Type I inositol-1,4,5-trisphosphate 5-phosphatase

Overview
NameType I inositol-1,4,5-trisphosphate 5-phosphatase
Smed IDSMED30008456
Length (bp)2152
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Type I inositol-1,4,5-trisphosphate 5-phosphatase (SMED30008456) t-SNE clustered cells

Violin plots show distribution of expression levels for Type I inositol-1,4,5-trisphosphate 5-phosphatase (SMED30008456) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Type I inositol-1,4,5-trisphosphate 5-phosphatase (SMED30008456) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Type I inositol-1,4,5-trisphosphate 5-phosphatase (SMED30008456) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30008456

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30008456SMESG000074184.1 SMESG000019975.1 dd_Smed_v4_266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30008456SMESG000074184.1 SMESG000019975.1 dd_Smed_v4_266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30008456SMESG000074184.1 dd_Smed_v4_7958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30008456SMESG000074184.1 dd_Smed_v6_7958_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30008456SMESG000074184.1 SMED30008456smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30008456SMESG000074184.1 SMED30008456smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30008456SMESG000074184.1 SMESG000019975.1 dd_Smed_v6_266_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30008456SMESG000074184.1 SMESG000019975.1 dd_Smed_v6_266_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30008456SMESG000074184.1 SMESG000019975.1 dd_Smed_v4_266_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Human
Match: INPP5A (inositol polyphosphate-5-phosphatase A [Source:HGNC Symbol;Acc:HGNC:6076])

HSP 1 Score: 316.235 bits (809), Expect = 1.639e-100
Identity = 179/418 (42.82%), Postives = 251/418 (60.05%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKI-LEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAK-FLIRDNLEN--VKYHMIGLGSCVGDHKPIYLSFCINPSATQ 1335
            LL++AN+GS FD P+ +  +W+      +  ++P F A+HCQE GGKNYE SM +VD FVK LL   A+  YN+AR+YLDE++  +E FTALGSFYF+HES+ N+ Q+DF A ++  V G+E++S  +E      KEKFP ++FPE KWSRKGFI TRW I D   D VNIHLFHD  NL      PS YS  R +AL Y L+++     EK+  F+FGDFNFRL ++ +++ L   + T++ V         E+ K+++R+                   D D K+ L++ +K+FD   FN       E+FR+        FD+E   F   L+E  +SFPPSYP++E+      YM TRCP+WCDRI ++P AK  ++R   E   V Y  IG   C+GDHKP++L+F I P A +
Sbjct:   13 LLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLC-TKATMQTV---RAADTNEVVKLIFRES------------------DNDRKVMLQLEKKLFDY--FN------QEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGK 400          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Human
Match: INPP5A (inositol polyphosphate-5-phosphatase A [Source:HGNC Symbol;Acc:HGNC:6076])

HSP 1 Score: 290.041 bits (741), Expect = 1.007e-90
Identity = 163/379 (43.01%), Postives = 229/379 (60.42%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKI-LEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLI 1227
            LL++AN+GS FD P+ +  +W+      +  ++P F A+HCQE GGKNYE SM +VD FVK LL   A+  YN+AR+YLDE++  +E FTALGSFYF+HES+ N+ Q+DF A ++  V G+E++S  +E      KEKFP ++FPE KWSRKGFI TRW I D   D VNIHLFHD  NL      PS YS  R +AL Y L+++     EK+  F+FGDFNFRL ++ +++ L   + T++ V         E+ K+++R+                   D D K+ L++ +K+FD   FN       E+FR+        FD+E   F   L+E  +SFPPSYP++E+      YM TRCP+WCDRI ++P AK L+
Sbjct:   13 LLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLC-TKATMQTV---RAADTNEVVKLIFRES------------------DNDRKVMLQLEKKLFDY--FN------QEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELV 361          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Human
Match: INPP5A (inositol polyphosphate-5-phosphatase A [Source:HGNC Symbol;Acc:HGNC:6076])

HSP 1 Score: 209.92 bits (533), Expect = 6.704e-62
Identity = 108/214 (50.47%), Postives = 143/214 (66.82%), Query Frame = 1
Query:  178 WINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQL 819
            W+      +  ++P F A+HCQE GGKNYE SM +VD FVK LL   A+  YN+AR+YLDE++  +E FTALGSFYF+HES+ N+ Q+DF A ++  V G+E++S  +E      KEKFP ++FPE KWSRKGFI TRW I D   D VNIHLFHD  NL      PS YS  R +AL Y L+++     EK+  F+FGDFNFRL ++ +++ L
Sbjct:    5 WLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVELL 218          

HSP 2 Score: 68.5514 bits (166), Expect = 5.270e-12
Identity = 29/57 (50.88%), Postives = 39/57 (68.42%), Query Frame = 1
Query: 1057 FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLI 1227
            FD+E   F   L+E  +SFPPSYP++E+      YM TRCP+WCDRI ++P AK L+
Sbjct:  220 FDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELV 276          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Human
Match: INPP5A (inositol polyphosphate-5-phosphatase A [Source:HGNC Symbol;Acc:HGNC:6076])

HSP 1 Score: 106.301 bits (264), Expect = 2.408e-26
Identity = 62/119 (52.10%), Postives = 78/119 (65.55%), Query Frame = 1
Query:  370 VEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLE 726
            + E + ALGSFYF+HES+ N+ Q+DF A ++  V G+E++S  +E      KEKFP ++FPE KWSRKGFI TRW I D   D VNIHLFHD  NL      PS YS  R +AL Y L+
Sbjct:   20 LREFYQALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLD 138          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Human
Match: INPP5A (inositol polyphosphate-5-phosphatase A [Source:HGNC Symbol;Acc:HGNC:6076])

HSP 1 Score: 87.8113 bits (216), Expect = 3.050e-20
Identity = 40/78 (51.28%), Postives = 52/78 (66.67%), Query Frame = 1
Query: 1105 VSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLI-RDNLEN--VKYHMIGLGSCVGDHKPIYLSFCINPSA 1329
            +SFPPSYP++E+      YM TRCP+WCDRI ++P AK L+ R   E   V Y  IG   C+GDHKP++L+F I P A
Sbjct:    3 ISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGA 80          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Celegans
Match: ipp-5 (Probable type I inositol 1,4,5-trisphosphate 5-phosphatase [Source:UniProtKB/Swiss-Prot;Acc:Q17848])

HSP 1 Score: 221.09 bits (562), Expect = 6.628e-65
Identity = 148/414 (35.75%), Postives = 226/414 (54.59%), Query Frame = 1
Query:  115 FLLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESV-SNVKQWDFTANEFIPVEG-RELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIP-LFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQ----GKNEEIRKIVYRKLESPIDKMTSFNDKV-----SNGFDKDDKILEIGRKIFDIPEFN-SCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCI 1317
            +LLI+AN+GS F+   R+  SWI  V   ++  +P FF IH QE GGK + E  Q V   +  L    AL  ++  R Y+D D+   E +TALG+  FI  S+ SNV Q++F   ++  +   +E+ +  +E+  +  K KFP +F+P  KW RKG++ TRWKI + V DFVN HLFHD  NLA I ++P  YS  R RAL + L +++   +   P LF+FGD NFRL ++  + +L E RT    V  + Q        +      + +  P + +      +     S+  D  + +L I +K FD   FN    ++    +R+ D+E    FQ + E  ++FPP+YP++E+  N    MKTR P+WCDR+ +N  A  L+ +     +Y   G+ +C GDHKP+ L+F I
Sbjct:    4 YLLITANVGSLFEPDARLHTSWIKTVADQVESVDPSFFVIHLQETGGKKFTECSQQVPIIINRL--STALPKFDLLRAYVDIDYEAIE-YTALGALCFIKRSLWSNVSQFNFHTKKYEQLTSPKEVVTHGLENYPYVVKHKFPKDFWPSIKWGRKGYMQTRWKIENKVFDFVNAHLFHDESNLALIHENPQLYSQNRKRALDFVLAELSSKENGCTPLLFVFGDLNFRLDSRSFLNRLTE-RTAQHPVADQEQMGSLADGLQASAANLQVITHPSENLRRTVSAIEFRRESDSDDSQNCVLRIEKKKFDY--FNHKKLLDDWRSYRDDDKE-TENFQSMFEMHINFPPTYPWSEDPENSETLMKTRAPAWCDRVLMNKNAYSLVEEG--EPQYRSFGMETCTGDHKPVMLTFNI 408          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Celegans
Match: ipp-5 (Probable type I inositol 1,4,5-trisphosphate 5-phosphatase [Source:UniProtKB/Swiss-Prot;Acc:Q17848])

