNNIVHRDLKPENILMDDC---------LNIKLSDFGFSCILKPTEKLRELCGTPGYLAPEILKCSMDETHPGYGREVDLWACGVIMFTLLAGSPPFWHRKQMLMLRMIMDGRFQFGSPEWDDRSSTVKDLICRLLEVCPEKRLTAEQALQHPFFQSHQ 255          
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Match: Pask (PAS domain containing serine/threonine kinase [Source:MGI Symbol;Acc:MGI:2155936])

HSP 1 Score: 88.5817 bits (218), Expect = 1.198e-18
Identity = 72/223 (32.29%), Postives = 114/223 (51.12%), Query Frame = 1
Query:  226 GRCFAEIKILENIQHCKTVVELVDSFITPNDEVF-LQMPFYATG-DLEKFTAALKMKKRKFTDSQIRQ-IMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP-QDFKVDIWSLATVLFSM---KTNVCFDKNT--ALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMT 867
            GR   EI IL  + H   +++++D F   N E F L M  + +G DL  F     +      D  +   I  QL+  + +L SQ IIHRD+K ENI++ + +          IKLIDF  A   +         GT +Y APEVL   P +  ++++WSL   L+++   +   C  + T  A+ HP    +++L++LLSG+L+  P +R ++E  I  PW+T
Sbjct: 1107 GRVTLEIAILSKVDHA-NIIKVLDIF--ENQEFFQLVMEKHGSGMDLFAF-----IDHHPCLDEPLASFIFRQLVSAVGYLHSQGIIHRDIKDENIVIAEDF---------TIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLIGNPYRGPELEMWSLGVTLYTLIFEENPFCEVEETMEAVIHPPFLVSQELMSLLSGLLQPCPEQRTTLEKLIRDPWVT 1312          
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Match: Ulk2 (unc-51 like kinase 2 [Source:MGI Symbol;Acc:MGI:1352758])

HSP 1 Score: 86.6557 bits (213), Expect = 4.270e-18
Identity = 76/244 (31.15%), Postives = 116/244 (47.54%), Query Frame = 1
Query:  178 DIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFS-------------MKTNVCFDKNTALRHPVIKRNKK--LLNLLSGMLEENPLKRLSVEACISHPWM 864
            ++A+K  + K L+        EIKIL+ +QH + +V L D    PN  VFL M +   GDL  +  A    K   ++  IR  + Q+   +  L S+ IIHRD+K +NI++     +      I IK+ DF  A             G+  Y APEV+ ++  D K D+WS+ TV++                  + ++KN +L  P I R     L NLL G+L+ N   R+  EA  SHP++
Sbjct:   35 EVAIKSINKKNLSKSQILLGKEIKILKELQH-ENIVALYDVQELPN-SVFLVMEYCNGGDLADYLQA----KGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLM-PSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFL 271          
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Match: Plk4 (polo like kinase 4 [Source:MGI Symbol;Acc:MGI:101783])

HSP 1 Score: 85.5001 bits (210), Expect = 9.155e-18
Identity = 68/244 (27.87%), Postives = 120/244 (49.18%), Query Frame = 1
Query:  178 DIALKKYDSK--YLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYD-PQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTN-VCFDKNT---ALRHPVIKR-------NKKLLNLLSGMLEENPLKRLSVEACISHPWMT 867
            ++A+K  D K  Y A    R   E+KI   ++H  +V+EL + F   N+ V+L +     G++ ++   LK + + F++ + R  M Q++  +L+L S  I+HRD+ L NI++            +NIK+ DF  A   + P        GT  Y +PE+ T      + DIWSL  + +++      FD +T    L   V+         +++  +L+  +L  NP  RLS+ + + HP+M+
Sbjct:   37 EVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKH-PSVLELYNYF-EDNNYVYLVLEMCHNGEMNRY---LKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTR---------NMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMS 266          
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Match: Plk4 (polo like kinase 4 [Source:MGI Symbol;Acc:MGI:101783])

HSP 1 Score: 85.5001 bits (210), Expect = 9.155e-18
Identity = 68/244 (27.87%), Postives = 120/244 (49.18%), Query Frame = 1
Query:  178 DIALKKYDSK--YLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYD-PQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTN-VCFDKNT---ALRHPVIKR-------NKKLLNLLSGMLEENPLKRLSVEACISHPWMT 867
            ++A+K  D K  Y A    R   E+KI   ++H  +V+EL + F   N+ V+L +     G++ ++   LK + + F++ + R  M Q++  +L+L S  I+HRD+ L NI++            +NIK+ DF  A   + P        GT  Y +PE+ T      + DIWSL  + +++      FD +T    L   V+         +++  +L+  +L  NP  RLS+ + + HP+M+
Sbjct:   37 EVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKH-PSVLELYNYF-EDNNYVYLVLEMCHNGEMNRY---LKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTR---------NMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMS 266          
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Match: Plk4 (polo like kinase 4 [Source:MGI Symbol;Acc:MGI:101783])

HSP 1 Score: 85.5001 bits (210), Expect = 9.753e-18
Identity = 68/244 (27.87%), Postives = 120/244 (49.18%), Query Frame = 1
Query:  178 DIALKKYDSK--YLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYD-PQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTN-VCFDKNT---ALRHPVIKR-------NKKLLNLLSGMLEENPLKRLSVEACISHPWMT 867
            ++A+K  D K  Y A    R   E+KI   ++H  +V+EL + F   N+ V+L +     G++ ++   LK + + F++ + R  M Q++  +L+L S  I+HRD+ L NI++            +NIK+ DF  A   + P        GT  Y +PE+ T      + DIWSL  + +++      FD +T    L   V+         +++  +L+  +L  NP  RLS+ + + HP+M+
Sbjct:   37 EVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKH-PSVLELYNYF-EDNNYVYLVLEMCHNGEMNRY---LKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTR---------NMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMS 266          
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Match: sp|Q10292|MEK1_SCHPO (Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mek1 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.011e-18
Identity = 59/177 (33.33%), Postives = 88/177 (49.72%), Query Frame = 1
Query:  424 IMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEV--LTNKPQDFK---------VDIWSLATVLFSMKT-------NVCFDKNTALRHPVIKR-NKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIW 897
            IM Q+LQ L +L  QNIIHRD+KLENI++      S +     I L DF  A            VGT +Y APE+  L  + Q  K         VD+WSL  ++F + +       +   +K    R PV K  +++  +L+S +L+ NP  R +V+ C+SHPW      +L  ++
Sbjct:  261 IMFQILQGLKYLHEQNIIHRDLKLENILI-----ASSSDTIFRIILTDFGVARCMQKGKRLSTFVGTPEYTAPEIQRLKGRSQVEKENSSGYGKEVDLWSLGVIMFLLLSGNSPSFADGVKEKQVDFRDPVWKSVSRQAKDLISNLLKTNPPDRFTVKQCLSHPWFARHSSRLTKLY 432          
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Match: sp|Q8IYT8|ULK2_HUMAN (Serine/threonine-protein kinase ULK2 OS=Homo sapiens OX=9606 GN=ULK2 PE=1 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 7.296e-18
Identity = 76/244 (31.15%), Postives = 117/244 (47.95%), Query Frame = 1
Query:  178 DIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFS-------------MKTNVCFDKNTALRHPVIKRNKK--LLNLLSGMLEENPLKRLSVEACISHPWM 864
            ++A+K  + K L+        EIKIL+ +QH + +V L D    PN  VFL M +   GDL  +  A    K   ++  IR  + Q+   +  L S+ IIHRD+K +NI++     +  +   I IK+ DF  A             G+  Y APEV+ ++  D K D+WS+ TV++                  + ++KN +L  P I R     L NLL G+L+ N   R+  EA  SHP++
Sbjct:   35 EVAIKSINKKNLSKSQILLGKEIKILKELQH-ENIVALYDVQELPN-SVFLVMEYCNGGDLADYLQA----KGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSSVSGIRIKIADFGFARYLHSNMMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLM-PSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFL 271          
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Match: sp|Q8CEE6|PASK_MOUSE (PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3)

