nuclear mitotic apparatus protein 1 isoform X2

Overview
Namenuclear mitotic apparatus protein 1 isoform X2
Smed IDSMED30008461
Length (bp)3994
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nuclear mitotic apparatus protein 1 isoform X2 (SMED30008461) t-SNE clustered cells

Violin plots show distribution of expression levels for nuclear mitotic apparatus protein 1 isoform X2 (SMED30008461) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nuclear mitotic apparatus protein 1 isoform X2 (SMED30008461) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nuclear mitotic apparatus protein 1 isoform X2 (SMED30008461) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008461

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30008461SMESG000071994.1 SmedASXL_017575SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30008461SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30008461SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008461SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30008461SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30008461SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008461SMESG000071994.1 dd_Smed_v6_10823_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30008461SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30008461SMESG000071994.1 dd_Smed_v4_10823_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Match: A0A1S3K4N9 (nuclear mitotic apparatus protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106178794 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.400e-40
Identity = 128/394 (32.49%), Postives = 209/394 (53.05%), Query Frame = 3
Query:   60 LDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQS-------ELAQSQMKLDQ--TKTLDAAQRANAEEIALEFQDKY-------KNLEKVLEAQKIEF----EETKRNLKRQHETEMKQLQADNEN 1181
            LD  D  +  V++KNA + +QR A + KEEL KV+ RV++IYG +E                + E          +E + D+  LE LL     ++KY QQVT+F+VGY  ++  RL+L+Q+VN+FF+ + + FD           EE L +   +   ++ D          E+A  +  ++ +  +LT R+ DLN EM++    YAQ KAGNKGRKK+EKAL  A  + + L+EKL  +   + EK+ ++  L KQ E K+ E  ++K AAE  K+ A  +E L+E+L  K A++ +L+        E AQ+    ++  T+ ++AAQ   +++I  E Q          ++L+++ E Q  +     +E    LK+QHE E+++L A+ E 
Sbjct:   31 LDRGDSPAQLVLDKNARSFAQRMADDTKEELEKVMKRVDHIYGTYE----------------YGEALMEGAGKNNMEYLSDIMELEELLRDTVKKRKYQQQVTIFVVGYKNVSDQRLKLLQQVNEFFIENSSTFD-----------EEDLRKGSPD---IDLD----------EVAVKITDSLNTAAELTQRISDLNKEMVEYLTNYAQAKAGNKGRKKLEKALNMAKEDIVTLSEKLMAAQTDLEEKEDKMQQLFKQIEIKTMEATRYKTAAEVAKRNAAGTEALQEELGKKNAELEELKKLVKDMEFEAAQNAYAKEKSDTRLMEAAQANKSDQIQEEIQKAQLSADATKRDLQQLYEKQISDLVKYHQEEIDQLKKQHEAEIRKLTAELEG 384          

HSP 2 Score: 129.798 bits (325), Expect = 2.684e-26
Identity = 150/598 (25.08%), Postives = 266/598 (44.48%), Query Frame = 3