HSP 1 Score: 221.09 bits (562), Expect = 8.807e-65
Identity = 152/415 (36.63%), Postives = 226/415 (54.46%), Query Frame = 1
Query:  115 FLLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESV-SNVKQWDFTANEFIPVEG-RELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIP-LFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQ-GKNEEIRKIVYRKLESPIDKMTSFNDKVS-----NGFDKDDK----ILEIGRKIFDIPEFN-SCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCI 1317
            +LLI+AN+GS F+   R+  SWI  V   ++  +P FF IH QE GGK + E  Q V   +  L    AL  ++  R Y+D D+   E +TALG+  FI  S+ SNV Q++F   ++  +   +E+ +  +E+  +  K KFP +F+P  KW RKG++ TRWKI + V DFVN HLFHD  NLA I ++P  YS  R RAL + L +++   +   P LF+FGD NFRL ++  + +L E RT    V  + Q G   +  +     L+       +    VS        D DD     +L I +K FD   FN    ++    +R+ D+E    FQ + E  ++FPP+YP++E+  N    MKTR P+WCDR+ +N  A  L+ +     +Y   G+ +C GDHKP+ L+F I
Sbjct:    4 YLLITANVGSLFEPDARLHTSWIKTVADQVESVDPSFFVIHLQETGGKKFTECSQQVPIIINRL--STALPKFDLLRAYVDIDYEAIE-YTALGALCFIKRSLWSNVSQFNFHTKKYEQLTSPKEVVTHGLENYPYVVKHKFPKDFWPSIKWGRKGYMQTRWKIENKVFDFVNAHLFHDESNLALIHENPQLYSQNRKRALDFVLAELSSKENGCTPLLFVFGDLNFRLDSRSFLNRLTE-RTAQHPVADQEQMGSLADGLQASAANLQVITHPSENLRRTVSAIEFRRESDSDDSQNSCVLRIEKKKFDY--FNHKKLLDDWRSYRDDDKE-TENFQSMFEMHINFPPTYPWSEDPENSETLMKTRAPAWCDRVLMNKNAYSLVEEG--EPQYRSFGMETCTGDHKPVMLTFNI 409          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Celegans
Match: C01B10.3 (pep chromosome:WBcel235:IV:6619468:6621352:-1 gene:WBGene00015278.1 transcript:C01B10.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C01B10.3)

HSP 1 Score: 53.5286 bits (127), Expect = 2.930e-7
Identity = 57/263 (21.67%), Postives = 107/263 (40.68%), Query Frame = 1
Query:  568 RKGFIHTRWKILDVVIDFVNIHL----FHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCF--VEKSEMFRNFDEEP--IHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDN---LENVKYHMIGLGSCVGDHKPIYL--SFCI 1317
            R GF+  R++I    + FVN++L    F D+  +A      +  ++ R + ++  L+++ +       + + G FN +L    L+  L + +  ++ V KK +  N E  + V R          +                      FD+   +  F  + + +M + ++ E   I F   L E    F PS  +   ++    + +T CP+W DRI  N     L + +      + Y ++     VG HKP+ L  S C+
Sbjct:  161 RTGFLLARFRIHGKELTFVNLNLHSVPFEDVNEIATKNSSITKAASKREQQIEMLLKELDEEGLRNDAILVAGSFNSQLHETDLLNYLAKTQL-VQTVAKKDEDGNVESIEHVDRHGRRTTTVERT---------------------RFDLHSIHDWFFRLGRGQMVKRYNGELANIAFKGNLKEETCFFQPSRHYELNDSGKEEFQRTLCPAWSDRILYNDRMNELFKHDSFCASGLYYGLVAEEKFVGPHKPVALHASICL 401          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Fly
Match: 5PtaseI (gene:FBgn0259178 transcript:FBtr0474081)

HSP 1 Score: 284.648 bits (727), Expect = 1.113e-87
Identity = 167/420 (39.76%), Postives = 235/420 (55.95%), Query Frame = 1
Query:  103 SINDFLLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEF----IPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKV-TKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTT--IENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCINPSATQMD 1341
            S  D  L++AN+GS F+ P+R+   W++     I   +P F A+H QEVGGK YE+SM+YV  F++ L     +  +    I++DEDF   E FTALGS YF+H+ V+++K W+F  + +      V+ + ++S NIE I  K K KFP  FFPE KWSRKGF+ TRW+I   VID VNIHLFHD  NLA     PS Y   R RAL +T+E+      +  +P F+FGDFNFR  T+ ++K+L E  T   ++NV      KNE                    NDK+       + +L +G+K F   +    F  K +  + FD E       L E+P+ F PSYPF E+   P  YM TRCP+WCDRI ++P+   +I+ +  +  Y MIG   C+GDHKP+YL+  + P+    D
Sbjct:    9 SSTDVFLVTANVGSLFEDPERLLQLWLSEFLAKIAVAQPRFLALHLQEVGGKTYEKSMEYVQEFIRCLCDAPEMGDFTCVHIFMDEDFKSAEHFTALGSLYFVHKDVASLKIWNFLTHSWEESLQDVKDKHIYSGNIETIATKEKSKFPQHFFPECKWSRKGFMRTRWEINGTVIDLVNIHLFHDASNLAACENFPSVYCKTRRRALVHTIERFHLDEQNGTVPFFLFGDFNFRCDTEGVVKELTENLTPHRVQNV------KNE--------------------NDKIHYRNSTGNNVLTVGKKEFSHADHQLKF--KEDWLKKFDRELEPLKDVLVEYPIKFVPSYPFEEDPEMPTDYMSTRCPAWCDRILMSPQVNEIIQSD--DWTYGMIGEAVCMGDHKPVYLTVRLKPNKGPAD 398          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Fly
Match: 5PtaseI (gene:FBgn0259178 transcript:FBtr0299661)

HSP 1 Score: 286.574 bits (732), Expect = 3.408e-86
Identity = 183/494 (37.04%), Postives = 263/494 (53.24%), Query Frame = 1
Query:  103 SINDFLLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEF----IPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKV-TKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTT--IENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCINPSATQMDYEVKDEESINDNTFKSNETNAANDTEPVNDMFTD---ITKLST--------EEINVSPQLITNSSSNRRLFNSV 1530
            S  D  L++AN+GS F+ P+R+   W++     I   +P F A+H QEVGGK YE+SM+YV  F++ L     +  +    I++DEDF   E FTALGS YF+H+ V+++K W+F  + +      V+ + ++S NIE I  K K KFP  FFPE KWSRKGF+ TRW+I   VID VNIHLFHD  NLA     PS Y   R RAL +T+E+      +  +P F+FGDFNFR  T+ ++K+L E  T   ++NV      KNE                    NDK+       + +L +G+K F   +    F  K +  + FD E       L E+P+ F PSYPF E+   P  YM TRCP+WCDRI ++P+   +I+ +  +  Y MIG   C+GDHKP+YL+  + P               N  T++S + N  N     N++ T      KL          E+I  S +LI ++ + R ++NS+
Sbjct:    9 SSTDVFLVTANVGSLFEDPERLLQLWLSEFLAKIAVAQPRFLALHLQEVGGKTYEKSMEYVQEFIRCLCDAPEMGDFTCVHIFMDEDFKSAEHFTALGSLYFVHKDVASLKIWNFLTHSWEESLQDVKDKHIYSGNIETIATKEKSKFPQHFFPECKWSRKGFMRTRWEINGTVIDLVNIHLFHDASNLAACENFPSVYCKTRRRALVHTIERFHLDEQNGTVPFFLFGDFNFRCDTEGVVKELTENLTPHRVQNV------KNE--------------------NDKIHYRNSTGNNVLTVGKKEFSHADHQLKF--KEDWLKKFDRELEPLKDVLVEYPIKFVPSYPFEEDPEMPTDYMSTRCPAWCDRILMSPQVNEIIQSD--DWTYGMIGEAVCMGDHKPVYLTVRLKP---------------NKGTYRSCDCNYTNTYAKPNNISTSPLPAVKLKYCPYSNKLFEDIATSSKLIVDTEA-RNMYNSL 456          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Fly
Match: 5PtaseI (gene:FBgn0259178 transcript:FBtr0299660)

HSP 1 Score: 270.011 bits (689), Expect = 2.785e-83
Identity = 162/404 (40.10%), Postives = 226/404 (55.94%), Query Frame = 1
Query:  103 SINDFLLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEF----IPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKV-TKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTT--IENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHK 1293
            S  D  L++AN+GS F+ P+R+   W++     I   +P F A+H QEVGGK YE+SM+YV  F++ L     +  +    I++DEDF   E FTALGS YF+H+ V+++K W+F  + +      V+ + ++S NIE I  K K KFP  FFPE KWSRKGF+ TRW+I   VID VNIHLFHD  NLA     PS Y   R RAL +T+E+      +  +P F+FGDFNFR  T+ ++K+L E  T   ++NV      KNE                    NDK+       + +L +G+K F   +    F  K +  + FD E       L E+P+ F PSYPF E+   P  YM TRCP+WCDRI ++P+   +I+ +  +  Y MIG   C+GDHK
Sbjct:    9 SSTDVFLVTANVGSLFEDPERLLQLWLSEFLAKIAVAQPRFLALHLQEVGGKTYEKSMEYVQEFIRCLCDAPEMGDFTCVHIFMDEDFKSAEHFTALGSLYFVHKDVASLKIWNFLTHSWEESLQDVKDKHIYSGNIETIATKEKSKFPQHFFPECKWSRKGFMRTRWEINGTVIDLVNIHLFHDASNLAACENFPSVYCKTRRRALVHTIERFHLDEQNGTVPFFLFGDFNFRCDTEGVVKELTENLTPHRVQNV------KNE--------------------NDKIHYRNSTGNNVLTVGKKEFSHADHQLKF--KEDWLKKFDRELEPLKDVLVEYPIKFVPSYPFEEDPEMPTDYMSTRCPAWCDRILMSPQVNEIIQSD--DWTYGMIGEAVCMGDHK 382          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Zebrafish
Match: inpp5l (inositol polyphosphate-5-phosphatase L [Source:ZFIN;Acc:ZDB-GENE-051127-29])