HSP 1 Score: 88.5817 bits (218), Expect = 8.382e-18
Identity = 72/223 (32.29%), Postives = 114/223 (51.12%), Query Frame = 1
Query:  226 GRCFAEIKILENIQHCKTVVELVDSFITPNDEVF-LQMPFYATG-DLEKFTAALKMKKRKFTDSQIRQ-IMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP-QDFKVDIWSLATVLFSM---KTNVCFDKNT--ALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMT 867
            GR   EI IL  + H   +++++D F   N E F L M  + +G DL  F     +      D  +   I  QL+  + +L SQ IIHRD+K ENI++ + +          IKLIDF  A   +         GT +Y APEVL   P +  ++++WSL   L+++   +   C  + T  A+ HP    +++L++LLSG+L+  P +R ++E  I  PW+T
Sbjct: 1107 GRVTLEIAILSKVDHA-NIIKVLDIF--ENQEFFQLVMEKHGSGMDLFAF-----IDHHPCLDEPLASFIFRQLVSAVGYLHSQGIIHRDIKDENIVIAEDF---------TIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLIGNPYRGPELEMWSLGVTLYTLIFEENPFCEVEETMEAVIHPPFLVSQELMSLLSGLLQPCPEQRTTLEKLIRDPWVT 1312          
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Match: sp|B2GUY1|PLK4_RAT (Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus OX=10116 GN=Plk4 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.671e-17
Identity = 69/244 (28.28%), Postives = 121/244 (49.59%), Query Frame = 1
Query:  178 DIALKKYDSK--YLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAV-IYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTN-VCFDKNT---ALRHPVIKR-------NKKLLNLLSGMLEENPLKRLSVEACISHPWMT 867
            ++A+K  D K  Y A    R   E+KI   ++H  +V+EL + F   N+ V+L +     G++ ++   LK + + F++S+ R  M Q++  +L+L S  I+HRD+ L NI++            +NIK+ DF  A  +  P        GT  Y +PE+ T      + DIWSL  + +++      FD +T    L   V+         +++  +L+  +L  NP  RLS+ + + HP+M+
Sbjct:   37 EVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKH-PSVLELYNYF-EDNNYVYLVLEMCHNGEMNRY---LKNRMKPFSESEARHFMHQIITGMLYLHSHGILHRDLTLSNILLTR---------NMNIKIADFGLATQLKMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMS 266          
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Match: sp|Q9QY01|ULK2_MOUSE (Serine/threonine-protein kinase ULK2 OS=Mus musculus OX=10090 GN=Ulk2 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.987e-17
Identity = 76/244 (31.15%), Postives = 116/244 (47.54%), Query Frame = 1
Query:  178 DIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFS-------------MKTNVCFDKNTALRHPVIKRNKK--LLNLLSGMLEENPLKRLSVEACISHPWM 864
            ++A+K  + K L+        EIKIL+ +QH + +V L D    PN  VFL M +   GDL  +  A    K   ++  IR  + Q+   +  L S+ IIHRD+K +NI++     +      I IK+ DF  A             G+  Y APEV+ ++  D K D+WS+ TV++                  + ++KN +L  P I R     L NLL G+L+ N   R+  EA  SHP++
Sbjct:   35 EVAIKSINKKNLSKSQILLGKEIKILKELQH-ENIVALYDVQELPN-SVFLVMEYCNGGDLADYLQA----KGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMFYEKNRSLM-PSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFL 271          
BLAST of Protein kinase domain containing protein vs. TrEMBL
Match: A0A077ZT51 (Myosin light chain kinase OS=Stylonychia lemnae OX=5949 GN=Contig4672.g4987 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 3.835e-20
Identity = 75/237 (31.65%), Postives = 125/237 (52.74%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVC-FD----KNTALR---------HPVIKR-NKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNM 906
            EI++L+  QH   ++ L+D F  P D +++ +   + GDL ++   L  +  K T+ + RQI+ QL  +L +L S  I HRD+KLENI++ +    S       +KL+DF  + +  P     D  GT  Y APEVL  +P    VD+WSL  + + + + +  FD    K TA +         H V K  + +  +L+  +LE++  KR+S+E  ++HPW+  R   ++ I  N+
Sbjct:  607 EIEVLKICQH-PNIIRLIDVFENP-DYIYIVLEHCSGGDLFQY---LDKRDFKITEDRARQIVHQLAASLYYLHSYGIAHRDLKLENILMVNQSDDSP------LKLVDFGLSKMIGPSETSTDPFGTLSYVAPEVLIQRPYGKNVDLWSLGVIQYVLLSGMLPFDSEDNKETARQTIYDPVPFDHQVWKYVSDESKDLILRLLEKDRFKRISLEEVLAHPWICKRSKDIQEIRMNV 832          
BLAST of Protein kinase domain containing protein vs. TrEMBL
Match: A0A1J4JCP5 (CAMK family protein kinase OS=Tritrichomonas foetus OX=1144522 GN=TRFO_02096 PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 6.072e-20
Identity = 71/227 (31.28%), Postives = 116/227 (51.10%), Query Frame = 1
Query:  226 GRCFAEIKILENIQHCKTVVEL--VDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAV-IYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSM-KTNVCFDKNTAL--------RHPVIKRN--KKLLNLLSGMLEENPLKRLSVEACISHPWM 864
            G    EI+I   I+H K V E+  V + +    ++++ M +   G L  +      ++ K ++++ ++  +QL+  + ++ S NI+HRD+K ENI++             NIK++DF  +  I +P        G+ QY APEVL + P    +DIWSL  VL++M    + F+ N  L          P   RN    LL +L GML++NP  R+S+   ISHPW+
Sbjct:   47 GLIEREIEISSTIKH-KYVAEIYSVINEVETRKKLYIVMEYVENGTLLNYVN----ERTKLSEAEAKKFFIQLVDFINYIHSYNIVHRDLKCENIMLDRNN---------NIKIVDFGLSRKIEEPSSYMATFCGSAQYAAPEVLMHLPYTHSIDIWSLGVVLYAMVHGRLPFESNNQLALINQIIKSEPSYDRNLSGALLGILQGMLDKNPESRMSIREIISHPWI 259          
BLAST of Protein kinase domain containing protein vs. TrEMBL
Match: A0A481ZAI4 (Putative serine/threonine protein kinase OS=Pithovirus LCPAC302 OX=2506593 GN=LCPAC302_02710 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 7.035e-20
Identity = 72/231 (31.17%), Postives = 116/231 (50.22%), Query Frame = 1
Query:  223 SGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFE-CAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTN-VCFDKNTALRHPVIKR--NKKL-----------LNLLSGMLEENPLKRLSVEACISHPWMTN 870
            S R   EI+IL +++H K ++ L   F    D ++L +P+ +  DL KF     +  ++     I +IM Q++  + +  S  IIHRD+KL+NI++            +NIKL DF  CAV  +      D VGT +Y APE+L     D  +D+W +  VLF + T    FD +   R  + +R  NKK+           +NLL  +L +NP  R+ ++  + H W+ +
Sbjct:   63 SDRTRQEIEILSDLKH-KRIIRLRGWF-EDEDNIYLVLPYLSGKDLSKFFKKSPLPSKE----NIIKIMKQIIDAVQYCHSNGIIHRDIKLDNILIN---------RHMNIKLTDFGLCAVRENNYEYFYDEVGTARYTAPELLYGDGYDEGIDLWGIGIVLFLLLTGKYPFDGSK--RKSIFRRIKNKKIDFDRYNLSTMEINLLKRLLCKNPRYRMKLDDILDHAWLND 276          
BLAST of Protein kinase domain containing protein vs. TrEMBL
Match: A0A077ZTR1 (Protein kinase domain containing protein OS=Stylonychia lemnae OX=5949 GN=Contig15660.g16684 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.060e-19
Identity = 73/242 (30.17%), Postives = 121/242 (50.00%), Query Frame = 1
Query:  181 IALKKYDSKYLALHSGR--CFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP-QDFKVDIWSLATVLFSM-KTNVCFDKN--TALRHPVIK--------RNKKLLNLLSGMLEENPLKRLSVEACISHPWM 864
            +ALK  + ++L+  + +     E  IL   +H  ++V L +SF T    VF+ M    +GDL  +      ++RK  +   + +  Q+++ L +  S+NI+HRD+KL+NI++             +IK+ DF  + +  P     +  GT  Y APEV  NK  + +  DIWS   VL++M    V F  N  T L+  + K         + + ++LL G+LE +P+KRL +     HPWM
Sbjct:  965 VALKSINKQFLSEEASKRKVMQEFNILRRTRHI-SIVRLYESFETAQHIVFV-MEVCGSGDLLTYV----RRRRKLKEDVAKHMFKQIIEGLRYCHSKNILHRDIKLDNILLNSEG---------DIKICDFGVSKLVKPGEIMTEQCGTPAYIAPEVFENKGYEGYSSDIWSAGVVLYAMLYGTVPFKANNMTELQKQITKCQTTFKEEISPEAISLLKGILERDPVKRLKISEIFKHPWM 1191          
BLAST of Protein kinase domain containing protein vs. TrEMBL
Match: A0A1Q9DZE3 (Putative serine/threonine-protein kinase fhkE OS=Symbiodinium microadriaticum OX=2951 GN=fhkE PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.107e-19
Identity = 71/241 (29.46%), Postives = 127/241 (52.70%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDF-ECAVIYDPQFPPQDNVGTNQYKAPEVL----TNKPQDFKVDIWSLATVLFSMKTNV-CFD----------KNTALRHPVIKR-NKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNMKQ 912
            E+ IL +++H + +V L +S I   D + L M     G+L  F   + +    FT+   R + +Q+ + L ++ SQ+I++RD+K ENI+V     K+  +  + IKL DF    +I+D        VGT QY APEV       K  D +VD+WSL  VL+ M      FD          +  +++ P  +R ++   +L+  +++ +P++RL ++ C++HPW++   G L  + + ++Q
Sbjct:  186 EVSILSSLRHNR-IVSLFES-IESQDYLHLVMELVEGGEL--FDHIVNIGS--FTEPVARYVFIQIAEGLKYIHSQHIVYRDLKPENILVDQ---KNSRQGLLEIKLSDFGHSKLIHDGYSTALTRVGTPQYWAPEVSDPFKAAKGYDERVDLWSLGVVLYVMLVGAYPFDGLGEPIDAQIRRASVQFPAGRRPSQNAQDLIRALIQSDPMQRLDLDRCLAHPWVSTSAGSLSKVLNEVRQ 417          
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000015274.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:30162873:30173183:1 gene:ENSAMXG00000014843.2 transcript:ENSAMXT00000015274.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 6.621e-18
Identity = 61/218 (27.98%), Postives = 108/218 (49.54%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP-QDFKVDIWSLATVLFSMKTNVCFDKNT---------ALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWM 864
            EI IL  + H   +V++++ F    +E F QM     GD       + M+ R   +     I  QL+  + +L+ ++++HRD+K ENII+  +++         IKLIDF  A   +P        GT +Y +PEVL   P +  ++++WSL  +L+++     F +N          A  +P    + +L  LL+G+L   P +R+++E  +  PW+
Sbjct:  192 EIAILARLSH-PNIVKVMEVF---ENESFFQMVMEKHGDGLDLFEFIDMQPR-LDEPLASYIFRQLVSAVTYLRGKSVLHRDIKDENIIINTLFH---------IKLIDFGSATTLEPGKLFHTFCGTLEYCSPEVLQGNPYEGPELEMWSLGVLLYTL----LFSENPFSTVEETILAKLNPPCNISSELYGLLAGLLHPMPAQRITLEELLQEPWI 391          
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Match: ulk2 (unc-51 like autophagy activating kinase 2 [Source:NCBI gene;Acc:103026407])