Query: 2361 LTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLI----------------KALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLE-----IRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRT----------------KGILVQLIDSKNLI---------NKTTRFNQNYWEKKHENN---KINYQK----EQQKLSEAAVENKFSSFSQIWNPESSI--DNMENDY----NSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPT---LVDIDQSP--------NNSKPSSRVAT--ATETNAKSRMSRD------LSKHIPLPPITSLE 3920
            + L  HP+V +Y+ +Y+ I+ FK+    +L  L+K  L+    L E+  V      ++ PQIE++ K++  + +    +L  I++      +     V S L+ ++     P+   T+ R   SL+   R  +  I                + L+Q Y    NL      K +    V H Q V    + D   I+ LE     +R  +  + P    Q+   L++   +++FTR DS+RN   +++A+ ++     LYK+AV++M  YV +PA++L  LVRK++H   M+ I   V+++++   + F++L+RME     + QR+ +  D + N RL  A+ LTETL+ +E    IF+IKP  +YR                 K  L  + D ++           N  +   + Y +     +    I  Q+    E + L+ +AV         +W+  SS     +E+ Y    + +   R+L++D NRML+  N +S    +  +     +      +RSYV V  P+   +V  D+ P         +  PS+ +A+   +  + K R++        L    PLPPIT  E
Sbjct: 1197 MALADHPIVNEYMKTYNGIVKFKDDVAQVL--LNKEMLQASQMLSEIEGVLFDRGEKVIPQIEKMTKNVYTLFEEITSLLSSIII------NDRGPVVSSILNVSRD----PTRTMTRERSSESLRGATRDSQRTIGTKMTPTSADSGNRRIQELEQQYDHLQNLFQDETKKHQD--EVNHNQVV-MMGMQDT--IKELEKELSGLRKSLAQS-PG---QYSTQLEHPDSAVMFTRLDSDRNSRAMKSAVNDSKLSPDLYKDAVDQMQAYVSLPAQRLAHLVRKFVHHCRMKEIEETVRQSKSLNNEVFQVLDRMETIQNVRAQRWAEKMDEMGNTRLQLAQLLTETLDAIEQESGIFLIKPHYSYRGRPFGHAGYNGPLSKPFKNYLASIRDRQHSAYVPAPTPASNSRSATYRRYGQNPPAADVPVGIPEQRGPVTEGEMLTGSAVNWVGEVPRPVWSMSSSHVKSALESGYPYQTSLVNTPRMLDLDINRMLIGQNQIST-KVDSSLSDDRLVNAANTNLRSYVTVNRPSAQPIVTKDKRPRSHTGFVDGSVPPSTPMASVPGSAHDKKVRIAETSDIPTVLPSISPLPPITPRE 1772          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Match: A0A1S3K513 (uncharacterized protein LOC106178794 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106178794 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 3.852e-39
Identity = 128/408 (31.37%), Postives = 210/408 (51.47%), Query Frame = 3
Query:   60 LDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQS-------ELAQSQMKLDQ--TKTLDAAQRANAEEI---------------------ALEFQDKYKNLEKVLEAQKIEF----EETKRNLKRQHETEMKQLQADNEN 1181
            LD  D  +  V++KNA + +QR A + KEEL KV+ RV++IYG +E                + E          +E + D+  LE LL     ++KY QQVT+F+VGY  ++  RL+L+Q+VN+FF+ + + FD           EE L +   +   ++ D          E+A  +  ++ +  +LT R+ DLN EM++    YAQ KAGNKGRKK+EKAL  A  + + L+EKL  +   + EK+ ++  L KQ E K+ E  ++K AAE  K+ A  +E L+E+L  K A++ +L+        E AQ+    ++  T+ ++AAQ   +++I                      LE++    +L+++ E Q  +     +E    LK+QHE E+++L A+ E 
Sbjct:   31 LDRGDSPAQLVLDKNARSFAQRMADDTKEELEKVMKRVDHIYGTYE----------------YGEALMEGAGKNNMEYLSDIMELEELLRDTVKKRKYQQQVTIFVVGYKNVSDQRLKLLQQVNEFFIENSSTFD-----------EEDLRKGSPD---IDLD----------EVAVKITDSLNTAAELTQRISDLNKEMVEYLTNYAQAKAGNKGRKKLEKALNMAKEDIVTLSEKLMAAQTDLEEKEDKMQQLFKQIEIKTMEATRYKTAAEVAKRNAAGTEALQEELGKKNAELEELKKLVKDMEFEAAQNAYAKEKSDTRLMEAAQANKSDQIQEEIQKAQLSADATKREETAVVLEWKISKPDLQQLYEKQISDLVKYHQEEIDQLKKQHEAEIRKLTAELEG 398          