HSP 1 Score: 255.373 bits (651), Expect = 1.214e-77
Identity = 153/413 (37.05%), Postives = 227/413 (54.96%), Query Frame = 1
Query:  112 DFLLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKI-LEIGRKIFDIPEFNSCFVE-KSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLE-----NVKYHMIGLGSCVGDHKPIYLSFCINPSA 1329
            D LL++AN+GS FD    +   W+     T+  Y+P F A+H QEVGGK+Y  +M + +NF   +     +  +++  +Y+D  F   + FTALGS YFIH+S+ N++Q+DF   +F  V G   +  +++ +T   KEKFP  F+P+ KWSRKG++ TRW I +  +D VN+HLFHD  NL      PS YSA R +AL+Y + ++T N    +P F+FGDFNFRL T  L++ L      I+ V K   G + E+ KI+  +                   D D K+ L I  K+F      + F E   +    +D+E   F   + E  + FPPSYP++E+   P  YM TRCP+WCDRI ++  A+ +I    E     +V Y  +G   C+GDHKP++L F +   A
Sbjct:    6 DILLVTANVGSLFDNVGEIEGDWLREFFTTVHMYKPRFVALHFQEVGGKDYMVNMGHAENFFWTIESSSEMADFDRVCVYVDSHFKAVDNFTALGSMYFIHKSLKNIQQYDFNVKDFKVVSGHNKYVGSLDGVTTMEKEKFPKNFWPDFKWSRKGYMRTRWIIHNQGLDLVNVHLFHDASNLIACNSSPSVYSANRKKALRYVINRITDNTYSPLPFFLFGDFNFRLDTLSLVQNL-SLSAEIQTVKK---GSSNEVEKIICEEK------------------DNDHKVLLHIETKLFAYLH-QAVFRENNGKELLKYDKEISAFHDVITEEDIPFPPSYPYSEDYTKPTQYMNTRCPAWCDRILMSHSARDIIHRREEGEGESSVVYDTLGSNICMGDHKPVFLFFPLKTYA 395          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Xenopus
Match: inpp5a.1 (inositol polyphosphate-5-phosphatase A [Source:NCBI gene;Acc:548959])

HSP 1 Score: 304.294 bits (778), Expect = 5.750e-96
Identity = 180/422 (42.65%), Postives = 254/422 (60.19%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLI--RDNLEN-VKYHMIGLGSCVGDHKPIYLSFCINPSATQMDYEV 1350
            LL++AN+G+ FD  + +  +W+     T+   +P F ++HCQEVGGKNYE SM +VD  VK LL   A+  +N+AR+YLDE++  +E FTALGSFYF+HES+ NV Q+DF A ++  V G+E++S  +E      KEKFP EFFPE+K SRKGFI TRW I D   D VNIHLFHD  N+      PS YS  R +AL Y L  VT +  EK+P F+FGDFNFRL  + +++ L   +TT++ V+         + K+V+R+ E         ND+          +L+I +K+F+   FN       E+FR+        FD+E   F   L+E  ++FPPSYP++E+ +    YM TRCP+WCDRI ++  AK L+   +N E  V Y  IG   C+GDHKP++LSF +   A + +  V
Sbjct:   13 LLVTANVGTLFDDTENLQKNWLREFYQTVHAQKPQFLSLHCQEVGGKNYEASMAHVDKLVKDLLSSDAMKEFNRARVYLDENYKSQENFTALGSFYFLHESLKNVYQYDFKAKKYRKVTGKEIYSDTLESTPMLEKEKFPQEFFPESKSSRKGFIRTRWCITDCAFDLVNIHLFHDASNVIAWESSPSIYSGIRQKALSYVLNSVTDHRFEKVPFFVFGDFNFRLDLKSVVETLC-AKTTMQTVH---AADTNAVDKLVFRESE---------NDR--------KVVLQIEKKLFEY--FN------QEVFRDNNGTALLEFDKELSVFKDRLYELDITFPPSYPYSEDSSQGKQYMNTRCPAWCDRILMSHSAKELLLKSENDERIVLYDHIGPNICMGDHKPVFLSFRVATGAGKTNAHV 405          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Xenopus
Match: inpp5a.1 (inositol polyphosphate-5-phosphatase A [Source:NCBI gene;Acc:548959])

HSP 1 Score: 294.278 bits (752), Expect = 8.679e-92
Identity = 180/442 (40.72%), Postives = 255/442 (57.69%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEK--------------------VTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLI--RDNLEN-VKYHMIGLGSCVGDHKPIYLSFCINPSATQMDYEV 1350
            LL++AN+G+ FD  + +  +W+     T+   +P F ++HCQEVGGKNYE SM +VD  VK LL   A+  +N+AR+YLDE++  +E FTALGSFYF+HES+ NV Q+DF A ++  V G+E++S  +E      KEKFP EFFPE+K SRKGFI TRW I D   D VNIHLFHD  N+      PS YS  R +AL Y L +                    VT +  EK+P F+FGDFNFRL  + +++ L   +TT++ V+         + K+V+R+ E         ND+          +L+I +K+F+   FN       E+FR+        FD+E   F   L+E  ++FPPSYP++E+ +    YM TRCP+WCDRI ++  AK L+   +N E  V Y  IG   C+GDHKP++LSF +   A + +  V
Sbjct:   13 LLVTANVGTLFDDTENLQKNWLREFYQTVHAQKPQFLSLHCQEVGGKNYEASMAHVDKLVKDLLSSDAMKEFNRARVYLDENYKSQENFTALGSFYFLHESLKNVYQYDFKAKKYRKVTGKEIYSDTLESTPMLEKEKFPQEFFPESKSSRKGFIRTRWCITDCAFDLVNIHLFHDASNVIAWESSPSIYSGIRQKALSYVLNRFSGMQRDMKSQNPSLQHGTSVTDHRFEKVPFFVFGDFNFRLDLKSVVETLC-AKTTMQTVHA---ADTNAVDKLVFRESE---------NDR--------KVVLQIEKKLFEY--FN------QEVFRDNNGTALLEFDKELSVFKDRLYELDITFPPSYPYSEDSSQGKQYMNTRCPAWCDRILMSHSAKELLLKSENDERIVLYDHIGPNICMGDHKPVFLSFRVATGAGKTNAHV 425          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Xenopus
Match: inpp5a.1 (inositol polyphosphate-5-phosphatase A [Source:NCBI gene;Acc:548959])

HSP 1 Score: 291.967 bits (746), Expect = 4.081e-91
Identity = 176/409 (43.03%), Postives = 247/409 (60.39%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLI--RDNLEN-VKYHMIGLGSCVGDHKPIYLSF 1311
            LL++AN+G+ FD  + +  +W+     T+   +P F ++HCQEVGGKNYE SM +VD  VK LL   A+  +N+AR+YLDE++  +E FTALGSFYF+HES+ NV Q+DF A ++  V G+E++S  +E      KEKFP EFFPE+K SRKGFI TRW I D   D VNIHLFHD  N+      PS YS  R +AL Y L  VT +  EK+P F+FGDFNFRL  + +++ L   +TT++ V+         + K+V+R+ E         ND+          +L+I +K+F+   FN       E+FR+        FD+E   F   L+E  ++FPPSYP++E+ +    YM TRCP+WCDRI ++  AK L+   +N E  V Y  IG   C+GDHK  +L+F
Sbjct:   13 LLVTANVGTLFDDTENLQKNWLREFYQTVHAQKPQFLSLHCQEVGGKNYEASMAHVDKLVKDLLSSDAMKEFNRARVYLDENYKSQENFTALGSFYFLHESLKNVYQYDFKAKKYRKVTGKEIYSDTLESTPMLEKEKFPQEFFPESKSSRKGFIRTRWCITDCAFDLVNIHLFHDASNVIAWESSPSIYSGIRQKALSYVLNSVTDHRFEKVPFFVFGDFNFRLDLKSVVETLC-AKTTMQTVHA---ADTNAVDKLVFRESE---------NDR--------KVVLQIEKKLFEY--FN------QEVFRDNNGTALLEFDKELSVFKDRLYELDITFPPSYPYSEDSSQGKQYMNTRCPAWCDRILMSHSAKELLLKSENDERIVLYDHIGPNICMGDHKG-FLTF 391          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Xenopus
Match: inpp5a.1 (inositol polyphosphate-5-phosphatase A [Source:NCBI gene;Acc:548959])

HSP 1 Score: 289.271 bits (739), Expect = 3.499e-90
Identity = 179/423 (42.32%), Postives = 246/423 (58.16%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLEN----VKYHMIGLGSCVGDHKPIYLSFCINPSATQMDYEV 1350
            LL   N+ S     D  F      V  T+   +P F ++HCQEVGGKNYE SM +VD  VK LL   A+  +N+AR+YLDE++  +E FTALGSFYF+HES+ NV Q+DF A ++  V G+E++S  +E      KEKFP EFFPE+K SRKGFI TRW I D   D VNIHLFHD  N+      PS YS  R +AL Y L  VT +  EK+P F+FGDFNFRL  + +++ L   +TT++ V+         + K+V+R+ E         ND+          +L+I +K+F+   FN       E+FR+        FD+E   F   L+E  ++FPPSYP++E+ +    YM TRCP+WCDRI ++  AK L+  + EN    V Y  IG   C+GDHKP++LSF +   A + +  V
Sbjct:   11 LLFEPNVSSLLCLADHSFPF----VLQTVHAQKPQFLSLHCQEVGGKNYEASMAHVDKLVKDLLSSDAMKEFNRARVYLDENYKSQENFTALGSFYFLHESLKNVYQYDFKAKKYRKVTGKEIYSDTLESTPMLEKEKFPQEFFPESKSSRKGFIRTRWCITDCAFDLVNIHLFHDASNVIAWESSPSIYSGIRQKALSYVLNSVTDHRFEKVPFFVFGDFNFRLDLKSVVETLC-AKTTMQTVH---AADTNAVDKLVFRESE---------NDR--------KVVLQIEKKLFEY--FN------QEVFRDNNGTALLEFDKELSVFKDRLYELDITFPPSYPYSEDSSQGKQYMNTRCPAWCDRILMSHSAKELLLKS-ENDERIVLYDHIGPNICMGDHKPVFLSFRVATGAGKTNAHV 399          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Xenopus
Match: fam204a (family with sequence similarity 204 member A [Source:Xenbase;Acc:XB-GENE-5961800])