HSP 1 Score: 85.1149 bits (209), Expect = 1.216e-17
Identity = 58/177 (32.77%), Postives = 89/177 (50.28%), Query Frame = 1
Query:  178 DIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLF 708
            ++A+K  + K L+        EIKIL+ +QH + +V L D   TPN  VFL M +   GDL  +  A    K    +  +R  + Q+   +  L S+ IIHRD+K +NI++     K  +   I IK+ DF  A             G+  Y APEV+ ++  D K D+WS+ TV++
Sbjct:   35 EVAIKSINKKNLSKSQILLGKEIKILKELQH-ENIVALYDVQETPN-FVFLVMEYCNGGDLADYLQA----KGTLREDTLRVFLQQIAAAMRILNSKGIIHRDLKPQNILLSYTGRKKSSINGIRIKIADFGFARYLQSNMMAATLCGSPMYMAPEVIMSQNYDAKADLWSIGTVIY 205          
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Match: stk17a (serine/threonine kinase 17a [Source:NCBI gene;Acc:103045004])

HSP 1 Score: 81.6481 bits (200), Expect = 7.321e-17
Identity = 56/232 (24.14%), Postives = 111/232 (47.84%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVCF----DKNTAL-----------RHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWM-TNRKGKLE 888
            EI +LE    C+ VV L + +  P+ E+ L + F A G++  F   +  +   F +  +++++ Q+L+ + FL  ++++H D+K +NI++      +      +IK++DF  + +       ++ +GT +Y APEVL  +P     D+WS+  + + M T +      DK                  + + +K  +  +  +L + P  R + E C+ H W+ T  K  +E
Sbjct:   87 EIAVLELAASCQRVVNLHEVYELPS-EMVLVLEFAAGGEI--FNQCVAERDEAFKEEDVKRLLRQILEGVSFLHKRDVVHLDLKPQNILL------TSNDPLGDIKIVDFGLSRMVSNNQEIREIMGTPEYVAPEVLNYEPISTATDMWSIGVLAYVMLTGISPFLGDDKQETFLNISQINISYTEEELEQLDKAAIQFIKSLLIKEPEGRATAEECLKHQWLQTQEKNSVE 309          
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000054016.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:23125160:23127852:-1 gene:ENSAMXG00000032327.1 transcript:ENSAMXT00000054016.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 8.987e-17
Identity = 66/239 (27.62%), Postives = 113/239 (47.28%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDN--VGTNQYKAPEVLTNKPQDF-KVDIWSLATVLFSMKT--------NVCFDKNTALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNMKQRFGI 924
            E++I++ + H   +V++ +   TP   +F+ M   A  DL++    L      F     + +  QL+  +++L  Q+I+HRD+K ENI++              IK+ DF  + +    FP   N   GT  Y APEVL  K  D  K D+WSL  +L++M T        N+ + +   L++  I   K   + +S ML+ +P  R SV     HPW+  +   + +   N  ++ G+
Sbjct:   59 ELEIIKYLDH-PYIVQVYEVHETPQGLIFIVMEA-AMMDLKQMIVELNY----FPVDLAKAVFSQLVSAVVYLHEQDIVHRDLKSENILLTPDG---------TIKVTDFGFSRM-SRGFPELCNSLCGTPNYCAPEVLCGKSYDGKKSDVWSLGVILYTMVTGELPFNYENILYLQKKPLQYS-IPVEKSCRDFISYMLQYDPFTRPSVTEVAQHPWLQLKSATVTTASKNTGKKIGL 280          
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Match: si:dkey-240h12.4 (death-associated protein kinase 2-like [Source:NCBI gene;Acc:103045656])