HSP 2 Score: 130.183 bits (326), Expect = 2.142e-26
Identity = 150/598 (25.08%), Postives = 266/598 (44.48%), Query Frame = 3
Query: 2361 LTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLI----------------KALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLE-----IRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRT----------------KGILVQLIDSKNLI---------NKTTRFNQNYWEKKHENN---KINYQK----EQQKLSEAAVENKFSSFSQIWNPESSI--DNMENDY----NSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPT---LVDIDQSP--------NNSKPSSRVAT--ATETNAKSRMSRD------LSKHIPLPPITSLE 3920
            + L  HP+V +Y+ +Y+ I+ FK+    +L  L+K  L+    L E+  V      ++ PQIE++ K++  + +    +L  I++      +     V S L+ ++     P+   T+ R   SL+   R  +  I                + L+Q Y    NL      K +    V H Q V    + D   I+ LE     +R  +  + P    Q+   L++   +++FTR DS+RN   +++A+ ++     LYK+AV++M  YV +PA++L  LVRK++H   M+ I   V+++++   + F++L+RME     + QR+ +  D + N RL  A+ LTETL+ +E    IF+IKP  +YR                 K  L  + D ++           N  +   + Y +     +    I  Q+    E + L+ +AV         +W+  SS     +E+ Y    + +   R+L++D NRML+  N +S    +  +     +      +RSYV V  P+   +V  D+ P         +  PS+ +A+   +  + K R++        L    PLPPIT  E
Sbjct: 1211 MALADHPIVNEYMKTYNGIVKFKDDVAQVL--LNKEMLQASQMLSEIEGVLFDRGEKVIPQIEKMTKNVYTLFEEITSLLSSIII------NDRGPVVSSILNVSRD----PTRTMTRERSSESLRGATRDSQRTIGTKMTPTSADSGNRRIQELEQQYDHLQNLFQDETKKHQD--EVNHNQVV-MMGMQDT--IKELEKELSGLRKSLAQS-PG---QYSTQLEHPDSAVMFTRLDSDRNSRAMKSAVNDSKLSPDLYKDAVDQMQAYVSLPAQRLAHLVRKFVHHCRMKEIEETVRQSKSLNNEVFQVLDRMETIQNVRAQRWAEKMDEMGNTRLQLAQLLTETLDAIEQESGIFLIKPHYSYRGRPFGHAGYNGPLSKPFKNYLASIRDRQHSAYVPAPTPASNSRSATYRRYGQNPPAADVPVGIPEQRGPVTEGEMLTGSAVNWVGEVPRPVWSMSSSHVKSALESGYPYQTSLVNTPRMLDLDINRMLIGQNQIST-KVDSSLSDDRLVNAANTNLRSYVTVNRPSAQPIVTKDKRPRSHTGFVDGSVPPSTPMASVPGSAHDKKVRIAETSDIPTVLPSISPLPPITPRE 1786          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Match: V4BLR6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_164724 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 3.527e-38
Identity = 103/317 (32.49%), Postives = 171/317 (53.94%), Query Frame = 3
Query:   54 SDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTK 1004
            S LD  D  +  VI++N+   +QR A E KEEL KV+ RVENI   FE    +  +F S                  +E V D+  L  LL     ++KY  QVTVFIVG+ +++T +L+L+Q+VN+FF++S   F++                          D P   +    ++ + + +++   + L  RLGD+N ++I+    YA+NKA NKGRKK+EKAL+ A ++   L+EKL      + EKD ++  L KQ E K+ E QK+++AAE  KK  +++EKLK+ +  ++ ++  ++  +++ ++ L Q +
Sbjct:    8 SILDRGDAPAQAVIDRNSRALAQRVANETKEELEKVMHRVENICENFEMTNEYYADFGS-----------------NMEFVSDIAELAELLQDQVKKKKYQAQVTVFIVGFQEVSTQKLKLLQQVNEFFLDSIRNFED--------------------------DVPNTPDVDLEDVTHKIDESLDVARGLATRLGDINQDIIEYLLNYAENKAKNKGRKKLEKALQAAKDDLSSLSEKLLGVQSDLEEKDEKMQQLYKQLEIKTLENQKYRSAAEVAKKNLLDAEKLKDDIVMRDEKLRDMRQVISRLEIDLTQAR 281          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Match: A0A267H9Y6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000311g9 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.470e-37
Identity = 177/671 (26.38%), Postives = 309/671 (46.05%), Query Frame = 3
Query:   39 LNQMYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMES-------EKLKEQLSAKEAQI----LQLQSELAQSQMKL----DQTKTLDA------AQRANAEEIALEFQDKYKNL----EKVLEAQKIEFEETKRNLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKISLTENDHRIRSLELS---SEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLK-------VDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKT-NDLLK 1943
            L  + ++LD +D  +  V+++NA     R A ER++EL +VL RV+NI   FE    +G                 NG +++V+ V  +  LE ++   Q+++KYL  VT+F+VGY      RL L+++V++F + +E +FD                          SD   DE     EL  +V+  I S  +L +RLGDL+  +++  A +  +K   K +KK+EK LE    +  +L++KL      + ++D +   + +Q E K+ E+ K +AA E  K AA +        ++  E++ A +A +    L+   E+ + +M++    DQT  L A      AQ  +A       Q++ + L    E  L + K ++     + K++HE E  +LQ                  +++K      D+R  S   S   SEFDEN   +    P+DD+                                     SR PT       +DV+ F      D++  W +VPRSH  GRF QYR L+ A ++   +Q ++   ++ R+I  LKS+  + +  WD ER+ L  +V+  E++ +DA++ A+LA+ ++E +    K        D ++     G++  + D+T+L  +V++++  L+  N LLK
Sbjct:    5 LASLSAELDYVDQAARDVLDRNAREAHDRMANERRDELNRVLRRVDNICSNFENYEAYG-----------------NGKTSVVQFVSGLAELEKIVSDPQAKKKYLDDVTIFVVGYENKCNSRLHLIEQVSEFLLENEALFD--------------------------SDLNSDEPVNFEELNASVESTIASVGELNSRLGDLHRGVVEGLAAHYNSKGAQKQKKKLEKELEALRKDFGELSDKLVHLNSELQDRDLKAQQMARQIENKNAELHKLRAAVEINKAAAAQLAELQAEHDRRGEEIEAVKADLERLKLETGEEMHRDKMEIELLRDQTGKLQAEIDDLKAQLNDAHAQYRAAQNELEELRLNNESRLASMKAKYRRQIASAKKRHEDESAKLQ------------------RRIKEEFYGPDNRSFSAASSRAESEFDENKQTIFV--PDDDERV-----------------------------------SRMPTE------EDVMEFDTEIAFDDDSAWDAVPRSHRRGRFTQYRNLARAKLAQEAEQSKQ---RADRKILQLKSRFNEFKAQWDEERQGLELSVQEAERETEDAKRKAELAVRKLEELYERFKDTQSLSTADSSELHSRIGQL--QVDKTQLETRVEELEHELRVINQLLK 566          