HSP 1 Score: 256.529 bits (654), Expect = 4.489e-78
Identity = 147/399 (36.84%), Postives = 218/399 (54.64%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFL---IRDNLENVKYHMIGLGSCVGDHKPIYL 1305
            + I+ANIGS  D P  M  +W   +  TI    P F A+H QE GGK YE++M+  +  ++ L++ Q L+ Y + + ++D D++  E+FTALGS Y IH+S++ ++ ++F    F    G  LF  ++       KE+FP +F+ E  W+RKGF+ TRW++ D   D VN+HLFHD  NL  +   PS YS  RS+AL + L ++    +E++P F+FGDFNFRL  +  I  L E  T  E   K +         ++Y +                 G  K    L I  K+FD            +  R FD EP+ F   L E P+ FPPSYPF+E+   P+ +M TRCPSWCDR+ ++  A+ L   ++D   +V+Y  IG   C+GDHKP++L
Sbjct:    7 MFITANIGSLSDQPGEMQKNWFQELFQTIHRCNPEFIAMHLQEFGGKEYEKNMEAAEKLIRMLIESQELSSYERVQAFIDTDYSQPERFTALGSIYLIHKSLNRIQIYNFKEKHFATFSGHNLFLGSLGDCPLVQKERFPQDFWKEFPWTRKGFMRTRWQLHDRTFDLVNLHLFHDASNLISLELSPSIYSLNRSKALNHVLNRLQD--TEEVPFFLFGDFNFRLDLKSFI--LAESWTQKEMTEKGT---------VLYEQ----------------EGLVK----LIIQNKVFDHKNMEIFQENNVQSLRKFDSEPLPFLSRLAEMPIFFPPSYPFSEDITRPSQFMGTRCPSWCDRVLMSYSARALLNKVKDEESDVQYDRIGADVCMGDHKPVFL 372          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Mouse
Match: Inpp5a (inositol polyphosphate-5-phosphatase A [Source:MGI Symbol;Acc:MGI:2686961])

HSP 1 Score: 310.842 bits (795), Expect = 1.522e-98
Identity = 176/417 (42.21%), Postives = 250/417 (59.95%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVK---YHMIGLGSCVGDHKPIYLSFCINPSATQ 1335
            LL++AN+GS FD P+ +  +W+      +  ++P F A+HCQE GGKNYE SM +VD FVK LL   A+  YN+AR+YLDE++  +E FTALGSFYF+HES+ N+ Q+DF A ++  V G+E++S  +E      KEKFP ++FPE KWSRKGFI TRW I D   D VNIHLFHD  NL      PS YS  R +AL Y L+++     EK+  F+FGDFNFRL ++ +++ L   + T++ V         E+ K+++R  ES  D+                 +L++ +K+FD   FN       ++FR+        FD+E   F   L+E  +SFPPSYP++E+ +    YM TRCP+WCDRI ++  AK L+  +    K   Y  IG   C+GDHKP++L+F I P A +
Sbjct:   13 LLVTANVGSLFDDPENLQKNWLREFYQVLHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYKKVTGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGVRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLC-TKATMQTV---RAADTNEVVKLIFR--ESDNDRKV---------------VLQLEKKLFDY--FN------QDVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDSSQGEQYMNTRCPAWCDRILMSLSAKELVLKSESEEKVATYDHIGPNVCMGDHKPVFLAFRIAPGAGK 400          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Mouse
Match: Inpp5a (inositol polyphosphate-5-phosphatase A [Source:MGI Symbol;Acc:MGI:2686961])

HSP 1 Score: 311.227 bits (796), Expect = 1.589e-98
Identity = 176/417 (42.21%), Postives = 250/417 (59.95%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVK---YHMIGLGSCVGDHKPIYLSFCINPSATQ 1335
            LL++AN+GS FD P+ +  +W+      +  ++P F A+HCQE GGKNYE SM +VD FVK LL   A+  YN+AR+YLDE++  +E FTALGSFYF+HES+ N+ Q+DF A ++  V G+E++S  +E      KEKFP ++FPE KWSRKGFI TRW I D   D VNIHLFHD  NL      PS YS  R +AL Y L+++     EK+  F+FGDFNFRL ++ +++ L   + T++ V         E+ K+++R  ES  D+                 +L++ +K+FD   FN       ++FR+        FD+E   F   L+E  +SFPPSYP++E+ +    YM TRCP+WCDRI ++  AK L+  +    K   Y  IG   C+GDHKP++L+F I P A +
Sbjct:   13 LLVTANVGSLFDDPENLQKNWLREFYQVLHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYKKVTGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGVRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLC-TKATMQTV---RAADTNEVVKLIFR--ESDNDRKV---------------VLQLEKKLFDY--FN------QDVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDSSQGEQYMNTRCPAWCDRILMSLSAKELVLKSESEEKVATYDHIGPNVCMGDHKPVFLAFRIAPGAGK 400          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Mouse
Match: Inpp5a (inositol polyphosphate-5-phosphatase A [Source:MGI Symbol;Acc:MGI:2686961])

HSP 1 Score: 291.967 bits (746), Expect = 2.865e-91
Identity = 168/405 (41.48%), Postives = 240/405 (59.26%), Query Frame = 1
Query:  154 FPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVK---YHMIGLGSCVGDHKPIYLSFCINPSATQ 1335
             P+ +  +W+      +  ++P F A+HCQE GGKNYE SM +VD FVK LL   A+  YN+AR+YLDE++  +E FTALGSFYF+HES+ N+ Q+DF A ++  V G+E++S  +E      KEKFP ++FPE KWSRKGFI TRW I D   D VNIHLFHD  NL      PS YS  R +AL Y L+++     EK+  F+FGDFNFRL ++ +++ L   + T++ V         E+ K+++R+         S ND+          +L++ +K+FD   FN       ++FR+        FD+E   F   L+E  +SFPPSYP++E+ +    YM TRCP+WCDRI ++  AK L+  +    K   Y  IG   C+GDHKP++L+F I P A +
Sbjct:   33 LPENLQKNWLREFYQVLHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYKKVTGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGVRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLC-TKATMQTV---RAADTNEVVKLIFRE---------SDNDR--------KVVLQLEKKLFDY--FN------QDVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDSSQGEQYMNTRCPAWCDRILMSLSAKELVLKSESEEKVATYDHIGPNVCMGDHKPVFLAFRIAPGAGK 408          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Mouse
Match: Inpp5k (inositol polyphosphate 5-phosphatase K [Source:MGI Symbol;Acc:MGI:1194899])

HSP 1 Score: 50.0618 bits (118), Expect = 7.490e-6
Identity = 44/140 (31.43%), Postives = 60/140 (42.86%), Query Frame = 1
Query:  970 DKILEIGRKIFDIPEFNSCFVEKSEMFRNFDE--EPIHFF------QYLHEF---PVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLN---------------PEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSF 1311
            D IL  G   F I +F   FV++S   + + E  E    F      Q L EF   P+ FPP+Y F+   NN +   K R P+W DRI                  P + FL+   L+N   HM      + DHKP+  +F
Sbjct:  203 DLILWFGDMNFRIEDFGLLFVQESITRKYYKELWEKDQLFIAKKNDQLLREFQEGPLLFPPTYKFDRHSNNYDTSEKKRKPAWTDRILWRLKRQPSQASPLASSVPTSYFLL--TLKNYVSHM---AYSISDHKPVTGTF 337          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. UniProt/SwissProt
Match: sp|Q14642|I5P1_HUMAN (Inositol polyphosphate-5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5A PE=1 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 7.869e-100
Identity = 179/418 (42.82%), Postives = 251/418 (60.05%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKI-LEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAK-FLIRDNLEN--VKYHMIGLGSCVGDHKPIYLSFCINPSATQ 1335
            LL++AN+GS FD P+ +  +W+      +  ++P F A+HCQE GGKNYE SM +VD FVK LL   A+  YN+AR+YLDE++  +E FTALGSFYF+HES+ N+ Q+DF A ++  V G+E++S  +E      KEKFP ++FPE KWSRKGFI TRW I D   D VNIHLFHD  NL      PS YS  R +AL Y L+++     EK+  F+FGDFNFRL ++ +++ L   + T++ V         E+ K+++R+                   D D K+ L++ +K+FD   FN       E+FR+        FD+E   F   L+E  +SFPPSYP++E+      YM TRCP+WCDRI ++P AK  ++R   E   V Y  IG   C+GDHKP++L+F I P A +
Sbjct:   13 LLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLC-TKATMQTV---RAADTNEVVKLIFRES------------------DNDRKVMLQLEKKLFDY--FN------QEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGK 400          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. UniProt/SwissProt
Match: sp|Q29467|I5P1_CANLF (Inositol polyphosphate-5-phosphatase A OS=Canis lupus familiaris OX=9615 GN=INPP5A PE=1 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 2.375e-98
Identity = 175/418 (41.87%), Postives = 249/418 (59.57%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKI-LEIGRKIFDIPEFNSCFVEKSEMFRN--------FDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLEN---VKYHMIGLGSCVGDHKPIYLSFCINPSATQ 1335
            LL++AN+GS FD P+ +  +W+      +  ++P F A+HCQE GGKNYE SM +VD FVK LL   A+  YN+AR+YLDE+F  +E FTALGSFYF+HES+ N+ Q+DF A ++  V G+E++S  +E      KEKFP ++FPE KWSRKGF+ TRW + D   D VNIHLFHD  NL      PS YS  R +AL Y L+++     EK+  F+FGDFNFRL ++ +++ L   + T++ V         E+ K+++R+                   D D K+ L++ +K+F    FN       E+FR+        FD+E   F   L+E  +SFPPSYP++E+      YM TRCP+WCDR+ ++P A+ LI  +      V Y  IG   C+GDHKP++L+F I P A +
Sbjct:   13 LLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENFKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYKKVTGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFVRTRWCVADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLC-TKATMQTV---RAADTNEVVKLIFRES------------------DNDRKVMLQLEKKLFHY--FN------QEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDSGQGRQYMNTRCPAWCDRVLMSPSARELILKSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIAPGAGK 400          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. UniProt/SwissProt
Match: sp|Q17848|I5P1_CAEEL (Probable type I inositol 1,4,5-trisphosphate 5-phosphatase OS=Caenorhabditis elegans OX=6239 GN=ipp-5 PE=2 SV=2)