HSP 1 Score: 80.8777 bits (198), Expect = 1.152e-16
Identity = 73/286 (25.52%), Postives = 129/286 (45.10%), Query Frame = 1
Query:   52 LDNKMDIEELRKSLKNQNFPSNFTFRYTIEDEKVSVYNNGHEDIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVC-FDKNT---ALRHPV-----------IKRNKKLLNLLSGMLEENPLKRLSVEACISHPWM 864
            L N  D  E+ + L + +F      R     E+ S  +   + + L++  S  L L       E++IL+ +QH   ++ L D F     EV + +     G+L  F A    +K   T+ +  + + Q+L+ + F+ S+ I H D+K ENI++ D     K      IK+IDF  A    P    +   GT QY  PEV+  +P     D+WS+  + + + + +  F  +T    LR+ V            + +    + +  +L + P +R++ E C+ HPW+
Sbjct:    6 LQNVEDFYEIGEILGSGHFGQVRELR-----ERASGVSWAGKFVKLRRSVSSRLGLERKSVEREVEILQALQHT-NIMALKDVF-ESRAEVVIVVELIRGGELFDFVA----EKENLTEIEAIEFLKQILKGVAFMHSKQIAHFDLKPENIMLSD-----KKVEHPEIKIIDFGLAQRLTPGEEYRSLCGTPQYIGPEVINYEPLSVASDMWSIGVITYILLSGLSPFQGDTDEETLRNIVDMKYEFEEQYFSQTSDMAKDFIEKLLIKEPSERMTAEECLLHPWI 275          
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 92.0485 bits (227), Expect = 3.191e-21
Identity = 62/242 (25.62%), Postives = 119/242 (49.17%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTN----VCFDK----------NTALRHPVIKR-NKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNMKQRFG 921
            E+ ILE  + C  +++L D+F TP  E+ L + +   G++  F   +   +  FT+  +R++M Q+L+ + FL   +++H D+K +NI++      +      +IK++DF  +   +     ++ +GT +Y APEVL  +P     D+WS+  + + M T     +  DK          N +    V +  + + +  +  +L + P +R + E C+ HPW++ R G L     N+    G
Sbjct:   42 EMAILEAARSCPHIIDLHDAFETPT-EIILVLEYAVGGEI--FNQCVAEGEDAFTEVDVRRLMRQILEGVAFLHRNDVVHLDLKPQNILL------TSASPLGDIKIVDFGLSRRVNSAEELREIMGTPEYVAPEVLNYEPISKATDMWSVGVLAYVMLTGESPFLGEDKQETFLNVSQLNVSYEPEVFEGVSVQAVAFIQQLLVKAPHRRATAEHCLRHPWLSAR-GVLPGWMENLAGGAG 273          
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010749.1 (pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1 gene:ENSPMAG00000009735.1 transcript:ENSPMAT00000010749.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 1.011e-18
Identity = 63/225 (28.00%), Postives = 110/225 (48.89%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDN---VGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTN-VCFDKN---TALRHPVIKR-------NKKLLNLLSGMLEENPLKRLSVEACISHPWMTNR 873
            E++I   ++H  +V+EL   F   N  V+L +     G++ ++   LK K   F++ Q+R  M Q +  +L+L S  I+HRD+ L N+++            +NIK+ DF  A     + P + +    GT  Y +PE+ T      + D+WSL  +L++M      FD +   T L   V+         +K   +L+  +L++NP+ RL +   + HP+M  R
Sbjct:   16 EVEIHCQLKH-PSVLELYTCFEDQN-YVYLVLEMCNNGEVGRY---LKAKGTPFSEEQVRHFMKQTVHGMLYLHSHGILHRDLTLSNLLL---------TADMNIKIADFGLAAQL--RLPEEKHFTMCGTPNYISPEIATRGAHGLESDVWSLGCMLYTMLVGRPPFDTDAIGTTLNRVVLGEYSEPMHLSKPARSLIHQLLQKNPVDRLGLACVLDHPFMALR 224          
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010747.1 (pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1 gene:ENSPMAG00000009735.1 transcript:ENSPMAT00000010747.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 1.078e-18
Identity = 63/225 (28.00%), Postives = 110/225 (48.89%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDN---VGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTN-VCFDKN---TALRHPVIKR-------NKKLLNLLSGMLEENPLKRLSVEACISHPWMTNR 873
            E++I   ++H  +V+EL   F   N  V+L +     G++ ++   LK K   F++ Q+R  M Q +  +L+L S  I+HRD+ L N+++            +NIK+ DF  A     + P + +    GT  Y +PE+ T      + D+WSL  +L++M      FD +   T L   V+         +K   +L+  +L++NP+ RL +   + HP+M  R
Sbjct:   16 EVEIHCQLKH-PSVLELYTCFEDQN-YVYLVLEMCNNGEVGRY---LKAKGTPFSEEQVRHFMKQTVHGMLYLHSHGILHRDLTLSNLLL---------TADMNIKIADFGLAAQL--RLPEEKHFTMCGTPNYISPEIATRGAHGLESDVWSLGCMLYTMLVGRPPFDTDAIGTTLNRVVLGEYSEPMHLSKPARSLIHQLLQKNPVDRLGLACVLDHPFMALR 224          
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 77.7962 bits (190), Expect = 6.627e-16
Identity = 63/224 (28.12%), Postives = 105/224 (46.88%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNV-GTNQYKAPEVLTNKPQDFKVDIWSLATVLFSM-------KTNVCFDKNTALRHPVIKRNKKL----LNLLSGMLEENPLKRLSVEACISHPWMTNRK 876
            EI I+  +QH   +V+++DSF T  D+  + +  YA G+L +             + Q+R+I  QL+  L +L S  I+HRD+K +NI++              +KL DF  A           ++ GT  Y +PE++  KP D   D+WS+  +L+ +        TN  F   + +    +K  K +     N L G+L + P  RLS  A + HP++  + 
Sbjct:   51 EIDIMRGLQH-PNIVQMLDSFET--DKEVVVVTDYAEGELFQILE----DDGNLPEEQVREIACQLVSALYYLHSHRILHRDMKPQNILLGKGGV---------VKLCDFGFARAMSINTLVLTSIKGTPLYMSPELVEEKPYDHTADLWSMGCILYELFVGTPPFYTNSIFQLVSLIIKDPVKWPKNMSSEFRNFLQGLLTKEPKLRLSWPALLHHPFVAGKS 258          
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003997.1 (pep scaffold:Pmarinus_7.0:GL489063:434:4002:1 gene:ENSPMAG00000003652.1 transcript:ENSPMAT00000003997.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 6.978e-16
Identity = 47/179 (26.26%), Postives = 85/179 (47.49%), Query Frame = 1
Query:  397 KFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNV---CFDKNTALRHPVIKRN------------KKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLE 888
            + T+ +  + M Q+L  + F+  Q I+H D+K ENI+  +       +    IK+IDF  A   +P  P +   GT ++ APEV+  +P  F  D+WS+  + + + + +     D +      V   N            +   +L+  M+E++  KR + E C+ HPW+ +   +LE
Sbjct:   16 ELTERECVEYMRQILDGVGFIHRQRIVHLDLKPENIMCVN-------RTGTCIKIIDFGLARRIEPGVPLKVMFGTPEFVAPEVIAFEPVTFVTDMWSIGVICYILVSGISPLAGDTDVETMANVTSCNWDFDDDGFADISEDCKDLIGKMIEKDVKKRWTCEQCVQHPWVQSSPERLE 187          
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 82.4185 bits (202), Expect = 1.098e-17
Identity = 53/168 (31.55%), Postives = 88/168 (52.38%), Query Frame = 1
Query:  406 DSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP-QDFKVDIWSLATVLFSMKTNVCF-----DKNTALRHPVIKRNK---------KLLNLLSGMLEENPLKRLSVEACISHPWM 864
            + Q R+    +   L++L + NI+HRD+K+ENI++ D            IK+IDF  + IYD +       G+  + APE+L   P    +VD+WS   VLF +   VC      D+N+++ H  IK+ K         ++++LLS ML  +P +R +++  + H WM
Sbjct:  243 EHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSS---------EIKIIDFGLSNIYDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVL---VCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPKRRATLKQVVEHHWM 398          
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Match: DUN1 (Cell-cycle checkpoint S/T protein kinase; required for transient G2/M arrest after DNA damage, damage-induced transcription, and nuclear-to-cytoplasmic redistribution of Rnr2p-Rnr4p after genotoxic stress and iron deprivation; phosphorylates repair protein Rad55p, transcriptional repressor Sml1p, superoxide dismutase, and ribonucleotide reductase inhibitors Crt1p and Dif1p; functions in the Mec1p pathway to regulate dNTP pools and telomere length; postreplicative repair role [Source:SGD;Acc:S000002259])