HSP 2 Score: 162.155 bits (409), Expect = 1.944e-36
Identity = 153/578 (26.47%), Postives = 262/578 (45.33%), Query Frame = 3
Query: 2316 LEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLN-LKELSPVSIR--SQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIP-SEKTTKVRE---MRSLQEDCRQMKLLIKALQQSYQSKFNL-----------LNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFK-ILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLS-----EAAVENKF------------SSFSQIWNPESSID----NMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTL-----VDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITS 3914
            +++P   +   D  GL L  HP+V +++ +Y+ I+  K +   +L E D    +EV N L  L   +++   ++RITPQIE++G+++  +      ++E+++L    IE+   ++ +S   PT      P ++  TK +E   M+ ++E  +   L +  L Q  ++KF             L QS+ +L+  LS        R     +V +QN                           S++FT+ D+ERN   ++ A+      E  Y+ AVE M +Y  +PA++L  + R+ LHR  +E++  AV++   FT D  + +L R+E+      +RY  I D LR ERL  A+ L +T + V  +CSIF+I+PVL+ R +  L Q   S  ++ +  R       +         + +QQ+LS     EAA  ++             +S S +WN  SS D        D   +   RLLE+D N++LL  N +S     E   G  +       +R YV +   +L       +DQ    + P +  A   +    +  +   +  +PLPPI S
Sbjct:  615 VDIPFPDDAGGDGPGLHLADHPIVGEFIRTYNHIMKSKTRLSELLSENDSY--KEVANNLANLGQEALKLDRESRITPQIEDLGRNLTFVSDQIFLLVENVIL---SIENLRRQQQQSSSEPTVASAASPEADAATKQKEEELMKQIEE-LKNKYLSVGRLMQEKEAKFQSELAERDVEIRELQQSVAQLQSDLS--------RLRAEQQVDLQN---------------------------SLMFTKLDAERNTKTLKRALASRRIGEAAYETAVEAMEEYASVPARRLLTMARRLLHRRTVEQLQRAVQQGDGFTEDRARLLLARLEDYEAGANRRYDQIMDRLREERLRLARGLVDTFDDVGESCSIFLIRPVLSLRHRDNLEQHYHS--IVEQNRRAAAQRRSEDELQALGRGRLQQQRLSPCPEEEAADGSRRLPDIAGSGVRHDTSLSDVWNIHSSTDMRMLPAGFDRTLLNTPRLLEMDVNKILLGQNRISASLDAETGSGGGA------GLRYYVPLKRRSLDTFSATVLDQ---GAPPPTTPALGKQLGGGNGGASGSATTVPLPPIKS 1140          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Match: A0A267FJM7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000311g1 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 7.251e-37
Identity = 152/577 (26.34%), Postives = 261/577 (45.23%), Query Frame = 3
Query: 2316 LEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLN-LKELSPVSIR--SQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIP-SEKTTKVREMRSLQ--EDCRQMKLLIKALQQSYQSKFNL-----------LNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFK-ILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLS-----EAAVENKF------------SSFSQIWNPESSID----NMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTL-----VDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITS 3914
            +++P   +   D  GL L  HP+V +++ +Y+ I+  K +   +L E D    +EV N L  L   +++   ++RITPQIE++G+++  +      ++E+++L    IE+   ++ +S   PT      P ++  TK +E   ++  E+ +   L +  L Q  ++KF             L QS+ +L+  LS        R     +V +QN                           S++FT+ D+ERN   ++ A+      E  Y+ AVE M +Y  +PA++L  + R+ LHR  +E++  AV++   FT D  + +L R+E+      +RY  I D LR ERL  A+ L +T + V  +CSIF+I+PVL+ R +  L Q   S  ++ +  R       +         + +QQ+LS     EAA  ++             +S S +WN  SS D        D   +   RLLE+D N++LL  N +S     E   G  +       +R YV +   +L       +DQ    + P +  A   +    +  +   +  +PLPPI S
Sbjct:  281 VDIPFPDDAGGDGPGLHLADHPIVGEFIRTYNHIMKSKTRLSELLSENDSY--KEVANNLASLGQEALKLDRESRITPQIEDLGRNLTFVSDQIFLLVENVIL---SIENLRRQQQQSSSEPTVASAASPEADAATKQKEEELIKQIEELKNKYLSVGRLMQEKEAKFQSELAERDVEIRELQQSVAQLQSDLS--------RLRAEQQVDLQN---------------------------SLMFTKLDAERNTKTLKRALASRRIGEAAYETAVEAMEEYASVPARRLLTMARRLLHRRTVEQLQRAVQQGDGFTEDRARLLLARLEDYEAGANRRYDQIMDRLREERLRLARGLVDTFDDVGESCSIFLIRPVLSLRHRDNLEQHYHS--IVEQNRRAAAQRRSEDELQALGRGRLQQQRLSPCPEEEAADGSRRLPDIAGSGVRHDTSLSDVWNIHSSTDMRMLPAGFDRTLLNTPRLLEMDVNKILLGQNRISASLDAETGSGGGA------GLRYYVPLKRRSLDTFSATVLDQ---GAPPPTTPALGKQLGGGNGGASGSATTVPLPPIKS 806          