HSP 1 Score: 221.09 bits (562), Expect = 1.120e-63
Identity = 152/415 (36.63%), Postives = 226/415 (54.46%), Query Frame = 1
Query:  115 FLLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESV-SNVKQWDFTANEFIPVEG-RELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIP-LFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQ-GKNEEIRKIVYRKLESPIDKMTSFNDKVS-----NGFDKDDK----ILEIGRKIFDIPEFN-SCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCI 1317
            +LLI+AN+GS F+   R+  SWI  V   ++  +P FF IH QE GGK + E  Q V   +  L    AL  ++  R Y+D D+   E +TALG+  FI  S+ SNV Q++F   ++  +   +E+ +  +E+  +  K KFP +F+P  KW RKG++ TRWKI + V DFVN HLFHD  NLA I ++P  YS  R RAL + L +++   +   P LF+FGD NFRL ++  + +L E RT    V  + Q G   +  +     L+       +    VS        D DD     +L I +K FD   FN    ++    +R+ D+E    FQ + E  ++FPP+YP++E+  N    MKTR P+WCDR+ +N  A  L+ +     +Y   G+ +C GDHKP+ L+F I
Sbjct:    4 YLLITANVGSLFEPDARLHTSWIKTVADQVESVDPSFFVIHLQETGGKKFTECSQQVPIIINRL--STALPKFDLLRAYVDIDYEAIE-YTALGALCFIKRSLWSNVSQFNFHTKKYEQLTSPKEVVTHGLENYPYVVKHKFPKDFWPSIKWGRKGYMQTRWKIENKVFDFVNAHLFHDESNLALIHENPQLYSQNRKRALDFVLAELSSKENGCTPLLFVFGDLNFRLDSRSFLNRLTE-RTAQHPVADQEQMGSLADGLQASAANLQVITHPSENLRRTVSAIEFRRESDSDDSQNSCVLRIEKKKFDY--FNHKKLLDDWRSYRDDDKE-TENFQSMFEMHINFPPTYPWSEDPENSETLMKTRAPAWCDRVLMNKNAYSLVEEG--EPQYRSFGMETCTGDHKPVMLTFNI 409          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. TrEMBL
Match: A0A210Q2G2 (Type I inositol 1,4,5-trisphosphate 5-phosphatase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17638 PE=4 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 2.727e-105
Identity = 187/404 (46.29%), Postives = 256/404 (63.37%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAK-FLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCINPS 1326
            LLISAN+GS F+ PD M   W+     T+Q+YEP   A+HCQEVGGKNYE SMQ+V++FVK +L  + L  Y++ R++LDED+T  +KFTALG+ YFIHES+ +V  WDF   +F+PV GRE+ S NIE++  K K KFP +FFP+ KWSRKGFI TRW I + + D VNIHLFHD  N+  +   PS YS  R  AL +TL++  K+  +K+P+FIFGDFNFRL   +L+  L     T      +++GK ++I KIVY + E     + S   K   GFD  DK  E+             F +K++  R +D+E   +   L+EF +SF PSYPF+E+  +   YMKTRCPSWCDRI ++  AK  ++ ++    +Y +IG   C+GDHKP+YL   I  S
Sbjct:    9 LLISANVGSIFEDPDHMLKLWLTEFLKTVQQYEPGLLALHCQEVGGKNYEASMQHVNSFVKSMLGCEELQKYDRVRVFLDEDYTAADKFTALGNLYFIHESIDDVMIWDFVDCKFVPVLGREVLSGNIENVQIKEKAKFPQDFFPDFKWSRKGFIRTRWNIRNCLFDLVNIHLFHDASNIIAMQTSPSVYSNNRKAALLHTLQRFEKDQYDKVPMFIFGDFNFRLDVHQLVSSLTSKTKT-----HQTKGKKDQIAKIVYSE-EGNGKTVLSIETK---GFDHHDKHAEV-------------FSKKAKYLRPYDKEIYSYKDKLYEFDISFAPSYPFSEDITDGLSYMKTRCPSWCDRILMSSSAKNIVVNEDKYQPRYDIIGKEICMGDHKPVYLYLHIKRS 390          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. TrEMBL
Match: A0A2R2MIC4 (type I inositol 1,4,5-trisphosphate 5-phosphatase isoform X2 OS=Lingula unguis OX=7574 GN=LOC106179883 PE=4 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 5.548e-105
Identity = 186/409 (45.48%), Postives = 257/409 (62.84%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKI-LEIGRKIFDIPEFNSCFVEKSEM-FRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCINPSATQM 1338
            +LI+AN+GS F+ P+RM   W+N    T+ + +P+F AIH QEVGGKNYEESMQYV++F+K +L  + L CY+KAR++LDEDFT  +KFTALGS YF H S++ V+ +DF A +F+P  GRE+ S NIE +  K K KFP  +FPE +WSRKGFI TRW I   + D +NIHLFHD  N+  +++ PSTY   R RALQ+T E++  +  EK+P F+FGDFNFRL T   +K L +    +E+  K    KN E+ K+ Y++                   D D KI L + +K FD       F + + +    +D+E   F   ++E  ++FPPSYPF+E  ++   YMKTRCP WCDRIF++  AK +I D+     Y  IG   C+GDHKPIYL F +  +A +M
Sbjct:   16 MLITANVGSIFEDPERMLKMWLNEFVATVTKLQPMFLAIHMQEVGGKNYEESMQYVNHFIKTMLASEDLECYDKARVFLDEDFTAVDKFTALGSLYFAHVSMTAVEVFDFQAKKFVPFVGREVLSGNIESVPIKEKAKFPQNYFPECRWSRKGFIRTRWNICGSIFDLINIHLFHDANNIEAMLQSPSTYCEHRQRALQHTFERIENDEYEKVPFFLFGDFNFRLDTYYFMKDLTKNLVAVESRSK----KNNELVKLTYKEA------------------DNDQKIVLVVEKKGFDHLRMKEIFYDNNGLSLLPYDKEIEPFRDRVYEHDINFPPSYPFSESLDDGVNYMKTRCPGWCDRIFVSYSAKSIIDDSSGPPLYLCIGKEVCMGDHKPIYLYFNLKHNAGKM 402          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. TrEMBL
Match: A0A2R2MIE9 (type I inositol 1,4,5-trisphosphate 5-phosphatase isoform X1 OS=Lingula unguis OX=7574 GN=LOC106179883 PE=4 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 5.240e-104
Identity = 186/409 (45.48%), Postives = 257/409 (62.84%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKI-LEIGRKIFDIPEFNSCFVEKSEM-FRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCINPSATQM 1338
            +LI+AN+GS F+ P+RM   W+N    T+ + +P+F AIH QEVGGKNYEESMQYV++F+K +L  + L CY+KAR++LDEDFT  +KFTALGS YF H S++ V+ +DF A +F+P  GRE+ S NIE +  K K KFP  +FPE +WSRKGFI TRW I   + D +NIHLFHD  N+  +++ PSTY   R RALQ+T E++  +  EK+P F+FGDFNFRL T   +K L +    +E+  K    KN E+ K+ Y++                   D D KI L + +K FD       F + + +    +D+E   F   ++E  ++FPPSYPF+E  ++   YMKTRCP WCDRIF++  AK +I D+     Y  IG   C+GDHKPIYL F +  +A +M
Sbjct:   16 MLITANVGSIFEDPERMLKMWLNEFVATVTKLQPMFLAIHMQEVGGKNYEESMQYVNHFIKTMLASEDLECYDKARVFLDEDFTAVDKFTALGSLYFAHVSMTAVEVFDFQAKKFVPFVGREVLSGNIESVPIKEKAKFPQNYFPECRWSRKGFIRTRWNICGSIFDLINIHLFHDANNIEAMLQSPSTYCEHRQRALQHTFERIENDEYEKVPFFLFGDFNFRLDTYYFMKDLTKNLVAVESRSK----KNNELVKLTYKEA------------------DNDQKIVLVVEKKGFDHLRMKEIFYDNNGLSLLPYDKEIEPFRDRVYEHDINFPPSYPFSESLDDGVNYMKTRCPGWCDRIFVSYSAKSIIDDSSGPPLYLCIGKEVCMGDHKPIYLYFNLKHNAGKM 402          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. TrEMBL
Match: A0A3S1A0D1 (IPPc domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_004743 PE=4 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 1.454e-103
Identity = 224/580 (38.62%), Postives = 316/580 (54.48%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNS-CFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAK-FLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCINPSATQMDYEVKDEESINDNTFKSNETNAANDTEPVNDMFTDITKLSTEEINVSPQLITNSSSNRRLFNSVVTNDFSRRKRHSI----VDSINGLRASIDIDKYNEMW---NIFDNGRFDKETELDIKFRLSHRPYIGMSSSVDELSNPPNNTR----TGQSLFIQAARNITTAENVI 1818
            LLI+AN+GS F+ PD MF  W+      IQ Y+P   A+HCQEVGGKNYE SMQ+V+ FVK LL  + LN +++ARI+LDED+T  +KFTALG+ YFIHE VS+V  WDF   +FI VEGRE+ S NIE++  K K KFP  FFPE KWSRKGF+ TRW + + + D +NIHLFHD  N+  +   PS Y+  R+RAL +TL++   +   K+P+FIFGDFNFRL + +LIK+L     T + V  +++GK + + KI Y +           N KV         +L +  K FD  E ++  F   ++    +D E   F   L E+ + FPPSYPF E+  +   YMKTR PSWCDR+ LN  +K  L +D+  +  Y +IG  +C+GDHKP+YL   + P   +   E+              E N   D        +D+ +   E ++++     +SS + +       +DF R +  SI    V    GLR S      +  W   NI D  +F++E  L   FR S +   G   S  E     N ++    T +  F + A  + T E V+
Sbjct:    9 LLITANVGSIFEEPDSMFPGWLKSFFECIQTYKPGILALHCQEVGGKNYEASMQHVNQFVKILLSCEELNKFDRARIFLDEDYTAADKFTALGNLYFIHEDVSDVLIWDFVDCKFIEVEGREVLSGNIENVPIKEKAKFPQHFFPEFKWSRKGFLRTRWSVNNCIFDLINIHLFHDASNIVAMESSPSLYAGNRARALLHTLQRFENDKYSKVPIFIFGDFNFRLDSYRLIKEL-----TAKLVASQTKGKKDMVNKIEYTE---------EGNGKV---------VLTVAIKNFDYYEKHTDLFASMNKWLHQYDAEGSSFRDRLFEYEIGFPPSYPFCEDVADGISYMKTRVPSWCDRVLLNHGSKDILSQDSCHSPVYDLIGRDTCMGDHKPVYLYVLMKPGKGKHLVEI--------------ENNLIVD--------SDLQQPQKEVVDMA----VSSSLDSQSLTPDTPSDFRRPRTLSINGEKVGIFLGLRGSDAETAQDVDWSLVNIHDYAKFEQEKYLMPDFRNSIKKLEGEEGS--ETGAGENASKKSGMTRKRSFKEMASKVRTMEKVL 537          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. TrEMBL
Match: A0A1B6LB85 (IPPc domain-containing protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.46556 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 4.811e-103
Identity = 177/410 (43.17%), Postives = 250/410 (60.98%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKS-EMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIR--DNLENVKYHMIGLGSCVGDHKPIYLSFCINPSATQM 1338
            L I+AN+GS F+ P+ M   W      T+   EP F A+HCQEVGGKNYE+SM++V+ FV+ L+  + L  +++ R+YLDED++  E FTALG+FYFIHESV +V  WDF    F+ VEG+++ S NIE +  K K KFP +FFPE KWSRKGF+ TRW +   V D VN+HLFHD  N   +   PS YS  R RAL+YTL++   +     P F+FGDFNFR  TQ +IK+L +    +E     +  KN EI K++YR  ES +                   +L +G+K F   +  + F+E + E  + FD+E  HF   L EFP+ FPPSYP+ E+    + YM+TRCP+WCDR+ L+  A+ L+   D   +++Y  IG  +C+GDHKP++L   +   A ++
Sbjct:    8 LFITANVGSIFEEPNVMLKLWTEEFLSTVSRLEPKFLALHCQEVGGKNYEQSMKHVEYFVRLLMTSEELRLFDRVRVYLDEDYSSAENFTALGNFYFIHESVPDVLIWDFKELNFVAVEGKDVHSGNIEDVPTKEKSKFPQDFFPECKWSRKGFLRTRWNLNGTVFDLVNLHLFHDASNFVAMETFPSVYSKTRQRALEYTLDRFHTDKYGSAPFFLFGDFNFRTDTQAVIKKLADGLNPVE----VNSAKNNEINKLLYRDQESQV-------------------VLTLGKKEFSHCDHQNLFIENAGEWLKEFDKELEHFAGQLFEFPIHFPPSYPYEEDTQVGHQYMQTRCPAWCDRVVLSETARLLVHKMDEDGSIEYGSIGENTCMGDHKPVFLRLSVVGEAGRV 394          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Cavefish
Match: INPP5A (inositol polyphosphate-5-phosphatase A [Source:NCBI gene;Acc:103037390])