HSP 1 Score: 79.337 bits (194), Expect = 9.502e-17
Identity = 67/238 (28.15%), Postives = 107/238 (44.96%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQ--MPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTK----------LFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLF----------------SMKTNVCFDKNTALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            E  IL  +QH   +V L+DSF+ P  +  +Q  +      D E F     ++K      + + +  QLL  L +L  QNIIHRD+K ENI++     ++ ++          + I +K+ DF  A             GT  Y APEVLT K    KVD+WS   +L+                S+K  +   K         K +  +L+L+S +L  NP +R +++  ++HPW  +
Sbjct:  248 ETNILMRVQH-PNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERI--VRKTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWFND 482          
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Match: KIN2 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN2 has a paralog, KIN1, that arose from the whole genome duplication [Source:SGD;Acc:S000004086])

HSP 1 Score: 77.411 bits (189), Expect = 5.898e-16
Identity = 50/164 (30.49%), Postives = 87/164 (53.05%), Query Frame = 1
Query:  418 RQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP-QDFKVDIWSLATVLFSMKTNVCF-----DKNTALRHPVIKRNK---------KLLNLLSGMLEENPLKRLSVEACISHPWM 864
            R+    +   L +L + NI+HRD+K+ENI++              IK+IDF  + I+D +       G+  + APE+L  +P    +VDIWS   VL+ +   VC      D+N+++ H  IK+ K         ++++LL+ M+  +PL+R +++  + HPWM
Sbjct:  226 RKFARGIASALQYLHANNIVHRDLKIENIMISSSG---------EIKIIDFGLSNIFDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVL---VCGKVPFDDENSSILHEKIKKGKVDYPSHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWM 377          
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 73.1738 bits (178), Expect = 7.440e-15
Identity = 69/271 (25.46%), Postives = 128/271 (47.23%), Query Frame = 1
Query:  181 IALKKYDSKY-LALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEV-LTNKPQDFKVDIWSLATVL------------------FSMKTN------------VCFDKN----TALRH----PVIKRNKKL----LNLLSGMLEENPLKRLSVEACISHPW 861
            +A+KK    +  A+ + R + E+K+L++++H + ++ L D F++P ++++       T DL +      ++ R      ++  + Q+L+ L ++ S  +IHRD+K  NI++ +           ++K+ DF  A I DPQ      V T  Y+APE+ LT +  D +VDIWS   +                   FS+ T+            +C +      T+L H    P  +R K +    ++LL  ML  +P KR++    ++HP+
Sbjct:   49 VAIKKIMKPFSTAVLAKRTYRELKLLKHLRH-ENLICLQDIFLSPLEDIYFVTELQGT-DLHRL-----LQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINEN---------CDLKICDFGLARIQDPQM--TGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRITAADALAHPY 301          
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 69.707 bits (169), Expect = 1.583e-13
Identity = 46/162 (28.40%), Postives = 84/162 (51.85%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKF---TAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFE-CAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSM 714
            EI ++++ +H K +V  +++++  +D++++ M F   G L      +          T+ QI  I+ +  Q L FL  ++IIHRD+K +N+++ D   +        +K+ DF  CA + D +      VGT  + APEV+  +  D K+D+WSL  +   M
Sbjct:  610 EILVMKDSRH-KNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLL-DTRAR--------VKITDFGFCARLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEM 761          
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Match: EDO37799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEV7])

HSP 1 Score: 84.3445 bits (207), Expect = 7.778e-19
Identity = 69/243 (28.40%), Postives = 115/243 (47.33%), Query Frame = 1
Query:  181 IALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTN-VCFDKNT--ALRHPVIKRNK------------KLLNLLSGMLEENPLKRLSVEACISHPWM 864
            +A+K    K L+        EIKIL+ +QH + VV L D    P+  V+L M       + + T     KK   ++  IR  + Q+   +  L+S+ I+HRD+K +N+++        +   I IK+ DF  A     +       G+  Y APEV+ +K  D + D+WSL T+++   T    F  N+  AL+    ++NK            +L +LL G+L+ NP  R+      +HP++
Sbjct:   37 VAVKVISKKNLSKTQSLLAKEIKILKELQH-ENVVSLFDCQELPSS-VYLVMEVLYICQMLRLT-----KKGTLSEDTIRMFLQQIASAMNALQSKGIVHRDLKPQNLLLSHSAASHPSPADIRIKIADFGFARFLPGEMMAATLCGSPMYMAPEVIMSKAYDARADLWSLGTIVYQCLTGKAPFQANSPQALKK-FYEKNKNVCPNIPAGTSSQLKHLLMGLLKRNPKDRMDFGDFFTHPFL 271          
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Match: EDO34707 (Serine/threonine-protein kinase PLK4 [Source:UniProtKB/Swiss-Prot;Acc:A7SNN5])

HSP 1 Score: 85.8853 bits (211), Expect = 2.330e-18
Identity = 64/252 (25.40%), Postives = 127/252 (50.40%), Query Frame = 1
Query:  175 EDIALKKYDSKYL--ALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDN---VGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVCFDKNTALRHPVIKRNKKLL--------------NLLSGMLEENPLKRLSVEACISHPWMTNR 873
            +++A+K  D K +  A    R   E++I   ++H  +++EL  ++   ++ V+L +     G+  ++   L+ +     +S++R+IM+Q+++ +L+L S  IIHRD+ L NI++            ++ K+ DF  A       P + +    GT  Y +PE+ T  P   + D+WS+  +LF++          A+R  +   NK +L              +L+S +L++NP  RL++   + HP++TN+
Sbjct:   37 QEVAIKMIDKKAMRTAGMVNRVCNEVEIHCRLKH-PSILELY-TYFEDDNYVYLVLELAENGEANRY---LRKQGHTLKESEVRRIMLQVVKGVLYLHSHGIIHRDLSLGNILLSS---------DMDAKIADFGLATRLS--LPDEKHYTMCGTPNYISPEIATRDPHGLESDVWSIGCMLFTLLVGKPPFDTEAVRSTL---NKVVLAEYDIPNHVSIEARDLISKLLKKNPQDRLTLSGILDHPFITNQ 269          
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Match: EDO40703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6E0])

HSP 1 Score: 79.7221 bits (195), Expect = 4.608e-17
Identity = 59/227 (25.99%), Postives = 117/227 (51.54%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPP---QDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNV-CFDKNTALR-HPVIKRN-------------KKLLNLLSGMLEENPLKRLSVEACISHPWMT 867
            E+ I++ I H + ++ L + + T +  ++L M     G L+K       +K++FT+ +   ++ QL+  + +L   +I+HRD+KLENI++    + +  +L +N+K+ DF  +++          Q   GT  Y APEV+ +     + D+WS+  +++++ T    F  +T  + + +IK+              +   NLL GML+ +P  R + +  + HPW+T
Sbjct:   74 EVMIMKKIYH-EHLIHLEEIYET-SKRMYLVMELCDAGGLDKMLE----RKKRFTEKETWTVIKQLVSAVAYLHDLDIVHRDLKLENILLS---HPTGNEL-LNVKITDFGLSIVKGGVGSDSMMQSVCGTPMYMAPEVIDDLGYSQQCDVWSIGVIMYTLFTGRPPFMADTEEKLYEIIKKGIVDFSDPCWEVCHESAKNLLLGMLKVDPAHRRTAKEVLIHPWIT 290          
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Match: EDO41399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I8])