HSP 2 Score: 77.0258 bits (188), Expect = 2.668e-10
Identity = 53/173 (30.64%), Postives = 96/173 (55.49%), Query Frame = 3
Query: 1449 SRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLK-------VDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKT-NDLLK 1943
            SR PT       +DV+ F      D++  W +VPRSH  GRF QYR L+ A ++   +Q ++   ++ R+I  LKS+  + +  WD ER+ L  +V+  E++ +DA++ A+LA+ ++E +    K        D ++     G++  + D+T+L  +V++++  L+  N LLK
Sbjct:   71 SRMPTE------EDVMEFDTEIAFDDDSAWDAVPRSHRRGRFTQYRNLARAKLAQEAEQSKQ---RADRKILQLKSRFNEFKAQWDEERQGLELSVQEAERETEDAKRKAELAVRKLEELYERFKDTQSLSTADSSELHSRIGQL--QVDKTQLETRVEELEHELRVINQLLK 232          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Nematostella
Match: EDO32182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT0])

HSP 1 Score: 102.449 bits (254), Expect = 5.532e-22
Identity = 132/535 (24.67%), Postives = 228/535 (42.62%), Query Frame = 3
Query: 2364 TLIQHPVVTDYLHSYDQILTFKEQFLAMLE---------ELDKIDLREVLNLKELSPVSIRSQNRITPQIE-EIGKSIEKILQ-MSLQIL--EHILLPRKKIESKTN----------KEVKSRLS-----PTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTAD-TFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKG------ILVQLIDSKN------------------LINK---TTRFNQNYWEKKHENNKINYQKEQQKL----SEAAVENKF-SSFSQIWNPESSIDNMENDYN-SIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPT 3782
             L  HPV ++ L +YD ++ FK+     L+         EL  +D+  V+N ++L+ V  R      P+I   IG+ +EK+   ++ Q L  E    P  + E ++            E + R S     P++ K  I S     ++E   L E    ++  +    + +Q + +     M +++  ++ L  Q  D  A                   +PA            S SI+F+R D+ERN   +  A+ E    +    + V  M+ YV +PAK+L  +VR+Y H  AM+ I   +KK+    +D     L RME     + +R+ D  D + + R   A+ + ET +++E+   IF+IKPVL+Y+ +       +L Q   S N                   +NK   TT   + Y E  + + + + Q E   +    S   V++ +  S  Q+   + + D+  N  N ++   ++LE+D NRM+L   + S  +      G  S   P   VR+YV V  P+
Sbjct:  210 ALRDHPVASESLRTYDSVMRFKDSVTRWLDREGVTEGADELKGLDM-TVINREDLAQVIER-----LPEIRYSIGQVLEKVDDILASQSLRREVTFAPSTRTEGESTFHELTGIRDTAESEERGSSPADEPSRDKSDIQSSYVKLLKEYNDLAEGYESLRRHMDEETKFHQEQTSQNAALMAEMQDTINQLRLQLADAMAGR---------------TGSPA----------RASSSIMFSRLDAERNAKILTRAMNERRIQQENVTDVVNTMSDYVSLPAKRLAHMVRRYSHHRAMQEIEEELKKSSGSLSDNVLHTLERMEVLQNDRARRWGDKMDEMADTRERLAQLMMETFQRLESDTGIFLIKPVLSYQGRSDPPGGYMLSQKKPSINSYRPPANSVGPATPAPTPWLNKSKSTTSVPRMYREMTNSSIQASRQLENGAMDMDVSRPGVDSLYQGSAWQVSRSQVNGDSPSNPGNLALSTPKILELDVNRMMLGQTHASTAF-----IGSVSGDVPSSLVRTYVTVERPS 708          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Nematostella
Match: EDO32181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVS8])

HSP 1 Score: 59.3066 bits (142), Expect = 7.882e-9
Identity = 92/389 (23.65%), Postives = 171/389 (43.96%), Query Frame = 3
Query:   90 VIEKNAITKSQRQATERKEELTKV---LTRVENIYGEFEKPTNF--GREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNF----IEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSEL-AQSQMKLDQTKTLDAAQRANAEEIAL---------EFQDKYKNLEKVLEAQKIE----FEETKRNLKRQHETEMKQLQADNENSF 1187
            +++ N+  ++ R+ATE +EELTK+   +TR  + Y   EK +      E   +     R++ T       +E V D+  L  +L    +++KY Q VTVFIVGY  +   R +L+ ++ +FF  +    D F    IE +   + E+   + K E +                     QQ+ Q    LT +L  L  ++ +      +NK G     +M+K++E                              MKQ      E+Q+ K  A++ KKA+  + +LK +L+AK+   L+LQ  L A ++M+L+  +  D   R    +  +         E++ K ++L++ +E+ + E    ++   + ++ +HE  +  L  D+E + 
Sbjct:   25 ILQANSRAQALRKATETQEELTKIRERVTRTLDTYDLSEKLSAGVDKAEVERITDEFLRQQAT-------LEFVDDMTQLMVILGDPVAKRKYQQHVTVFIVGYENLCGRRAKLLAQLQEFFTQNMADDDKFELEPIEFDLEDVGEQVRGKKKLEKSL--------------------QQSHQDIMSLTEKLLKLQNDLDEN-----ENKLG-----QMQKSME------------------------------MKQV-----EIQRLKVQADNGKKASDLANELKAELAAKD---LELQQHLKAMNEMELNIAQIEDKQDRDFERQKKIKEENQREKEEYEQKIRDLQQYVESVRTEMQQHYDSELKKVRHEHEMTLYYLNQDHETAL 338          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Match: SMESG000071994.1 (SMESG000071994.1)

HSP 1 Score: 2625.51 bits (6804), Expect = 0.000e+0
Identity = 1309/1317 (99.39%), Postives = 1310/1317 (99.47%), Query Frame = 3
Query:   48 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKR------NLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKISLTENDHRIRSLELSSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI 3980
            MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKR      +LKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKISLT NDHRIRSLELSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI
Sbjct:    1 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKISLTGNDHRIRSLELSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI 1317          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Match: SMESG000071994.1 (SMESG000071994.1)

HSP 1 Score: 2616.65 bits (6781), Expect = 0.000e+0
Identity = 1309/1334 (98.13%), Postives = 1310/1334 (98.20%), Query Frame = 3
Query:   48 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKR------NLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKISLTENDHRIRSLEL-----------------SSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI 3980
            MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKR      +LKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKISLT NDHRIRSLEL                 SSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI
Sbjct:    1 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKISLTGNDHRIRSLELELNECKQLTVLKSNTKMSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI 1334          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Match: SMESG000071994.1 (SMESG000071994.1)