HSP 1 Score: 303.138 bits (775), Expect = 1.277e-95
Identity = 172/409 (42.05%), Postives = 254/409 (62.10%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLI---RDNLENVKYHMIGLGSCVGDHKPIYLSFCINPSATQ 1335
            LL +AN+GS F+ P  +  +W+     T+  ++P F A+HCQEVGGKNYEESM +VD+FVK LL   A+  +N+AR+YLDE++  +E FTALGS YF+HES+ N+ Q+DF A +F  V G+E++S  +E  +   KEKFP ++FPE KWSRKGFI TRW + D   D VNIHLFHD  NL      PS YS  R +AL Y L+++T    E++P F+FGDFNFRL ++++I+ L     T++ V  +++  N E+ K+++R+         S ND+          +L++ +K+F+    +        +   FD+E   F   L E  +SFPPSYP++E+ N    YM TRCP+WCDRI ++  A+ L+     + +++ Y  IG   C+GDHKP++LSF +   A +
Sbjct:   13 LLATANVGSLFEDPTNLQKTWLREFYQTVHTHKPHFVALHCQEVGGKNYEESMAHVDSFVKELLSSDAMKEFNRARVYLDENYKSQEHFTALGSCYFVHESLKNLHQFDFKAKKFKKVAGKEIYSDTLESTSMLEKEKFPQDYFPECKWSRKGFIRTRWALGDCAFDLVNIHLFHDASNLVAWENSPSVYSGTRQKALGYVLDRITDQRYERVPYFLFGDFNFRLDSKQVIESLCST-ATMQTV--RAEDTN-EVDKLIFRE---------SDNDR--------KVVLQLEKKLFNYINQDVFRENNGTLLLEFDKELSVFKDRLQELEISFPPSYPYSEDSNQGKQYMNTRCPAWCDRILMSSSARDLVLKPETDEKSITYDNIGANVCMGDHKPVFLSFRLTAGAGK 400          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Cavefish
Match: inpp5l (inositol polyphosphate-5-phosphatase L [Source:ZFIN;Acc:ZDB-GENE-051127-29])

HSP 1 Score: 235.343 bits (599), Expect = 2.325e-70
Identity = 146/408 (35.78%), Postives = 220/408 (53.92%), Query Frame = 1
Query:  112 DFLLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKI-LEIGRKIFDIPEFNSCFVEKS--EMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLE---NVKYHMIGLGSCVGDHKPIYLSFCI 1317
            D LL++AN+GS FD    +   W+     T+  ++P F A+H QEVGGK+Y  +M + +NF                       F +     ALGS YFIH+S+ N++Q+DF+A EF  V G   +  +++ +    KEKFP  F+P+ KWSRKG++ TRW I +  +D VN+HLFHD  NL      PS YS  R +AL+Y + +++ +    +P F+FGDFNFRL TQ L++ L    +T   V    +  + E+ KI+Y +                   D D K+ L I  K+F      + F E +  E+ + +D+E   F   + E  + FPPSYP++E+   P  YM TRCPSWCDRI ++   + +I+   E   N+ Y+ +G   C+GDHKP++L F +
Sbjct:    6 DVLLVTANVGSLFDNVGEIERDWLREFFTTVHTHKPCFIALHFQEVGGKDYMVNMAHAENFFC-------------------LSFLLCLSLQALGSMYFIHKSLKNIQQYDFSAKEFKSVSGHNKYVGSLDGVATVEKEKFPKNFWPDIKWSRKGYMRTRWIIHNQGLDLVNVHLFHDASNLIACNSSPSVYSTNRQKALRYVINRISDSSYSPLPFFLFGDFNFRLDTQSLVQNL----STSAEVQTVKKDSSNEVEKIIYEEK------------------DNDHKVLLHIETKLFAYLH-QAVFRENNGKELLK-YDKEIAAFHDVITEEQILFPPSYPYSEDYTKPTQYMNTRCPSWCDRILMSHSTQDIIQRREEGESNIVYNTLGPNVCMGDHKPVFLFFAL 370          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Yeast
Match: INP51 (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase; synaptojanin-like protein with an N-terminal Sac1 domain, plays a role in phosphatidylinositol 4,5-bisphosphate homeostasis and in endocytosis; null mutation confers cold-tolerant growth [Source:SGD;Acc:S000001264])

HSP 1 Score: 48.9062 bits (115), Expect = 2.323e-6
Identity = 26/77 (33.77%), Postives = 35/77 (45.45%), Query Frame = 1
Query: 1081 FQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSF 1311
            F Y HE  + FPP+Y F+    N +   K R P+W DRI    E        LE ++Y          DH+P+Y  F
Sbjct:  752 FPYFHEMAIDFPPTYKFDPGTKNYDTSEKMRIPAWTDRILSRGEV-------LEQLEYKCCE-DILFSDHRPVYAIF 820          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Nematostella
Match: EDO49130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGY0])