HSP 1 Score: 78.9518 bits (193), Expect = 1.203e-16
Identity = 57/222 (25.68%), Postives = 107/222 (48.20%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFS-------MKTNVCFDKNTALRH-------PVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWM 864
            EI++L N++H + +V+L D F    + +FL M +   GDL +F  +    KR   +   R+ + QL   L +++S ++ H D+K +N+++   +          +K+ DF  A    P     +  G+  Y APE++  +  D  VD+WS+  +L+         K+    +    LR        P  + +    +LL  +L+ +P +R+S EA  +HP++
Sbjct:   65 EIELLRNLEH-EHIVQLKD-FQWDENHIFLIMEYCGGGDLSRFIHS----KRALPERMARKFLRQLACALQYMRSYDVAHMDLKPQNLLLSSRHNPV-------LKIADFGFAQKLHPNSEASNIRGSPLYMAPEMICCQSYDASVDLWSVGVILYETLFGEPPFKSKTFVELEAKLRSSEPIKLPPGPRVSADCRDLLIALLQRDPKQRISFEAFFTHPFI 273          
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Match: EDO41241 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z5])

HSP 1 Score: 80.4925 bits (197), Expect = 1.218e-16
Identity = 72/274 (26.28%), Postives = 131/274 (47.81%), Query Frame = 1
Query:  154 SVYNNGHEDIALKKYDS-KYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLF-SMKTNVCFDK---------NTALRHPV---IKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNMKQRFGI*YI 933
             V+     ++A+K  D  ++      +   E+ IL+ + H   +V L   F T  + VF+ M       LE     L     K  +   R ++ Q+L  L +L S+NI+H D+K EN+++  +  +     +  +KL DF  A I + +   +  VGT  Y APEVL N+P +  +D+WS+  V++ S+     F++         N A  +P     + +K  +NL+S +L+     R   + C+ HPW+ + +  L+    ++++  GI Y+
Sbjct:  533 GVHRQSGREVAVKVIDKLRFPTKQEAQLKNEVAILKQLNH-PGMVTLEQMFET-QERVFVVMEKLRGDMLEMI---LSSPNGKLDERCTRFLITQILLALKYLHSKNIVHCDLKPENVLLAPITSECG---YPAVKLCDFGFARIIEEKSFRRSVVGTPAYLAPEVLLNQPYNRSLDMWSVGVVIYVSLSGTFPFNEEEDIQDQIHNAAFMYPPDPWQEISKDAINLISNLLQVKQRSRYGCDKCLIHPWLQSYQTWLD--LRSLERVMGIRYL 796          
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Match: pask (PAS domain containing serine/threonine kinase [Source:NCBI gene;Acc:101157160])

HSP 1 Score: 90.5077 bits (223), Expect = 2.039e-19
Identity = 68/235 (28.94%), Postives = 114/235 (48.51%), Query Frame = 1
Query:  226 GRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDF-KVDIWSLATVLFSMKTNVCFDKN----------TALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIW 897
            G+   EI IL  +QH   +V++V+ F    +  + QM     GD       + M+ R   +     I  QL+  + +L+++NIIHRD+K ENII+   ++         I+LIDF  A I  P     +  GT +Y +PEVL   P +  ++++WSL  +LF++     F +N            L+ P    + +L  +L G+L  NP KR++++  +  PW++      E  W
Sbjct:  938 GKVSQEIAILTRVQH-HNIVKVVEVF---ENGSYFQMVMEKHGDGLDLFEFIDMQPR-LDEPLASYIFRQLVAAVFYLRTKNIIHRDIKDENIIIDKCFH---------IRLIDFGSAAILVPGKLFYNFCGTLEYCSPEVLQGHPYEGPELEMWSLGVLLFTL----LFSENPFCDVEEILDAKLKLP-FSVSSELHVVLRGLLHSNPKKRMTLDQLLLQPWISQPISLAEYSW 1153          
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Match: pask (PAS domain containing serine/threonine kinase [Source:NCBI gene;Acc:101157160])

HSP 1 Score: 87.0409 bits (214), Expect = 2.617e-18
Identity = 68/235 (28.94%), Postives = 114/235 (48.51%), Query Frame = 1
Query:  226 GRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP-QDFKVDIWSLATVLFSMKTNVCFDKN----------TALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIW 897
            G+   EI IL  +QH   +V++V+ F    +  + QM     GD       + M+ R   +     I  QL+  + +L+++NIIHRD+K ENII+   ++         I+LIDF  A I  P     +  GT +Y +PEVL   P +  ++++WSL  +LF++     F +N            L+ P    + +L  +L G+L  NP KR++++  +  PW++      E  W
Sbjct:  718 GKVSQEIAILTRVQH-HNIVKVVEVF---ENGSYFQMVMEKHGDGLDLFEFIDMQPR-LDEPLASYIFRQLVAAVFYLRTKNIIHRDIKDENIIIDKCFH---------IRLIDFGSAAILVPGKLFYNFCGTLEYCSPEVLQGHPYEGPELEMWSLGVLLFTL----LFSENPFCDVEEILDAKLKLP-FSVSSELHVVLRGLLHSNPKKRMTLDQLLLQPWISQPISLAEYSW 933          
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Match: si:dkey-240h12.4 (death-associated protein kinase 2 [Source:NCBI gene;Acc:101174843])

HSP 1 Score: 83.1889 bits (204), Expect = 2.114e-17
Identity = 64/243 (26.34%), Postives = 117/243 (48.15%), Query Frame = 1
Query:  181 IALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVC-FDKNT---ALRHPV----------IKRNKKLL-NLLSGMLEENPLKRLSVEACISHPWM 864
            + +++     L +       E++IL+ ++H   +V L D F     E+ L +   + G+L  F A    +K    +++  Q M Q+L+ L F+ S NI H D+K ENI++ +     K    +N+KLIDF  A  +      +   GT QY APEV++ +P     D+WS+  + + + + +  F  +T    LR+ V           K    +  + +  +L ++  +R++ E C+ HPW+
Sbjct:   44 LKIRRKGGSLLGMDRTSVEREVEILQALKH-PNIVLLKDVF-ESRSEMVLVLELISGGELFDFIA----EKDNLLETEAIQFMKQILEGLRFMHSNNIAHFDLKPENIMLSE-----KVSPQLNVKLIDFGLAYRFHQGQEYKSTSGTPQYVAPEVISFEPLSTAADMWSIGVITYILLSGMSPFQGDTDEETLRNVVAVHYEFEDLYFKTTSSMAKDFIQKLLVKDSRERMTAEECLLHPWI 275          
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Match: si:dkey-240h12.4 (death-associated protein kinase 2 [Source:NCBI gene;Acc:101174843])

HSP 1 Score: 83.1889 bits (204), Expect = 2.114e-17
Identity = 64/243 (26.34%), Postives = 117/243 (48.15%), Query Frame = 1
Query:  181 IALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVC-FDKNT---ALRHPV----------IKRNKKLL-NLLSGMLEENPLKRLSVEACISHPWM 864
            + +++     L +       E++IL+ ++H   +V L D F     E+ L +   + G+L  F A    +K    +++  Q M Q+L+ L F+ S NI H D+K ENI++ +     K    +N+KLIDF  A  +      +   GT QY APEV++ +P     D+WS+  + + + + +  F  +T    LR+ V           K    +  + +  +L ++  +R++ E C+ HPW+
Sbjct:   44 LKIRRKGGSLLGMDRTSVEREVEILQALKH-PNIVLLKDVF-ESRSEMVLVLELISGGELFDFIA----EKDNLLETEAIQFMKQILEGLRFMHSNNIAHFDLKPENIMLSE-----KVSPQLNVKLIDFGLAYRFHQGQEYKSTSGTPQYVAPEVISFEPLSTAADMWSIGVITYILLSGMSPFQGDTDEETLRNVVAVHYEFEDLYFKTTSSMAKDFIQKLLVKDSRERMTAEECLLHPWI 275          
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Match: prkd3 (serine/threonine-protein kinase D3 [Source:NCBI gene;Acc:101160371])