HSP 1 Score: 2598.54 bits (6734), Expect = 0.000e+0
Identity = 1287/1311 (98.17%), Postives = 1292/1311 (98.55%), Query Frame = 3
Query:   48 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRNLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKISLTENDHRIRSLELSSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI 3980
            MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRNLKRQHETEMKQLQADNENSFQQ           ++I   E+   I+ L+ SSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI
Sbjct:    1 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRNLKRQHETEMKQLQADNENSFQQ-----------IRI---EHQQEIQQLK-SSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI 1296          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Match: SMESG000071994.1 (SMESG000071994.1)

HSP 1 Score: 2588.91 bits (6709), Expect = 0.000e+0
Identity = 1286/1317 (97.65%), Postives = 1292/1317 (98.10%), Query Frame = 3
Query:   48 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKR------NLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKISLTENDHRIRSLELSSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI 3980
            MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKR      +LKRQHETEMKQLQADNENSFQQ           ++I   E+   I+ L+ SSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI
Sbjct:    1 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQ-----------IRI---EHQQEIQQLK-SSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI 1302          
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Match: SMESG000071994.1 (SMESG000071994.1)

HSP 1 Score: 2574.66 bits (6672), Expect = 0.000e+0
Identity = 1286/1340 (95.97%), Postives = 1292/1340 (96.42%), Query Frame = 3
Query:   48 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKR------NLKRQHETEMKQLQADNENSFXXXXXXXXXXXXXLKISLTENDHRIRSLELSSEFDENAIALHWSEPEDDDNKPXXXXXXXXXXN-----------------------DNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI 3980
            MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKR      +LKRQHETEMKQLQADNENSFQQ           ++I   E+   I+ L+ SSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRN                       DNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI
Sbjct:    1 MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFEKPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQKYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILNEEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDLNIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVISEKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQKIEFEETKRSPIENNDLKRQHETEMKQLQADNENSFQQ-----------IRI---EHQQEIQQLK-SSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNFSDILSSPRGDLSPINNGSNSASDNEKKKSTSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSVPRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQIWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLDGTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPILDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKTGVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAMLEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQILEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDCRQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVHIQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAILENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKKNQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEKVENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENNKINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLEIDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDIDQSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVKINKENHVENTI 1325          
The following BLAST results are available for this feature:
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K4N91.400e-4032.49nuclear mitotic apparatus protein 1 isoform X2 OS=... [more]
A0A1S3K5133.852e-3931.37uncharacterized protein LOC106178794 isoform X1 OS... [more]
V4BLR63.527e-3832.49Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A267H9Y61.470e-3726.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FJM77.251e-3726.34Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO321825.532e-2224.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321817.882e-923.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear mitotic apparatus protein 1 isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071994.10.000e+099.39SMESG000071994.1[more]