HSP 1 Score: 251.906 bits (642), Expect = 1.118e-76
Identity = 152/404 (37.62%), Postives = 239/404 (59.16%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGK-NYEESMQYVDNFVKFLLKDQALNC-YNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEA-KFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCIN 1320
            LLI+AN+GS F+  +     W+  +  T ++++P F A+H QE GGK   E + + V++F + LLK++ +   +++   ++D+DF   EKFTALG  YFI +S+ N+  W+   ++F+  +  E+   ++  ++   K KFP EFFP+ KWSRKGF+ TRWKI + + D +NIHLFHD  NL  +   PS YS  R RAL++ LE++  +   K P  +FGDFNFRL T+ +++ L      +++ Y +  G++    K+++R      DK  S  DKV         +L +  K F + + +    E  + F+ ++ E   F   L+EF +SFPPSYPF+++      Y  +RCPSWCDR+FL+  A K +I+D   +V Y MIG   C+GDHKP+YL F ++
Sbjct:    9 LLITANVGSLFEDRENKEKIWVEKILETFEKFDPSFVALHFQECGGKVAAEAAFESVEDFTRALLKNEKICLRFDRRFAWIDQDFQKAEKFTALGCIYFIKKSLKNILVWNHQESQFVSTKVEEIKVGDLSDVSCVQKLKFPREFFPQLKWSRKGFMRTRWKINNCIFDLLNIHLFHDASNLEAMQMSPSDYSQARHRALKHILERLENDSLPKAPCILFGDFNFRLDTKAVVESLC---AGLQSQYIRKDGESIP-SKVLFR------DKKIS--DKV---------VLAVETKKFVVHDQSYFHSEDGKRFQKYNREFEEFQNKLYEFNISFPPSYPFSDDIKEGMLYNNSRCPSWCDRVFLSHSARKMVIQDVDHSVTYDMIGRKVCMGDHKPVYLHFYLD 391          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Medaka
Match: INPP5A (inositol polyphosphate-5-phosphatase A [Source:NCBI gene;Acc:101156112])

HSP 1 Score: 325.094 bits (832), Expect = 3.738e-104
Identity = 178/409 (43.52%), Postives = 248/409 (60.64%), Query Frame = 1
Query:  118 LLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAK--FLIRDNLE-NVKYHMIGLGSCVGDHKPIYLSFCINPSATQ 1335
            LL++AN+GS F+ P+ +  +W+     T+Q ++P F A+HCQEVGGKNYE SM +V +FVK LL   AL  YN+AR+YLDED+  +E FTALGSFYFIHE++ N++Q+DF A  F  V GRE  S  +E  +   K KFP +++P+ KWSRKGFI TRW + D   D VNIHLFHD  NL      PS YS  R +AL + L+++T    EK+P FIFGDFNFRL +    KQ +E   +   +   + GK  E+ K+++R+++         NDK          +L++ +K+F+    +            FD+E   F   L E  +SFPPSYP++E+      YM TRCP+WCDRI ++P A+  F   +N E +V Y  IG   C+GDHKP++LSF I   A +
Sbjct:   14 LLVTANVGSLFEDPENLQKTWLREFYQTVQSHKPHFLALHCQEVGGKNYEASMSHVGSFVKELLSSDALMEYNRARVYLDEDYKSKEHFTALGSFYFIHETLKNIQQFDFNAKIFEKVVGRETCSETLESRSSLEKAKFPKDYYPQCKWSRKGFIRTRWALADWTFDLVNIHLFHDASNLVAWENSPSVYSTTRQKALGFVLDRITDQRYEKVPYFIFGDFNFRLDS----KQFIESVCSTATMQTVTTGKTNEVDKLIFREID---------NDK--------KVVLQLEKKLFNYVNQDVFRENNGTSLLEFDKELTPFKDRLIELEISFPPSYPYSEDSTQGKEYMNTRCPAWCDRILMSPSARDQFFKPENEEKSVTYDNIGANVCMGDHKPVFLSFRIAAGAGK 401          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Medaka
Match: inpp5l (type I inositol 1,4,5-trisphosphate 5-phosphatase [Source:NCBI gene;Acc:101171587])

HSP 1 Score: 257.299 bits (656), Expect = 1.845e-78
Identity = 153/404 (37.87%), Postives = 223/404 (55.20%), Query Frame = 1
Query:  112 DFLLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKI-LEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIR---DNLENVKYHMIGLGSCVGDHKPIYLSF 1311
            D LL++AN+GS FD    +   W+  +   I +Y+P F A+H QEVGGK+Y  +M   +NF   L   + L  Y++  IY+D  F  E+ FTALG+ YFIH+++ NV Q+DF   +F  V G+  +   ++ +T   KEKFP  F+P  KWSRKGF+ TRW I +  +D VNIHLFHD  NL      PS YSA R  AL+Y + +++ +    +P F+FGDFNFRL T  L++ L     T   V     G N E++KI   +                   D D ++ L I  K+F          +       +D+E   F   + E  ++FPPSYP++E+ + P  YM TRCP+WCDRI ++  A  +I    D+ + + Y+ +G   C+GDHKP++LSF
Sbjct:    6 DVLLVTANVGSLFDNVGEIQNGWLQELFKAIHKYKPQFIALHFQEVGGKDYMVNMGNAENFFWLLESSEELKDYDRTCIYVDSQFQAEDSFTALGNMYFIHKTLKNVYQYDFNVKDFKAVLGQNKYVGCLDTVTTVEKEKFPKNFWPNFKWSRKGFMRTRWIIHNQGLDLVNIHLFHDASNLIACNASPSIYSANRKNALRYVINRLSDDRYTSLPFFLFGDFNFRLDTLSLVQHLC----TEAEVQTVKDGSN-EVQKIFCEEK------------------DNDHQVLLHIEEKLFQYLHQALFREDNGRALLIYDKETSAFHDDIKEEDITFPPSYPYSEDYSKPTQYMNTRCPAWCDRILMSHSAHDVIHRGEDDEKTIVYNTVGTNVCMGDHKPVFLSF 386          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Planmine SMEST
Match: SMESG000074184.1 (SMESG000074184.1)