HSP 1 Score: 82.4185 bits (202), Expect = 7.923e-17
Identity = 72/256 (28.12%), Postives = 123/256 (48.05%), Query Frame = 1
Query:  157 VYNNGHE----DIALKKYDS-KYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLF-SMKTNVCFD---------KNTALRHPVIKR---NKKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            VY   H     D+A+K  D  ++      +   E+ IL+N+ H   +V L   F TP + VF+ M       LE     L  +K K  +   + ++ Q+L  L  L  +NI+H D+K EN+++      +  + F  +KL DF  A I   +   +  VGT  Y APEVL +K  +  +D+WS+  +++ S+     F+         +N A  +P       + +  +L++ +L+    KR SV+ C+SHPW+ +
Sbjct:  581 VYGGKHRKSGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHH-PGIVNLECMFETP-ERVFVVMEKLHGDMLEMI---LSSEKSKLPERITKFLVTQILVALRHLHFKNIVHCDLKPENVLL------ASAEPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDEDINDQIQNAAFMYPPAPWKDISAEATDLINNLLQVKMRKRYSVDKCLSHPWLQD 825          
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Match: SMESG000056960.1 (SMESG000056960.1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 287/287 (100.00%), Postives = 287/287 (100.00%), Query Frame = 1
Query:   64 MDIEELRKSLKNQNFPSNFTFRYTIEDEKVSVYNNGHEDIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVCFDKNTALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNMKQRFGI 924
            MDIEELRKSLKNQNFPSNFTFRYTIEDEKVSVYNNGHEDIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVCFDKNTALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNMKQRFGI
Sbjct:    1 MDIEELRKSLKNQNFPSNFTFRYTIEDEKVSVYNNGHEDIALKKYDSKYLALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNVCFDKNTALRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWMTNRKGKLESIWHNMKQRFGI 287          
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Match: SMESG000068045.1 (SMESG000068045.1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.731e-23
Identity = 65/224 (29.02%), Postives = 106/224 (47.32%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSF-ITPNDEVFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNV--CFDKNTA-------------LRHPVIKRNKKLLNLLSGMLEENPLKRLSVEACISHPWM 864
            E+KIL+  +    ++ ++    +    + F+ +P+   GDL+ +      K  +   SQI+ I   L   + FLKS +IIHRD+K ENI++      + +  F ++KLIDFE AV Y+P   P +  GT  Y APE+       F VDIWS+  VL+ + T      D+N                +H  ++++ +   LL  +       R S E C+   W+
Sbjct:   58 ELKILKLCEKSPYIINIIGEICVKETKQRFIILPYCKEGDLKTYLN----KHSELHISQIKSIAGNLFDAVKFLKSVSIIHRDIKCENILI------NSSAFFFDVKLIDFENAVAYNPLSEPSERCGTFGYIAPEMFDENFYSFGVDIWSIGVVLYYLFTRQFPFGDRNKHSEYVRNSKDFRFNYKHQTLRKHFQFRELLENIFVSQYKNRWSAEKCLQSNWL 271          
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Match: SMESG000081274.1 (SMESG000081274.1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.738e-20
Identity = 67/237 (28.27%), Postives = 113/237 (47.68%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDE---VFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNV-------CFDKNTALRHPVIKRN-----------------KKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            EI+IL+ +   + ++EL+++      +     +   +   G+L    A  ++     T+  +  IM Q+L  + F+ S++IIHRD+K ENI+     Y SK    +  K+IDF  AV +D + PP+  VGT  + APEVL  +PQ +  DIWS+  + F++   +         D    L  P I  N                 ++  + +S +L   P KRLS   C+ H W+++
Sbjct:  270 EIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL----LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIV-----YCSKNNDLL--KIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSS 495          
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Match: SMESG000081274.1 (SMESG000081274.1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.782e-20
Identity = 67/237 (28.27%), Postives = 113/237 (47.68%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDE---VFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNV-------CFDKNTALRHPVIKRN-----------------KKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            EI+IL+ +   + ++EL+++      +     +   +   G+L    A  ++     T+  +  IM Q+L  + F+ S++IIHRD+K ENI+     Y SK    +  K+IDF  AV +D + PP+  VGT  + APEVL  +PQ +  DIWS+  + F++   +         D    L  P I  N                 ++  + +S +L   P KRLS   C+ H W+++
Sbjct:  257 EIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL----LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIV-----YCSKNNDLL--KIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSS 482          
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Match: SMESG000081274.1 (SMESG000081274.1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.173e-20
Identity = 67/237 (28.27%), Postives = 113/237 (47.68%), Query Frame = 1
Query:  241 EIKILENIQHCKTVVELVDSFITPNDE---VFLQMPFYATGDLEKFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVKDVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKPQDFKVDIWSLATVLFSMKTNV-------CFDKNTALRHPVIKRN-----------------KKLLNLLSGMLEENPLKRLSVEACISHPWMTN 870
            EI+IL+ +   + ++EL+++      +     +   +   G+L    A  ++     T+  +  IM Q+L  + F+ S++IIHRD+K ENI+     Y SK    +  K+IDF  AV +D + PP+  VGT  + APEVL  +PQ +  DIWS+  + F++   +         D    L  P I  N                 ++  + +S +L   P KRLS   C+ H W+++
Sbjct:  270 EIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL----LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIV-----YCSKNNDLL--KIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSS 495          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ULK21.519e-1831.15unc-51 like autophagy activating kinase 2 [Source:... [more]
ULK21.519e-1831.15unc-51 like autophagy activating kinase 2 [Source:... [more]
PASK1.099e-1727.31PAS domain containing serine/threonine kinase [Sou... [more]
PASK1.099e-1727.31PAS domain containing serine/threonine kinase [Sou... [more]
PASK1.099e-1727.31PAS domain containing serine/threonine kinase [Sou... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
air-16.398e-1626.43Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
air-16.398e-1626.43Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
pmk-21.622e-1529.26Mitogen-activated protein kinase pmk-2 [Source:Un... [more]
pmk-21.822e-1529.26Mitogen-activated protein kinase pmk-2 [Source:Un... [more]
R06A10.42.427e-1525.36pep chromosome:WBcel235:I:1089666:1095796:-1 gene:... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bt1.316e-1728.32gene:FBgn0005666 transcript:FBtr0344988[more]
bt1.327e-1728.32gene:FBgn0005666 transcript:FBtr0334482[more]
bt1.341e-1728.32gene:FBgn0005666 transcript:FBtr0334483[more]
bt1.443e-1728.32gene:FBgn0005666 transcript:FBtr0089793[more]
bt1.554e-1728.32gene:FBgn0005666 transcript:FBtr0301340[more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17a1.883e-1826.52serine/threonine kinase 17a [Source:ZFIN;Acc:ZDB-G... [more]