SMESG000071994.10.000e+098.13SMESG000071994.1[more]
SMESG000071994.10.000e+098.17SMESG000071994.1[more]
SMESG000071994.10.000e+097.65SMESG000071994.1[more]
SMESG000071994.10.000e+095.97SMESG000071994.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008461 ID=SMED30008461|Name=nuclear mitotic apparatus protein 1 isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=3994bp
CATGACTTAAAATCTGCATAGTTTCGATTCCGCGAGTTTTAAATCAAATG
TACAGCGATTTGGATGAAATAGATTTCGTTTCTCTAAAAGTTATTGAAAA
AAATGCAATTACAAAATCCCAAAGACAAGCCACTGAACGAAAAGAAGAAT
TAACGAAAGTCTTAACTCGGGTTGAAAATATTTACGGTGAATTTGAAAAG
CCTACAAATTTCGGCAGAGAATTTTCGTCATTAAATCCGGCAATTTTCCG
TGAAAAAACCACAGCAAACGGCGATTCGACAATTGTGGAATGCGTGAAAG
ATGTGCCTGCCCTCGAAAACCTTCTCGACAGTTATCAGAGCAGGCAGAAA
TATTTGCAGCAAGTTACCGTGTTCATTGTGGGCTATTCTAAAATGGCCAC
AGATCGTCTGAGATTAATGCAGGAAGTCAATCAGTTTTTCGTAAATAGTG
AAACTATTTTCGACAATTTTATTGAAAGAGAAGATAGAATTCTCAATGAG
GAAGCCTTAGAGCGTGACAAAACCGAAAACGCCTTTGTAAATTCTGACTA
TCCAGAGGATGAAGAATATACGACTTCCGAATTGGCAAACAATGTCCAAC
AGGCCATTCAATCATGTCAGGACTTGACAAATCGCCTTGGAGATTTAAAC
ATTGAAATGATAGATTGTTTTGCTAAATACGCTCAAAACAAAGCCGGAAA
TAAAGGAAGAAAAAAAATGGAAAAAGCGTTGGAAAATGCAACAAATGAAA
CTTTAAAACTTAATGAAAAATTGACTCAATCATTGAAAGTAATATCAGAA
AAAGATTCACGAATAGATAACCTAATGAAACAATGTGAAACTAAATCAAA
AGAAGTACAAAAATTCAAGGCTGCCGCTGAATCCATAAAGAAAGCTGCTA
TGGAATCTGAAAAGTTGAAAGAACAGTTAAGTGCCAAAGAAGCCCAAATA
TTACAATTGCAATCTGAATTAGCTCAATCGCAGATGAAATTAGACCAAAC
TAAAACTCTAGATGCAGCTCAAAGAGCGAACGCCGAAGAAATAGCTCTCG
AATTTCAGGATAAATATAAAAATCTTGAAAAGGTTTTGGAAGCTCAGAAA
ATAGAATTTGAAGAAACGAAAAGAAATTTGAAACGGCAACACGAAACTGA
AATGAAGCAACTTCAGGCAGACAACGAGAACAGCTTCCAGCAAATTAGAA
TTGAACACCAACAGGAAATACAGCAATTGAAGATCAGTTTGACGGAAAAT
GACCATCGTATTAGATCATTAGAATTGTCTAGTGAATTTGATGAGAACGC
AATTGCTTTACATTGGAGTGAGCCAGAAGATGATGACAATAAACCAAGCC
GGCGGTCACTCAGCAGCCTATCTAGAAATGACAACGAAAAGAAAAAATCA
ACTAGTAATAGTGGATCACCTTCAAGATTTGGAAGTGGAAAAAATGGGTC
TCGTCAGCCCACTACTTCCGGTCGTTCTTCAGGCAAGGATGTTTTGACAT
TCAGTGATGCTCCTGATCTTGACAATGAAGAATTCTGGTCAAGCGTTCCT
CGCAGTCATTTGCTGGGCCGTTTTTTTCAATACAGACAATTGAGCATGGC
TTCAATGTCGAATTTATTAGACCAACATGAAAAGCTTCAAGGCAAAAGTA
CTCGTCAAATATATTCATTGAAATCGCAACACCAACAGCACCAACAAATA
TGGGATAGAGAGCGAGAATTGTTAATTGAAGCTGTGCGTAACACAGAAAA
AGACAGGAAAGATGCACAAAAATATGCCGACTTAGCCATGGAAGAAATGG
AAAATATTGTCACTTCATTGAAGGTGGATAAAAATCAAAAATTAGATGGG
ACTGGGGAAATTTTGGAAGAAACTGATGAAACGAAGTTGATTGAAAAAGT
GGATCAAATAAAAGAATACCTGAAAACAAATGATTTACTCAAAGATCCTA
TTGGTAAAATGATTGGAGATTTACGGAAAATGTGCCAATTATTTCAAGAG
CGATCTCGAATCTCTGTACCCAAATATGTTACAATGGTCGATTTGCGAAA
AAGTGAGGAGCTTAAGCAAAATCTCATGGCTAATGCAACTCAGACGGAAG
ATGAAAACTATAGGTTAATCTCAAGAATTGGATCACATGGACCTATTTTG
GACGAGGAGAAAGATATAATGTTTCCAGAAGAAATTGATAGTGATAAGAG
CACTCGAAGTGTTGCTATATCTGCCAGTCCAACCTTAGTGAGAATAGCTT
TTAATGATTACCGGAAACTGAGCAATAATTCACCGATTGAAAAAACAGGA
GTTTCCGCTCAAGATCTCGAAGTGCCGAGTGAAATGGAAGATGTTCAAGA
TCGGACCGGGTTGACTTTGATACAACATCCAGTCGTAACGGACTATTTAC
ACAGCTACGATCAAATATTAACGTTCAAGGAACAGTTTTTAGCTATGTTA
GAAGAACTGGACAAAATTGATTTGAGAGAAGTTCTCAATTTGAAGGAACT
GAGTCCAGTTTCAATCCGGTCTCAAAATAGAATAACTCCTCAAATTGAAG
AGATTGGTAAATCCATTGAAAAAATTTTGCAAATGTCACTGCAAATTCTC
GAGCATATTTTACTACCACGAAAGAAGATAGAATCGAAAACAAACAAAGA
GGTAAAATCTCGACTGTCACCCACAAAAGGAAAGCAACCAATACCATCAG
AGAAGACGACAAAAGTTAGAGAAATGAGATCCTTACAAGAAGATTGCCGA
CAAATGAAATTATTGATAAAAGCACTTCAACAATCATATCAATCGAAGTT
CAATTTACTCAACCAATCAATGTTGAAATTAAAACAAATGTTATCCGTTT
TACATAAACAGTGTGTTGATAGATTCGCCGTCCATGACGAAGTTCATATT
CAAAATCTAGAAATTCGTACTGACGTGACAAACACAAACCCTGCTGACAA
CCTTCAACACCAACCTCCTCTTGATTACGATTCAATATCTATTCTCTTTA
CAAGGCGAGATTCTGAAAGAAATATTGGAAGGATTCAAAACGCAATTTTG
GAAAATGGGTTTCCTGAGACTCTTTACAAAGAAGCAGTCGAAAAAATGGC
GCAATACGTCGAAATTCCCGCTAAACAGTTGTACATTTTAGTGAGAAAAT
ATTTACACAGAGATGCTATGGAAAGGATTTCATATGCGGTGAAGAAAAAT
CAAAATTTTACTGCAGATACGTTTAAAATTCTTAATCGAATGGAAAATAC
AACTGAGAAGAAGCAACAGAGATATAAGGACATACAAGACCATTTACGAA
ATGAACGGCTTATTCGAGCAAAAGCTCTCACAGAAACGTTAGAAAAAGTC
GAAAATACATGTTCTATTTTCATGATAAAACCTGTTCTCAATTACAGGAC
AAAGGGAATTCTCGTACAACTTATAGACTCAAAAAATCTAATAAATAAAA
CAACTCGATTTAATCAGAATTATTGGGAAAAGAAGCACGAAAATAACAAA
ATAAACTATCAAAAAGAACAACAAAAGTTATCTGAAGCAGCAGTAGAAAA
TAAATTTTCATCATTTTCACAAATTTGGAATCCCGAAAGTTCCATTGATA
ATATGGAAAATGATTATAATTCCATTTTTGAATCTCGCCTGCTGGAAATT
GACACTAATAGAATGCTTCTTCCATTGAATAATGTCAGCATTCCTTATAC
AAATGAAGGTATTTATGGCAAGGAATCAATTCTTCCTCCGCAAATCGCAG
TTAGATCTTATGTTGCTGTGGCACATCCTACTCTTGTGGATATAGACCAA
AGTCCCAACAATTCAAAGCCGTCAAGCAGAGTTGCGACTGCAACAGAAAC
GAATGCTAAATCCAGAATGTCAAGGGATTTGAGCAAACATATTCCTCTTC
CTCCGATTACTTCACTAGAAATAAACAACCACGAAGTTGACGTCAAAATT
AACAAAGAAAATCATGTTGAAAATACAATCTGATTGATGAAATT
back to top