HSP 1 Score: 1209.9 bits (3129), Expect = 0.000e+0
Identity = 621/624 (99.52%), Postives = 622/624 (99.68%), Query Frame = 1
Query:  166 MFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCINPSATQMDYEVKDEESINDNTFKSNETNAANDTEPVNDMFTDITKLSTEEINVSPQLITNSSSNRRLFNSVVTNDFSRRKRHSIVDSINGLRASIDIDKYNEMWNIFDNGRFDKETELDIKFRLSHRPYIGMSSSVDELSNPPNNTRTGQSLFIQAARNITTAENVISAFRQSINRKRKIXXXXXXXXXXXXXXXKIIGNDIIMETYQITPSVNNNANTQIQVVAENKKTNHKNSCCAIS 2037
            MFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHKFKEKFPLEFFPENKWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFND+VSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCINPSATQMDYEVKDEESINDNTFKSNETNAANDTEPVNDMFTDITKLSTEEINVSPQLI NSSSNRRLFNSVVTNDFSRRKRHSIVDSINGLRASIDIDKYNEMWNIFDNGRFDKETELDIKFRLSHRPYIGMSSSVDELSNPPNNTRTGQSLFIQAARNITTAENVISAFRQSINRKRKISDSSSENDLDEDQNNKIIGNDIIMETYQITPSVNNNAN QIQVVAENKKTNHKNSCCAIS
Sbjct:    1 MFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHKFKEKFPLEFFPENKWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDRVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEENNPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKPIYLSFCINPSATQMDYEVKDEESINDNTFKSNETNAANDTEPVNDMFTDITKLSTEEINVSPQLIANSSSNRRLFNSVVTNDFSRRKRHSIVDSINGLRASIDIDKYNEMWNIFDNGRFDKETELDIKFRLSHRPYIGMSSSVDELSNPPNNTRTGQSLFIQAARNITTAENVISAFRQSINRKRKISDSSSENDLDEDQNNKIIGNDIIMETYQITPSVNNNANIQIQVVAENKKTNHKNSCCAIS 624          
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Planmine SMEST
Match: SMESG000074184.1 (SMESG000074184.1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 293/294 (99.66%), Postives = 294/294 (100.00%), Query Frame = 1
Query:  166 MFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHXXXXXXXXXXXXXXXWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEM 1047
            MFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHKFKEKFPLEFFPENKWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFND+VSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEM
Sbjct:    1 MFASWINGVTVTIQEYEPIFFAIHCQEVGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALGSFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHKFKEKFPLEFFPENKWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSACRSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIENVYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDRVSNGFDKDDKILEIGRKIFDIPEFNSCFVEKSEM 294          
The following BLAST results are available for this feature:
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
INPP5A1.639e-10042.82inositol polyphosphate-5-phosphatase A [Source:HGN... [more]
INPP5A1.007e-9043.01inositol polyphosphate-5-phosphatase A [Source:HGN... [more]
INPP5A6.704e-6250.47inositol polyphosphate-5-phosphatase A [Source:HGN... [more]
INPP5A2.408e-2652.10inositol polyphosphate-5-phosphatase A [Source:HGN... [more]
INPP5A3.050e-2051.28inositol polyphosphate-5-phosphatase A [Source:HGN... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ipp-56.628e-6535.75Probable type I inositol 1,4,5-trisphosphate 5-pho... [more]
ipp-58.807e-6536.63Probable type I inositol 1,4,5-trisphosphate 5-pho... [more]
C01B10.32.930e-721.67pep chromosome:WBcel235:IV:6619468:6621352:-1 gene... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
5PtaseI1.113e-8739.76gene:FBgn0259178 transcript:FBtr0474081[more]
5PtaseI3.408e-8637.04gene:FBgn0259178 transcript:FBtr0299661[more]
5PtaseI2.785e-8340.10gene:FBgn0259178 transcript:FBtr0299660[more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
inpp5l1.214e-7737.05inositol polyphosphate-5-phosphatase L [Source:ZFI... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inpp5a.15.750e-9642.65inositol polyphosphate-5-phosphatase A [Source:NCB... [more]
inpp5a.18.679e-9240.72inositol polyphosphate-5-phosphatase A [Source:NCB... [more]
inpp5a.14.081e-9143.03inositol polyphosphate-5-phosphatase A [Source:NCB... [more]
inpp5a.13.499e-9042.32inositol polyphosphate-5-phosphatase A [Source:NCB... [more]
fam204a4.489e-7836.84family with sequence similarity 204 member A [Sour... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Inpp5a1.522e-9842.21inositol polyphosphate-5-phosphatase A [Source:MGI... [more]
Inpp5a1.589e-9842.21inositol polyphosphate-5-phosphatase A [Source:MGI... [more]
Inpp5a2.865e-9141.48inositol polyphosphate-5-phosphatase A [Source:MGI... [more]
Inpp5k7.490e-631.43inositol polyphosphate 5-phosphatase K [Source:MGI... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q14642|I5P1_HUMAN7.869e-10042.82Inositol polyphosphate-5-phosphatase A OS=Homo sap... [more]
sp|Q29467|I5P1_CANLF2.375e-9841.87Inositol polyphosphate-5-phosphatase A OS=Canis lu... [more]
sp|Q17848|I5P1_CAEEL1.120e-6336.63Probable type I inositol 1,4,5-trisphosphate 5-pho... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210Q2G22.727e-10546.29Type I inositol 1,4,5-trisphosphate 5-phosphatase ... [more]
A0A2R2MIC45.548e-10545.48type I inositol 1,4,5-trisphosphate 5-phosphatase ... [more]
A0A2R2MIE95.240e-10445.48type I inositol 1,4,5-trisphosphate 5-phosphatase ... [more]
A0A3S1A0D11.454e-10338.62IPPc domain-containing protein OS=Elysia chlorotic... [more]
A0A1B6LB854.811e-10343.17IPPc domain-containing protein (Fragment) OS=Graph... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
INPP5A1.277e-9542.05inositol polyphosphate-5-phosphatase A [Source:NCB... [more]
inpp5l2.325e-7035.78inositol polyphosphate-5-phosphatase L [Source:ZFI... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
INP512.323e-633.77Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO491301.118e-7637.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
INPP5A3.738e-10443.52inositol polyphosphate-5-phosphatase A [Source:NCB... [more]
inpp5l1.845e-7837.87type I inositol 1,4,5-trisphosphate 5-phosphatase ... [more]
back to top
BLAST of Type I inositol-1,4,5-trisphosphate 5-phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000074184.10.000e+099.52SMESG000074184.1[more]
SMESG000074184.10.000e+099.66SMESG000074184.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30008456 ID=SMED30008456|Name=Type I inositol-1,4,5-trisphosphate 5-phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=2152bp
ACATTATCTTTTGAAAAAATTTTGTGATTAAATTTTACCAAGCTTTAATG
TGTTATAAACTTTATAAATTAAATTATGAAATGTAAATGATAAAAAATGA
AATCTATTAATGATTTTTTATTAATATCTGCAAATATTGGTTCAACATTC
GATTTTCCTGATAGAATGTTTGCTTCTTGGATAAATGGTGTAACCGTTAC
GATCCAAGAGTATGAACCAATATTTTTTGCTATTCATTGCCAGGAAGTTG
GTGGAAAAAATTATGAAGAATCAATGCAGTATGTTGACAATTTTGTCAAG
TTTCTTTTAAAGGATCAAGCTCTCAATTGTTACAATAAAGCTCGCATTTA
TTTAGATGAGGATTTTACTGTAGAAGAAAAGTTTACTGCCCTTGGTAGTT
TCTATTTTATTCATGAATCAGTCTCAAATGTTAAACAATGGGATTTTACT
GCTAATGAATTCATTCCCGTGGAAGGAAGAGAACTTTTTAGTGCCAACAT
TGAACACATTACACATAAATTTAAAGAAAAATTTCCACTCGAGTTTTTTC
CAGAAAATAAGTGGTCAAGAAAAGGCTTTATTCATACACGTTGGAAGATT
TTAGATGTCGTTATAGATTTTGTGAACATTCATCTTTTTCATGATATATG
CAACTTAGCTCCCATTATCAAGGATCCTTCAACATATTCAGCGTGCAGAT
CTCGTGCCCTCCAATATACTCTGGAAAAGGTGACGAAAAACTACTCAGAA
AAGATTCCTCTATTCATTTTTGGTGATTTCAATTTCAGATTGACAACTCA
GAAGTTGATAAAACAATTAGTCGAACCGAGAACAACAATAGAAAATGTCT
ACAAAAAATCACAAGGTAAAAATGAGGAGATTAGGAAAATTGTTTATCGG
AAACTGGAATCACCCATTGACAAAATGACGTCTTTCAATGACAAAGTTTC
CAATGGATTTGATAAAGATGATAAAATCCTGGAAATTGGAAGAAAAATAT
TTGATATACCGGAATTCAATAGTTGTTTTGTGGAAAAATCAGAAATGTTC
AGAAATTTTGACGAAGAACCGATTCATTTTTTTCAATATTTACACGAATT
CCCAGTCTCATTTCCACCTAGTTATCCTTTTAATGAGGAAGAAAATAATC
CAAATTGTTACATGAAAACTCGTTGCCCATCGTGGTGTGATAGAATCTTT
TTGAATCCAGAAGCGAAATTTCTTATTCGTGACAATTTGGAAAATGTGAA
ATATCATATGATTGGATTGGGATCATGTGTCGGTGATCACAAGCCCATTT
ATTTGTCATTCTGCATAAATCCTTCCGCAACTCAAATGGATTATGAAGTA
AAAGATGAAGAAAGCATAAATGATAACACTTTTAAATCCAATGAAACCAA
CGCTGCAAATGATACCGAACCTGTTAACGATATGTTTACAGACATTACAA
AGCTGTCAACAGAAGAAATAAATGTCTCTCCTCAATTAATTACAAATAGT
TCTTCCAATCGTCGTTTGTTTAATTCTGTTGTAACTAATGATTTCAGTCG
ACGTAAACGGCATTCAATTGTTGATTCTATTAATGGTCTGAGAGCTTCAA
TTGATATTGATAAATACAATGAAATGTGGAATATATTCGATAATGGTAGA
TTTGATAAAGAAACTGAGTTAGATATCAAGTTCCGTTTATCTCATCGTCC
CTATATTGGCATGTCAAGTTCCGTTGATGAATTGTCAAACCCTCCAAACA
ATACCAGAACTGGGCAATCGTTATTTATTCAAGCTGCTAGAAATATTACT
ACTGCTGAGAATGTTATATCTGCCTTTCGTCAGTCTATTAATCGGAAGCG
AAAAATTTCCGATTCATCGTCTGAAAATGATCTTGACGAAGATCAAAATA
ATAAAATAATTGGTAATGATATTATTATGGAAACCTATCAAATAACACCA
TCTGTTAATAACAATGCAAATACTCAAATTCAAGTTGTGGCGGAGAACAA
AAAAACAAATCACAAAAATTCTTGTTGTGCCATATCTTAAATTGAAGACT
CTGTTCTACCTCAACTGAGCTTCATGATATACATATCTCTTGATTAATGG
ACGGCAATTTCCGTAATTAGTATTACTTTACGTAATAGTATTACTCAAAA
TG
back to top

protein sequence of SMED30008456-orf-1

>SMED30008456-orf-1 ID=SMED30008456-orf-1|Name=SMED30008456-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=648bp
MKSINDFLLISANIGSTFDFPDRMFASWINGVTVTIQEYEPIFFAIHCQE
VGGKNYEESMQYVDNFVKFLLKDQALNCYNKARIYLDEDFTVEEKFTALG
SFYFIHESVSNVKQWDFTANEFIPVEGRELFSANIEHITHKFKEKFPLEF
FPENKWSRKGFIHTRWKILDVVIDFVNIHLFHDICNLAPIIKDPSTYSAC
RSRALQYTLEKVTKNYSEKIPLFIFGDFNFRLTTQKLIKQLVEPRTTIEN
VYKKSQGKNEEIRKIVYRKLESPIDKMTSFNDKVSNGFDKDDKILEIGRK
IFDIPEFNSCFVEKSEMFRNFDEEPIHFFQYLHEFPVSFPPSYPFNEEEN
NPNCYMKTRCPSWCDRIFLNPEAKFLIRDNLENVKYHMIGLGSCVGDHKP
IYLSFCINPSATQMDYEVKDEESINDNTFKSNETNAANDTEPVNDMFTDI
TKLSTEEINVSPQLITNSSSNRRLFNSVVTNDFSRRKRHSIVDSINGLRA
SIDIDKYNEMWNIFDNGRFDKETELDIKFRLSHRPYIGMSSSVDELSNPP
NNTRTGQSLFIQAARNITTAENVISAFRQSINRKRKISDSSSENDLDEDQ
NNKIIGNDIIMETYQITPSVNNNANTQIQVVAENKKTNHKNSCCAIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004445inositol-polyphosphate 5-phosphatase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036691Endo/exonu/phosph_ase_sf
IPR039737INPP5A
IPR000300IPPc
IPR005135Endo/exonuclease/phosphatase
IPR011991WHTH_DNA-bd_dom
Vocabulary: biological process
TermDefinition
GO:0046856phosphatidylinositol dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000300Inositol polyphosphate-related phosphataseSMARTSM00128i5p_5coord: 2..413
e-value: 6.2E-42
score: 155.3
IPR036691Endonuclease/exonuclease/phosphatase superfamilyGENE3DG3DSA:3.60.10.10coord: 32..292
e-value: 2.1E-5
score: 26.5
IPR036691Endonuclease/exonuclease/phosphatase superfamilyGENE3DG3DSA:3.60.10.10coord: 306..441
e-value: 6.1E-14
score: 53.6
IPR036691Endonuclease/exonuclease/phosphatase superfamilySUPERFAMILYSSF56219DNase I-likecoord: 6..411
NoneNo IPR availablePANTHERPTHR12997:SF2TYPE I INOSITOL 1,4,5-TRISPHOSPHATE 5-PHOSPHATASEcoord: 6..415
IPR039737Type I inositol 1,4,5-trisphosphate 5-phosphatasePANTHERPTHR12997TYPE I INOSITOL-1,4,5-TRISPHOSPHATE 5-PHOSPHATASEcoord: 6..415