ulk1a1.010e-1630.77unc-51 like autophagy activating kinase 1a [Source... [more]
ulk21.068e-1632.20unc-51 like autophagy activating kinase 2 [Source:... [more]
si:dkey-201l21.23.661e-1628.06si:dkey-201l21.2 [Source:ZFIN;Acc:ZDB-GENE-060531-... [more]
camk1ga6.850e-1627.76calcium/calmodulin-dependent protein kinase IGa [S... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000029423.18.118e-1926.29serine/threonine-protein kinase 17A-like [Source:N... [more]
ULK21.752e-1833.90unc-51 like autophagy activating kinase 2 [Source:... [more]
PASK5.559e-1728.57PAS domain containing serine/threonine kinase [Sou... [more]
xpo56.379e-1726.18exportin 5 [Source:Xenbase;Acc:XB-GENE-5947328][more]
xpo56.673e-1726.18exportin 5 [Source:Xenbase;Acc:XB-GENE-5947328][more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pask1.198e-1832.29PAS domain containing serine/threonine kinase [Sou... [more]
Ulk24.270e-1831.15unc-51 like kinase 2 [Source:MGI Symbol;Acc:MGI:13... [more]
Plk49.155e-1827.87polo like kinase 4 [Source:MGI Symbol;Acc:MGI:1017... [more]
Plk49.155e-1827.87polo like kinase 4 [Source:MGI Symbol;Acc:MGI:1017... [more]
Plk49.753e-1827.87polo like kinase 4 [Source:MGI Symbol;Acc:MGI:1017... [more]
back to top
BLAST of Protein kinase domain containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q10292|MEK1_SCHPO2.011e-1833.33Meiosis-specific serine/threonine-protein kinase m... [more]
sp|Q8IYT8|ULK2_HUMAN7.296e-1831.15Serine/threonine-protein kinase ULK2 OS=Homo sapie... [more]
sp|Q8CEE6|PASK_MOUSE8.382e-1832.29PAS domain-containing serine/threonine-protein kin... [more]
sp|B2GUY1|PLK4_RAT2.671e-1728.28Serine/threonine-protein kinase PLK4 OS=Rattus nor... [more]
sp|Q9QY01|ULK2_MOUSE2.987e-1731.15Serine/threonine-protein kinase ULK2 OS=Mus muscul... [more]
back to top
BLAST of Protein kinase domain containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A077ZT513.835e-2031.65Myosin light chain kinase OS=Stylonychia lemnae OX... [more]
A0A1J4JCP56.072e-2031.28CAMK family protein kinase OS=Tritrichomonas foetu... [more]
A0A481ZAI47.035e-2031.17Putative serine/threonine protein kinase OS=Pithov... [more]
A0A077ZTR11.060e-1930.17Protein kinase domain containing protein OS=Stylon... [more]
A0A1Q9DZE31.107e-1929.46Putative serine/threonine-protein kinase fhkE OS=S... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000015274.26.621e-1827.98pep primary_assembly:Astyanax_mexicanus-2.0:9:3016... [more]
ulk21.216e-1732.77unc-51 like autophagy activating kinase 2 [Source:... [more]
stk17a7.321e-1724.14serine/threonine kinase 17a [Source:NCBI gene;Acc:... [more]
ENSAMXT00000054016.18.987e-1727.62pep primary_assembly:Astyanax_mexicanus-2.0:3:2312... [more]
si:dkey-240h12.41.152e-1625.52death-associated protein kinase 2-like [Source:NCB... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk17b3.191e-2125.62serine/threonine kinase 17b (apoptosis-inducing) [... [more]
ENSPMAT00000010749.11.011e-1828.00pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1... [more]
ENSPMAT00000010747.11.078e-1828.00pep scaffold:Pmarinus_7.0:GL476742:232416:246048:1... [more]
STK366.627e-1628.13serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
ENSPMAT00000003997.16.978e-1626.26pep scaffold:Pmarinus_7.0:GL489063:434:4002:1 gene... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN11.098e-1731.55Serine/threonine protein kinase involved in regula... [more]
DUN19.502e-1728.15Cell-cycle checkpoint S/T protein kinase; required... [more]
KIN25.898e-1630.49Serine/threonine protein kinase involved in regula... [more]
HOG17.440e-1525.46Mitogen-activated protein kinase involved in osmor... [more]
CLA41.583e-1328.40Cdc42p-activated signal transducing kinase; member... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO377997.778e-1928.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347072.330e-1825.40Serine/threonine-protein kinase PLK4 [Source:UniP... [more]
EDO407034.608e-1725.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413991.203e-1625.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412411.218e-1626.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pask2.039e-1928.94PAS domain containing serine/threonine kinase [Sou... [more]
pask2.617e-1828.94PAS domain containing serine/threonine kinase [Sou... [more]
si:dkey-240h12.42.114e-1726.34death-associated protein kinase 2 [Source:NCBI gen... [more]
si:dkey-240h12.42.114e-1726.34death-associated protein kinase 2 [Source:NCBI gen... [more]
prkd37.923e-1728.13serine/threonine-protein kinase D3 [Source:NCBI ge... [more]
back to top
BLAST of Protein kinase domain containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056960.10.000e+0100.00SMESG000056960.1[more]
SMESG000068045.11.731e-2329.02SMESG000068045.1[more]
SMESG000081274.11.738e-2028.27SMESG000081274.1[more]
SMESG000081274.11.782e-2028.27SMESG000081274.1[more]
SMESG000081274.12.173e-2028.27SMESG000081274.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008475 ID=SMED30008475|Name=Protein kinase domain containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1035bp
TTATATTCAATCGAATTATTATTTAAATAAATATTTTTTGGTTGATAATA
TTTAGACAACAAAATGGATATTGAAGAATTGAGAAAATCTTTAAAGAATC
AAAATTTCCCATCCAACTTCACATTTAGATATACAATTGAAGACGAAAAA
GTTTCCGTTTACAATAACGGACATGAAGACATTGCTTTGAAAAAATATGA
TTCCAAATATCTGGCATTGCATTCAGGACGTTGCTTTGCTGAAATCAAGA
TATTAGAGAATATTCAACATTGCAAAACTGTCGTTGAATTAGTCGACTCG
TTTATTACTCCAAACGATGAAGTGTTTTTACAAATGCCTTTTTACGCCAC
TGGCGACCTTGAGAAATTTACGGCAGCTTTAAAGATGAAAAAACGAAAGT
TCACAGACTCCCAGATCAGACAAATTATGATGCAATTGTTACAGACTCTT
TTATTTCTCAAATCCCAAAATATCATCCATCGAGATGTTAAGCTGGAAAA
CATAATTGTCAAGGACGTTTATTATAAAAGTAAAACAAAATTATTCATCA
ATATAAAATTAATTGATTTTGAATGTGCTGTTATTTATGATCCCCAGTTT
CCTCCACAGGACAATGTCGGAACGAATCAGTATAAAGCTCCAGAAGTTTT
AACTAATAAACCTCAAGATTTCAAAGTTGATATTTGGTCACTTGCGACAG
TTTTGTTCTCAATGAAGACCAATGTTTGTTTTGATAAAAATACGGCATTG
CGACATCCAGTTATTAAAAGAAATAAGAAATTATTGAATTTGTTGAGTGG
AATGCTTGAGGAGAACCCTTTGAAGCGTTTGTCTGTTGAAGCGTGCATCA
GTCATCCATGGATGACAAATAGAAAAGGAAAACTAGAAAGCATTTGGCAT
AACATGAAACAAAGATTCGGAATATAATATATTTTGTCTATTTTGCTCGT
CGATTTTTGTGTGAAAGTATAGCGCAAATCCGTTTTTATTTCTAATATGA
CAAGAAAAATTTGTGAAGTTAGTTCATTGCGTAAT
back to top

protein sequence of SMED30008475-orf-1

>SMED30008475-orf-1 ID=SMED30008475-orf-1|Name=SMED30008475-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=288bp
MDIEELRKSLKNQNFPSNFTFRYTIEDEKVSVYNNGHEDIALKKYDSKYL
ALHSGRCFAEIKILENIQHCKTVVELVDSFITPNDEVFLQMPFYATGDLE
KFTAALKMKKRKFTDSQIRQIMMQLLQTLLFLKSQNIIHRDVKLENIIVK
DVYYKSKTKLFINIKLIDFECAVIYDPQFPPQDNVGTNQYKAPEVLTNKP
QDFKVDIWSLATVLFSMKTNVCFDKNTALRHPVIKRNKKLLNLLSGMLEE
NPLKRLSVEACISHPWMTNRKGKLESIWHNMKQRFGI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..32
score: 5.0