protein sequence of SMED30008461-orf-1

>SMED30008461-orf-1 ID=SMED30008461-orf-1|Name=SMED30008461-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1312bp
MYSDLDEIDFVSLKVIEKNAITKSQRQATERKEELTKVLTRVENIYGEFE
KPTNFGREFSSLNPAIFREKTTANGDSTIVECVKDVPALENLLDSYQSRQ
KYLQQVTVFIVGYSKMATDRLRLMQEVNQFFVNSETIFDNFIEREDRILN
EEALERDKTENAFVNSDYPEDEEYTTSELANNVQQAIQSCQDLTNRLGDL
NIEMIDCFAKYAQNKAGNKGRKKMEKALENATNETLKLNEKLTQSLKVIS
EKDSRIDNLMKQCETKSKEVQKFKAAAESIKKAAMESEKLKEQLSAKEAQ
ILQLQSELAQSQMKLDQTKTLDAAQRANAEEIALEFQDKYKNLEKVLEAQ
KIEFEETKRNLKRQHETEMKQLQADNENSFQQIRIEHQQEIQQLKISLTE
NDHRIRSLELSSEFDENAIALHWSEPEDDDNKPSRRSLSSLSRNDNEKKK
STSNSGSPSRFGSGKNGSRQPTTSGRSSGKDVLTFSDAPDLDNEEFWSSV
PRSHLLGRFFQYRQLSMASMSNLLDQHEKLQGKSTRQIYSLKSQHQQHQQ
IWDRERELLIEAVRNTEKDRKDAQKYADLAMEEMENIVTSLKVDKNQKLD
GTGEILEETDETKLIEKVDQIKEYLKTNDLLKDPIGKMIGDLRKMCQLFQ
ERSRISVPKYVTMVDLRKSEELKQNLMANATQTEDENYRLISRIGSHGPI
LDEEKDIMFPEEIDSDKSTRSVAISASPTLVRIAFNDYRKLSNNSPIEKT
GVSAQDLEVPSEMEDVQDRTGLTLIQHPVVTDYLHSYDQILTFKEQFLAM
LEELDKIDLREVLNLKELSPVSIRSQNRITPQIEEIGKSIEKILQMSLQI
LEHILLPRKKIESKTNKEVKSRLSPTKGKQPIPSEKTTKVREMRSLQEDC
RQMKLLIKALQQSYQSKFNLLNQSMLKLKQMLSVLHKQCVDRFAVHDEVH
IQNLEIRTDVTNTNPADNLQHQPPLDYDSISILFTRRDSERNIGRIQNAI
LENGFPETLYKEAVEKMAQYVEIPAKQLYILVRKYLHRDAMERISYAVKK
NQNFTADTFKILNRMENTTEKKQQRYKDIQDHLRNERLIRAKALTETLEK
VENTCSIFMIKPVLNYRTKGILVQLIDSKNLINKTTRFNQNYWEKKHENN
KINYQKEQQKLSEAAVENKFSSFSQIWNPESSIDNMENDYNSIFESRLLE
IDTNRMLLPLNNVSIPYTNEGIYGKESILPPQIAVRSYVAVAHPTLVDID
QSPNNSKPSSRVATATETNAKSRMSRDLSKHIPLPPITSLEINNHEVDVK
INKENHVENTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 183..203
NoneNo IPR availableCOILSCoilCoilcoord: 256..321
NoneNo IPR availableCOILSCoilCoilcoord: 1062..1082
NoneNo IPR availableCOILSCoilCoilcoord: 221..241
NoneNo IPR availableCOILSCoilCoilcoord: 326..382
NoneNo IPR availableCOILSCoilCoilcoord: 1144..1164
NoneNo IPR availableCOILSCoilCoilcoord: 666..686
NoneNo IPR availableCOILSCoilCoilcoord: 893..913
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1252..1272
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1252..1277
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 424..450
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 424..482
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 865..890
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 451..481
NoneNo IPR availablePANTHERPTHR37915FAMILY NOT NAMEDcoord: 78..1289